F465611

General Info

Members Datasets Scaffolds Average Seq Length
577 283 1154 448

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10000394|Ga0105246_1000039419
Length 470
Sequence VNKPSLATPLSLLGLCLLLSACAGNPDAVDSGITPPAAWHSAERAASQATNQRWWTHFGSPSLNRLIDQARRDSFDVAAAMARVRQAQATAVIAGAPLLPEVKFNLTATREKLLRGSGNSDLNATENNKTVTSYDANLTASYELDFWGARAAARDGALHSLQASRFDQANVELTLLSNVADRYAQTLAARQRVQIAELNLANARAVLDLVQTRYDAGSATALELAQQKSLVAGQQRQLPLVEQLAEEARITLAALLGQPVQALELGSEAFPALTWPTIGPGVPSQLLSRRPDLARAEAQLAAAXXXVSVARAAMLPAVTLGATLGSGAYKADEILRSPFYTLTSGLVAPIFNNGRLSAERDKARARQDELLQSYRGAIINGFADVEKALSSISRLDQQRQWQAEELQQARTAFRIAESRYQAGAEDLLTVLQTQRTLYAAQDLDVQLRLSRLQASIALYKALGGGWNSGT

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
46 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
67 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
68 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
78 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
79 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
80 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
81 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
82 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
83 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
84 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
85 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
86 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
87 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
88 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
89 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
104 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
147 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
172 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
173 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
174 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
175 2511231004 Pseudomonas sp. GM102 Isolate Nodule
176 2511231007 Pseudomonas sp. GM18 Isolate Nodule
177 2511231016 Pseudomonas sp. GM50 Isolate Nodule
178 2511231019 Pseudomonas sp. GM67 Isolate Nodule
179 2511231023 Pseudomonas sp. GM80 Isolate Nodule
180 2511231031 Pseudomonas sp. GM16 Isolate Nodule
181 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
182 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
183 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
184 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
185 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
186 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
187 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
188 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
189 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
190 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
191 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
192 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
193 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
194 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
195 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
196 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
197 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
198 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
199 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
200 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
201 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
202 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
203 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
204 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
205 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
206 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
207 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
208 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
209 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
210 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
211 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
212 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
213 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
214 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
215 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
216 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
217 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
218 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
219 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
220 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
221 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
222 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
223 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
224 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
225 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
226 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
227 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
228 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
229 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
230 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
231 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
232 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
233 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
234 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
235 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
236 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
237 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
238 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
239 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
240 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
241 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
242 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
243 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
244 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
245 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
246 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
247 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
248 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
249 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
250 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
251 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
252 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
253 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
254 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
255 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
256 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
257 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
258 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
259 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
260 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
261 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
262 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
263 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
264 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
265 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
266 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
267 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
268 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
269 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
270 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
271 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
272 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
273 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
274 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
275 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
276 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
277 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
278 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
279 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
280 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
281 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
282 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
283 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.11
Metatranscriptomes 0
Isolates 18.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 1.39
Rhizoplane 5.55
Rhizosphere 74.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10000394 3300011119 Bacteria 23433
2 Ga0055538_1000218 3300003751 Bacteria 33353
3 Ga0055539_1000260 3300003752 Bacteria 33353
4 Ga0055533_1000251 3300003756 Bacteria 33353
5 Ga0055532_1000275 3300003758 Bacteria 33341
6 Ga0055532_1000293 3300003758 Bacteria 31405
7 Ga0055525_1000348 3300003759 Bacteria 33353
8 Ga0055536_1000015 3300003781 Bacteria 237585
9 Ga0055536_1000714 3300003781 Bacteria 22241
10 Ga0055530_10000003 3300003791 Bacteria 237585
11 Ga0055530_10001314 3300003791 Bacteria 18689
12 Ga0055530_10002529 3300003791 Bacteria 11658
13 Ga0055540_1000124 3300003792 Bacteria 80047
14 Ga0055540_1001441 3300003792 Bacteria 14185
15 Ga0055531_10000378 3300003794 Bacteria 43030
16 Ga0055541_1000157 3300003841 Bacteria 33353
17 Ga0065714_10067445 3300005288 Bacteria 5511
18 Ga0065712_10069082 3300005290 Bacteria 8063
19 Ga0070670_100000961 3300005331 Bacteria 22614
20 Ga0070670_100001919 3300005331 Bacteria 17019
21 Ga0070661_100000814 3300005344 Bacteria 22418
22 Ga0070669_100000377 3300005353 Bacteria 34330
23 Ga0070662_100003307 3300005457 Bacteria 10045
24 Ga0070664_100000974 3300005564 Bacteria 22418
25 Ga0070664_100078066 3300005564 Bacteria 2848
26 Ga0068854_100082159 3300005578 Bacteria 2381
27 Ga0068851_10000212 3300005834 Bacteria 27806
28 Ga0105251_10001011 3300009011 Bacteria 24641
29 Ga0105251_10002100 3300009011 Bacteria 16050
30 Ga0105251_10004801 3300009011 Bacteria 9046
31 Ga0105251_10012861 3300009011 Bacteria 4710
32 Ga0105244_10000654 3300009036 Bacteria 30447
33 Ga0105244_10000710 3300009036 Bacteria 28813
34 Ga0105244_10001501 3300009036 Bacteria 18700
35 Ga0105244_10002183 3300009036 Bacteria 15000
36 Ga0105244_10064020 3300009036 Bacteria 1846
37 Ga0105244_10087597 3300009036 Bacteria 1534
38 Ga0105250_10000405 3300009092 Bacteria 31642
39 Ga0105250_10001701 3300009092 Bacteria 11616
40 Ga0105250_10062399 3300009092 Bacteria 1499
41 Ga0105243_10000161 3300009148 Bacteria 76138
42 Ga0105243_10001383 3300009148 Bacteria 21524
43 Ga0105243_10058390 3300009148 Bacteria 3075
44 Ga0105243_10082944 3300009148 Bacteria 2621
45 Ga0105242_10001513 3300009176 Bacteria 18269
46 Ga0105248_10167135 3300009177 Bacteria 2479
47 Ga0105237_10002588 3300009545 Bacteria 22313
48 Ga0105246_10019498 3300011119 Bacteria 4335
49 Ga0157345_1000055 3300012498 Bacteria 24212
50 Ga0157373_10010997 3300013100 Bacteria 6664
51 Ga0157373_10022976 3300013100 Bacteria 4522
52 Ga0157373_10025301 3300013100 Bacteria 4295
53 Ga0157373_10176789 3300013100 Bacteria 1502
54 Ga0157371_10001224 3300013102 Bacteria 27291
55 Ga0157371_10026408 3300013102 Bacteria 4221
56 Ga0157370_10105116 3300013104 Bacteria 2643
57 Ga0157369_10000775 3300013105 Bacteria 41214
58 Ga0157369_10019716 3300013105 Bacteria 7546
59 Ga0157369_10022600 3300013105 Bacteria 7014
60 Ga0157375_10007279 3300013308 Bacteria 9686
61 Ga0157375_10129536 3300013308 Bacteria 2641
62 Ga0157375_10158046 3300013308 Bacteria 2407
63 Ga0182008_10011922 3300014497 Bacteria 4607
64 Ga0182008_10027332 3300014497 Bacteria 2892
65 Ga0182008_10070217 3300014497 Bacteria 1723
66 Ga0182006_1000552 3300015261 Bacteria 28231
67 Ga0182006_1001138 3300015261 Bacteria 16925
68 Ga0182006_1001294 3300015261 Bacteria 15434
69 Ga0182007_10000235 3300015262 Bacteria 37247
70 Ga0182007_10017884 3300015262 Bacteria 2580
71 Ga0182005_1000187 3300015265 Bacteria 42477
72 Ga0182005_1007226 3300015265 Bacteria 3343
73 Ga0182005_1015177 3300015265 Bacteria 2150
74 Ga0163161_10001773 3300017792 Bacteria 15737
75 Ga0163161_10049817 3300017792 Bacteria 3029
76 Ga0163161_10050626 3300017792 Bacteria 3007
77 Ga0163161_10081852 3300017792 Bacteria 2378
78 Ga0209784_100057 3300025224 Bacteria 167476
79 Ga0209566_100073 3300025225 Bacteria 167476
80 Ga0209674_100095 3300025226 Bacteria 167476
81 Ga0209147_100092 3300025229 Bacteria 167476
82 Ga0209563_100093 3300025230 Bacteria 167476
83 Ga0209258_100552 3300025242 Bacteria 33457
84 Ga0209646_1000353 3300025246 Bacteria 33363
85 Ga0209677_100054 3300025253 Bacteria 167476
86 Ga0209676_1000017 3300025292 Bacteria 643409
87 Ga0209676_1000055 3300025292 Bacteria 361565
88 Ga0209676_1000127 3300025292 Bacteria 189701
89 Ga0209050_1000076 3300025298 Bacteria 285628
90 Ga0209050_1000120 3300025298 Bacteria 198658
91 Ga0209050_1000754 3300025298 Bacteria 46538
92 Ga0209051_1000050 3300025303 Bacteria 284349
93 Ga0209051_1000083 3300025303 Bacteria 192732
94 Ga0209051_1008940 3300025303 Bacteria 5230
95 Ga0209257_1000175 3300025304 Bacteria 165070
96 Ga0207656_10000194 3300025321 Bacteria 21842
97 Ga0207696_1000108 3300025711 Bacteria 157445
98 Ga0207696_1013874 3300025711 Bacteria 2783
99 Ga0207655_1000035 3300025728 Bacteria 359016
100 Ga0207655_1000114 3300025728 Bacteria 164098
101 Ga0207655_1000187 3300025728 Bacteria 109886
102 Ga0207655_1002162 3300025728 Bacteria 16381
103 Ga0207655_1004013 3300025728 Bacteria 10636
104 Ga0207655_1011208 3300025728 Bacteria 5357
105 Ga0207713_1000296 3300025735 Bacteria 57184
106 Ga0207713_1001895 3300025735 Bacteria 15860
107 Ga0207713_1002998 3300025735 Bacteria 11801
108 Ga0207671_10002161 3300025914 Bacteria 21404
109 Ga0207649_10000032 3300025920 Bacteria 143552
110 Ga0207681_10000222 3300025923 Bacteria 45089
111 Ga0207650_10000068 3300025925 Bacteria 139947
112 Ga0207650_10000240 3300025925 Bacteria 60809
113 Ga0207706_10005232 3300025933 Bacteria 12113
114 Ga0207686_10033785 3300025934 Bacteria 3055
115 Ga0207709_10000089 3300025935 Bacteria 149139
116 Ga0207709_10000420 3300025935 Bacteria 41163
117 Ga0207709_10058155 3300025935 Bacteria 2401
118 Ga0207679_10000169 3300025945 Bacteria 53789
119 Ga0207640_10024341 3300025981 Bacteria 3652
120 Ga0209281_1007742 3300027111 Bacteria 2668
121 Ga0207428_10022447 3300027907 Bacteria 5326
122 Ga0207428_10155128 3300027907 Bacteria 1742
123 Ga0307511_10019649 3300030521 Bacteria 6416
124 Ga0316179_1043273 3300030734 Bacteria 1620
125 Ga0316178_1032926 3300030735 Bacteria 2036
126 Ga0307509_10053544 3300031507 Bacteria 4303
127 Ga0307408_100001664 3300031548 Bacteria 16378
128 Ga0307405_10002419 3300031731 Bacteria 8222
129 Ga0307412_10018439 3300031911 Bacteria 4199
130 Ga0307510_10002818 3300033180 Bacteria 19940
131 Ga0439438_000047 3300041405 Bacteria 58963
132 Ga0439438_000079 3300041405 Bacteria 45616
133 Ga0439447_000029 3300041407 Bacteria 50096
134 Ga0439466_0022242 3300041411 Bacteria 2239
135 Ga0439445_0011524 3300042004 Bacteria 2110
136 Ga0439432_000084 3300042006 Bacteria 29253
137 Ga0439432_003522 3300042006 Bacteria 5794
138 Ga0439451_000416 3300042009 Bacteria 8328
139 Ga0439451_013687 3300042009 Bacteria 1639
140 Ga0439452_000366 3300042010 Bacteria 27485
141 Ga0439452_014101 3300042010 Bacteria 2226
142 Ga0439456_001010 3300042013 Bacteria 5596
143 Ga0439456_005550 3300042013 Bacteria 2562
144 Ga0439463_003203 3300042016 Bacteria 4153
145 Ga0439463_016952 3300042016 Bacteria 1803
146 Ga0450911_000029 3300042115 Bacteria 77010
147 Ga0450900_004023 3300042136 Bacteria 1668
148 Ga0450903_007191 3300042138 Bacteria 1838
149 Ga0450904_000853 3300042139 Bacteria 5015
150 Ga0450906_000006 3300042145 Bacteria 44000
151 Ga0450907_005167 3300042146 Bacteria 2211
152 Ga0439440_0013387 3300042993 Bacteria 1758
153 Ga0495617_000758 3300046452 Bacteria 15791
154 Ga0495617_017205 3300046452 Bacteria 2441
155 Ga0495617_020500 3300046452 Bacteria 2233
156 Ga0495617_020625 3300046452 Bacteria 2227
157 Ga0495617_026047 3300046452 Bacteria 1969
158 Ga0495627_000437 3300046453 Bacteria 36282
159 Ga0495627_003580 3300046453 Bacteria 6778
160 Ga0495627_010330 3300046453 Bacteria 3399
161 Ga0495627_023582 3300046453 Bacteria 2014
162 Ga0495627_032461 3300046453 Bacteria 1643
163 Ga0495592_0021649 3300046454 Bacteria 4890
164 Ga0495590_0000304 3300046457 Bacteria 25815
165 Ga0495590_0003994 3300046457 Bacteria 5987
166 Ga0495590_0017293 3300046457 Bacteria 2597
167 Ga0495590_0027147 3300046457 Bacteria 2009
168 Ga0495591_000902 3300046458 Bacteria 20708
169 Ga0495591_004082 3300046458 Bacteria 7273
170 Ga0495591_008662 3300046458 Bacteria 4139
171 Ga0495591_010895 3300046458 Bacteria 3481
172 Ga0495591_011082 3300046458 Bacteria 3438
173 Ga0495591_015405 3300046458 Bacteria 2702
174 Ga0495591_024646 3300046458 Bacteria 1903
175 Ga0495638_0000291 3300046460 Bacteria 65847
176 Ga0495638_0000802 3300046460 Bacteria 33149
177 Ga0495638_0006192 3300046460 Bacteria 8739
178 Ga0495638_0024517 3300046460 Bacteria 3932
179 Ga0495638_0086342 3300046460 Bacteria 1896
180 Ga0495653_0001409 3300046463 Bacteria 18728
181 Ga0495650_0001339 3300046471 Bacteria 24538
182 Ga0495650_0002671 3300046471 Bacteria 13889
183 Ga0495650_0005204 3300046471 Bacteria 8546
184 Ga0495650_0031090 3300046471 Bacteria 2407
185 Ga0495650_0031401 3300046471 Bacteria 2391
186 Ga0495605_0011456 3300046474 Bacteria 4940
187 Ga0495605_0020466 3300046474 Bacteria 3515
188 Ga0495605_0039322 3300046474 Bacteria 2370
189 Ga0495605_0039508 3300046474 Bacteria 2363
190 Ga0495605_0054925 3300046474 Bacteria 1927
191 Ga0495605_0060938 3300046474 Bacteria 1807
192 Ga0495639_0000314 3300046475 Bacteria 23654
193 Ga0495584_0000047 3300046491 Bacteria 88674
194 Ga0495584_0003556 3300046491 Bacteria 8519
195 Ga0495584_0007216 3300046491 Bacteria 5798
196 Ga0495585_0000045 3300046492 Bacteria 123148
197 Ga0495585_0000485 3300046492 Bacteria 37784
198 Ga0495585_0000951 3300046492 Bacteria 24409
199 Ga0495585_0001375 3300046492 Bacteria 19240
200 Ga0495585_0001807 3300046492 Bacteria 16239
201 Ga0495585_0005375 3300046492 Bacteria 8083
202 Ga0495585_0053524 3300046492 Bacteria 2233
203 Ga0495594_0052973 3300046499 Bacteria 2234
204 Ga0495596_0009111 3300046500 Bacteria 4383
205 Ga0495607_0000193 3300046501 Bacteria 64986
206 Ga0495607_0000203 3300046501 Bacteria 63159
207 Ga0495607_0000787 3300046501 Bacteria 30087
208 Ga0495607_0001897 3300046501 Bacteria 17721
209 Ga0495607_0003062 3300046501 Bacteria 12996
210 Ga0495607_0003272 3300046501 Bacteria 12463
211 Ga0495607_0007353 3300046501 Bacteria 7629
212 Ga0495607_0010949 3300046501 Bacteria 6066
213 Ga0495607_0066903 3300046501 Bacteria 2020
214 Ga0495583_0000469 3300046506 Bacteria 59716
215 Ga0495583_0002536 3300046506 Bacteria 15443
216 Ga0495583_0003897 3300046506 Bacteria 11048
217 Ga0495583_0018370 3300046506 Bacteria 3682
218 Ga0495583_0032271 3300046506 Bacteria 2529
219 Ga0495606_0000687 3300046507 Bacteria 52533
220 Ga0495606_0001080 3300046507 Bacteria 39192
221 Ga0495606_0001893 3300046507 Bacteria 26159
222 Ga0495606_0007784 3300046507 Bacteria 9480
223 Ga0495606_0007859 3300046507 Bacteria 9413
224 Ga0495606_0013532 3300046507 Bacteria 6436
225 Ga0495606_0016676 3300046507 Bacteria 5587
226 Ga0495606_0044326 3300046507 Bacteria 2959
227 Ga0495606_0072594 3300046507 Bacteria 2162
228 Ga0495610_0000653 3300046512 Bacteria 33834
229 Ga0495610_0001993 3300046512 Bacteria 17435
230 Ga0495610_0003790 3300046512 Bacteria 11531
231 Ga0495610_0010421 3300046512 Bacteria 5775
232 Ga0495610_0014623 3300046512 Bacteria 4602
233 Ga0495610_0019527 3300046512 Bacteria 3788
234 Ga0495610_0034931 3300046512 Bacteria 2585
235 Ga0495616_0000141 3300046513 Bacteria 62889
236 Ga0495616_0000468 3300046513 Bacteria 30703
237 Ga0495616_0001561 3300046513 Bacteria 15773
238 Ga0495616_0016850 3300046513 Bacteria 4037
239 Ga0495616_0025563 3300046513 Bacteria 3153
240 Ga0495616_0078371 3300046513 Bacteria 1585
241 Ga0495620_0000084 3300046515 Bacteria 78328
242 Ga0495620_0000193 3300046515 Bacteria 46662
243 Ga0495620_0001665 3300046515 Bacteria 13119
244 Ga0495620_0006775 3300046515 Bacteria 6267
245 Ga0495620_0015313 3300046515 Bacteria 3875
246 Ga0495620_0021979 3300046515 Bacteria 3084
247 Ga0495620_0030982 3300046515 Bacteria 2455
248 Ga0495620_0046588 3300046515 Bacteria 1871
249 Ga0495631_0000046 3300046518 Bacteria 74315
250 Ga0495631_0000062 3300046518 Bacteria 66560
251 Ga0495631_0008792 3300046518 Bacteria 5072
252 Ga0495631_0011240 3300046518 Bacteria 4406
253 Ga0495632_0000173 3300046519 Bacteria 66328
254 Ga0495632_0000490 3300046519 Bacteria 37421
255 Ga0495632_0001350 3300046519 Bacteria 20624
256 Ga0495632_0008875 3300046519 Bacteria 6112
257 Ga0495632_0024096 3300046519 Bacteria 3239
258 Ga0495632_0058205 3300046519 Bacteria 1884
259 Ga0495637_0000077 3300046520 Bacteria 78543
260 Ga0495637_0000382 3300046520 Bacteria 33210
261 Ga0495637_0001016 3300046520 Bacteria 17637
262 Ga0495637_0002482 3300046520 Bacteria 10189
263 Ga0495637_0004222 3300046520 Bacteria 7463
264 Ga0495637_0004688 3300046520 Bacteria 7056
265 Ga0495637_0009665 3300046520 Bacteria 4696
266 Ga0495637_0016239 3300046520 Bacteria 3482
267 Ga0495637_0024556 3300046520 Bacteria 2727
268 Ga0495643_0002199 3300046522 Bacteria 15915
269 Ga0495643_0006797 3300046522 Bacteria 7477
270 Ga0495643_0017150 3300046522 Bacteria 4240
271 Ga0495643_0018006 3300046522 Bacteria 4114
272 Ga0495643_0021103 3300046522 Bacteria 3743
273 Ga0495643_0053386 3300046522 Bacteria 2166
274 Ga0495644_0035703 3300046523 Bacteria 1876
275 Ga0495648_0001577 3300046524 Bacteria 22207
276 Ga0495648_0002946 3300046524 Bacteria 15277
277 Ga0495648_0019788 3300046524 Bacteria 4716
278 Ga0495648_0036537 3300046524 Bacteria 3167
279 Ga0495648_0042189 3300046524 Bacteria 2872
280 Ga0495648_0046196 3300046524 Bacteria 2701
281 Ga0495648_0064797 3300046524 Bacteria 2151
282 Ga0495648_0068114 3300046524 Bacteria 2078
283 Ga0495666_0010798 3300046526 Bacteria 4555
284 Ga0495666_0042845 3300046526 Bacteria 2187
285 Ga0495654_0000671 3300046530 Bacteria 27008
286 Ga0495654_0001065 3300046530 Bacteria 20061
287 Ga0495654_0010706 3300046530 Bacteria 4980
288 Ga0495654_0012949 3300046530 Bacteria 4471
289 Ga0495654_0043364 3300046530 Bacteria 2229
290 Ga0495654_0046785 3300046530 Bacteria 2129
291 Ga0495654_0049074 3300046530 Bacteria 2068
292 Ga0495587_0080235 3300046536 Bacteria 1891
293 Ga0495609_0000179 3300046538 Bacteria 64090
294 Ga0495609_0001420 3300046538 Bacteria 15986
295 Ga0495609_0007319 3300046538 Bacteria 5523
296 Ga0495597_0000136 3300046542 Bacteria 65668
297 Ga0495597_0002212 3300046542 Bacteria 12756
298 Ga0495645_0034324 3300046543 Bacteria 3701
299 Ga0495622_0001067 3300046557 Bacteria 14460
300 Ga0495622_0007438 3300046557 Bacteria 5081
301 Ga0495633_0000259 3300046558 Bacteria 62637
302 Ga0495633_0013126 3300046558 Bacteria 4378
303 Ga0495668_0006199 3300046616 Bacteria 7898
304 Ga0495668_0018114 3300046616 Bacteria 4073
305 Ga0495668_0019365 3300046616 Bacteria 3924
306 Ga0495634_0064162 3300046642 Bacteria 2435
307 Ga0495611_0000641 3300046648 Bacteria 20035
308 Ga0495611_0005457 3300046648 Bacteria 5431
309 Ga0495611_0007386 3300046648 Bacteria 4666
310 Ga0495611_0009634 3300046648 Bacteria 4081
311 Ga0495625_0000004 3300046660 Bacteria 611314
312 Ga0495625_0002854 3300046660 Bacteria 18144
313 Ga0495625_0007213 3300046660 Bacteria 9728
314 Ga0495625_0011349 3300046660 Bacteria 7274
315 Ga0495625_0031416 3300046660 Bacteria 3950
316 Ga0495625_0040398 3300046660 Bacteria 3402
317 Ga0495625_0041796 3300046660 Bacteria 3335
318 Ga0495659_0000195 3300046664 Bacteria 26638
319 Ga0495661_0002164 3300046665 Bacteria 15360
320 Ga0495661_0003572 3300046665 Bacteria 11443
321 Ga0495661_0005196 3300046665 Bacteria 9269
322 Ga0495661_0015908 3300046665 Bacteria 5007
323 Ga0495661_0021004 3300046665 Bacteria 4260
324 Ga0495661_0023135 3300046665 Bacteria 4037
325 Ga0495661_0030424 3300046665 Bacteria 3438
326 Ga0495661_0097803 3300046665 Bacteria 1657
327 Ga0495588_0050403 3300046674 Bacteria 2142
328 Ga0495588_0105436 3300046674 Bacteria 1483
329 Ga0495646_0009394 3300046680 Bacteria 6203
330 Ga0495669_0000767 3300046684 Bacteria 13748
331 Ga0495624_0000102 3300046690 Bacteria 57805
332 Ga0495670_0000720 3300046691 Bacteria 15765
333 Ga0495670_0002587 3300046691 Bacteria 8941
334 Ga0495671_0000262 3300046692 Bacteria 44528
335 Ga0495671_0000767 3300046692 Bacteria 23069
336 Ga0495671_0001822 3300046692 Bacteria 13731
337 Ga0495671_0029360 3300046692 Bacteria 2824
338 Ga0495671_0047511 3300046692 Bacteria 2144
339 Ga0495671_0048798 3300046692 Bacteria 2111
340 Ga0495671_0076379 3300046692 Bacteria 1642
341 Ga0495649_0013288 3300046694 Bacteria 4754
342 Ga0495649_0015373 3300046694 Bacteria 4357
343 Ga0495649_0027529 3300046694 Bacteria 3153
344 Ga0495649_0060134 3300046694 Bacteria 2044
345 Ga0495589_0000160 3300046794 Bacteria 62225
346 Ga0495589_0006655 3300046794 Bacteria 6088
347 Ga0495589_0007475 3300046794 Bacteria 5726
348 Ga0495660_0000620 3300046810 Bacteria 27860
349 Ga0495660_0005639 3300046810 Bacteria 7484
350 Ga0495660_0005937 3300046810 Bacteria 7273
351 Ga0495660_0010543 3300046810 Bacteria 5376
352 Ga0495660_0011419 3300046810 Bacteria 5155
353 Ga0495660_0020146 3300046810 Bacteria 3823
354 Ga0495660_0022341 3300046810 Bacteria 3612
355 Ga0495660_0026534 3300046810 Bacteria 3283
356 Ga0495660_0093593 3300046810 Bacteria 1557
357 Ga0495581_0013841 3300047315 Bacteria 4675
358 Ga0495636_0050787 3300047318 Bacteria 1736
359 Ga0495672_0001785 3300047320 Bacteria 20653
360 Ga0495672_0002198 3300047320 Bacteria 18162
361 Ga0495672_0002403 3300047320 Bacteria 17279
362 Ga0495672_0014676 3300047320 Bacteria 5351
363 Ga0495672_0032061 3300047320 Bacteria 3273
364 Ga0495672_0032415 3300047320 Bacteria 3251
365 Ga0495672_0051597 3300047320 Bacteria 2421
366 Ga0495676_0000161 3300047321 Bacteria 51776
367 Ga0495676_0028351 3300047321 Bacteria 4781
368 Ga0495680_0005280 3300047322 Bacteria 12191
369 Ga0495683_0000154 3300047323 Bacteria 67844
370 Ga0495683_0007288 3300047323 Bacteria 5997
371 Ga0495683_0020648 3300047323 Bacteria 3395
372 Ga0495683_0022985 3300047323 Bacteria 3205
373 Ga0495683_0039730 3300047323 Bacteria 2377
374 Ga0495683_0071396 3300047323 Bacteria 1703
375 Ga0495687_007615 3300047443 Bacteria 6342
376 Ga0495677_0001132 3300047445 Bacteria 10646
377 Ga0495679_000688 3300047446 Bacteria 22049
378 Ga0495679_002082 3300047446 Bacteria 10558
379 Ga0495679_008152 3300047446 Bacteria 4286
380 Ga0495679_009111 3300047446 Bacteria 3996
381 Ga0495679_010324 3300047446 Bacteria 3672
382 Ga0495673_0000280 3300047469 Bacteria 69011
383 Ga0495673_0000320 3300047469 Bacteria 61906
384 Ga0495673_0000621 3300047469 Bacteria 34892
385 Ga0495673_0002058 3300047469 Bacteria 14714
386 Ga0495673_0004632 3300047469 Bacteria 8560
387 Ga0495673_0004788 3300047469 Bacteria 8371
388 Ga0495673_0013002 3300047469 Bacteria 4387
389 Ga0495673_0039223 3300047469 Bacteria 2149
390 Ga0495681_0000081 3300047470 Bacteria 83631
391 Ga0495681_0000136 3300047470 Bacteria 63327
392 Ga0495681_0000165 3300047470 Bacteria 55137
393 Ga0495681_0001806 3300047470 Bacteria 15736
394 Ga0495681_0006029 3300047470 Bacteria 8020
395 Ga0495681_0008472 3300047470 Bacteria 6449
396 Ga0495681_0014392 3300047470 Bacteria 4537
397 Ga0495681_0018308 3300047470 Bacteria 3862
398 Ga0495681_0030444 3300047470 Bacteria 2747
399 Ga0495684_0014681 3300047471 Bacteria 6027
400 Ga0495686_0008218 3300047472 Bacteria 7696
401 Ga0495686_0086384 3300047472 Bacteria 1909
402 Ga0495593_0019609 3300047673 Bacteria 3790
403 Ga0495593_0045314 3300047673 Bacteria 2348
404 Ga0495602_0000192 3300048088 Bacteria 57639
405 Ga0495626_0000108 3300048091 Bacteria 108112
406 Ga0495626_0000181 3300048091 Bacteria 76433
407 Ga0495626_0000204 3300048091 Bacteria 71581
408 Ga0495626_0001682 3300048091 Bacteria 17038
409 Ga0495626_0009092 3300048091 Bacteria 5389
410 Ga0495626_0016149 3300048091 Bacteria 3802
411 Ga0495626_0019368 3300048091 Bacteria 3405
412 Ga0495626_0020721 3300048091 Bacteria 3272
413 Ga0496105_0174817 3300048908 Bacteria 1759
414 Ga0496106_0172612 3300048909 Bacteria 1714
415 Ga0496116_0002043 3300048919 Bacteria 21635
416 Ga0496116_0002641 3300048919 Bacteria 18581
417 Ga0496117_0001062 3300048920 Bacteria 41875
418 Ga0496117_0057388 3300048920 Bacteria 2704
419 Ga0496117_0096305 3300048920 Bacteria 1888
420 Ga0496118_0001086 3300048921 Bacteria 42347
421 Ga0496118_0046863 3300048921 Bacteria 3357
422 Ga0496118_0060715 3300048921 Bacteria 2805
423 Ga0496118_0063214 3300048921 Bacteria 2724
424 Ga0496118_0069340 3300048921 Bacteria 2554
425 Ga0496119_0012883 3300048922 Bacteria 6737
426 Ga0496121_0000255 3300048924 Bacteria 113201
427 Ga0496121_0001455 3300048924 Bacteria 39989
428 Ga0496121_0073782 3300048924 Bacteria 2732
429 Ga0496121_0116675 3300048924 Bacteria 2024
430 Ga0496121_0149155 3300048924 Bacteria 1723
431 Ga0496122_0011290 3300048925 Bacteria 9069
432 Ga0496122_0014745 3300048925 Bacteria 7534
433 Ga0496122_0017785 3300048925 Bacteria 6612
434 Ga0496122_0046319 3300048925 Bacteria 3369
435 Ga0496122_0059746 3300048925 Bacteria 2812
436 Ga0496122_0083928 3300048925 Bacteria 2206
437 Ga0496123_0001902 3300048926 Bacteria 27233
438 Ga0496123_0020665 3300048926 Bacteria 5145
439 Ga0496123_0044497 3300048926 Bacteria 3035
440 Ga0496123_0071975 3300048926 Bacteria 2153
441 Ga0496124_0011145 3300048927 Bacteria 9018
442 Ga0496125_0010312 3300048928 Bacteria 9459
443 Ga0496125_0019685 3300048928 Bacteria 6355
444 Ga0496125_0020978 3300048928 Bacteria 6110
445 Ga0496125_0023414 3300048928 Bacteria 5700
446 Ga0496125_0064347 3300048928 Bacteria 2914
447 Ga0496125_0077428 3300048928 Bacteria 2563
448 Ga0496125_0080145 3300048928 Bacteria 2500
449 Ga0496126_0032445 3300048929 Bacteria 4919
450 Ga0496126_0077744 3300048929 Bacteria 2941
451 Ga0495678_000281 3300049459 Bacteria 55979
452 Ga0495678_001448 3300049459 Bacteria 18686
453 Ga0495678_004432 3300049459 Bacteria 8116
454 Ga0495678_005188 3300049459 Bacteria 7285
455 Ga0495678_012451 3300049459 Bacteria 4031
456 Ga0495678_030318 3300049459 Bacteria 2264
457 Ga0495678_035224 3300049459 Bacteria 2054
458 Ga0495678_054015 3300049459 Bacteria 1540
459 Ga0495682_0002100 3300049460 Bacteria 9710
460 Ga0495682_0023854 3300049460 Bacteria 2282
461 Ga0495682_0034527 3300049460 Bacteria 1864
462 Ga0495682_0034668 3300049460 Bacteria 1860
463 Ga0501241_001007 3300049758 Bacteria 5929
464 nmdc:mga00v17_50161_c1 3300050491 Bacteria 2534
465 Ga0500572_000755 3300053111 Bacteria 10384
466 Ga0500621_049934 3300053126 Bacteria 1693
467 Ga0500586_030622 3300053145 Bacteria 1770
468 Ga0500634_0026960 3300053161 Bacteria 3129
469 2511258370 2511231004 Bacteria 6669789
470 2511269172 2511231007 Bacteria 6306603
471 2511327421 2511231016 Bacteria 6704427
472 2511344358 2511231019 Bacteria 6520662
473 2511372667 2511231023 Bacteria 6808468
474 2511413202 2511231031 Bacteria 6558529
475 2555671086 2554235341 Bacteria 6867980
476 2597859157 2597489887 Bacteria 6666321
477 2597864714 2597489888 Bacteria 6179543
478 2597869391 2597489889 Bacteria 6297495
479 2599326605 2599185155 Bacteria 5827168
480 2599357354 2599185160 Bacteria 6844013
481 2599370419 2599185162 Bacteria 6957254
482 2599377338 2599185163 Bacteria 6995158
483 2599382929 2599185164 Bacteria 6841688
484 2599389377 2599185165 Bacteria 6843250
485 2599395644 2599185166 Bacteria 6959206
486 2599397897 2599185167 Bacteria 6353609
487 2599408381 2599185168 Bacteria 6997636
488 2599452344 2599185179 Bacteria 6611171
489 2599464157 2599185181 Bacteria 6844519
490 2599471189 2599185182 Bacteria 6883168
491 2599488068 2599185185 Bacteria 6652270
492 2599493176 2599185186 Bacteria 6831633
493 2599506909 2599185189 Bacteria 5862825
494 2599513277 2599185190 Bacteria 6285678
495 2599518223 2599185191 Bacteria 6297582
496 2599806263 2599185257 Bacteria 6492581
497 2599878026 2599185288 Bacteria 6666191
498 2599891953 2599185290 Bacteria 6289611
499 2599947233 2599185303 Bacteria 6512725
500 2600217301 2599185356 Bacteria 6843884
501 2601689998 2600255296 Bacteria 5784754
502 2601777471 2600255313 Bacteria 6842543
503 2601795776 2600255318 Bacteria 6383414
504 2606075377 2603880185 Bacteria 6379190
505 2606128240 2603880199 Bacteria 6377649
506 2621298756 2619619299 Bacteria 6649820
507 2624493240 2623620446 Bacteria 6500345
508 2643871415 2643221571 Bacteria 6228673
509 2644187014 2643221633 Bacteria 6733554
510 2644622458 2643221713 Bacteria 6554480
511 2671100301 2667528171 Bacteria 6900659
512 2671772673 2671180172 Bacteria 6495783
513 2677900767 2675903420 Bacteria 6247433
514 2715752491 2713897148 Bacteria 5883533
515 2715757983 2713897149 Bacteria 6506249
516 2723249490 2721755607 Bacteria 5841722
517 2738672005 2738541265 Bacteria 6594665
518 2738750399 2738541282 Bacteria 6593925
519 2738809991 2738541294 Bacteria 6925949
520 2738859439 2738541303 Bacteria 6591772
521 2738897351 2738541309 Bacteria 6926455
522 2808930975 2808606377 Bacteria 6646337
523 2808953097 2808606381 Bacteria 6646461
524 2808977034 2808606385 Bacteria 6711065
525 2808992189 2808606388 Bacteria 6706662
526 2809214045 2808606445 Bacteria 6057339
527 2817492087 2816332298 Bacteria 6852809
528 2819705961 2818991464 Bacteria 6907494
529 2826585192 2826581358 Bacteria 5963467
530 2834032898 2834028612 Bacteria 6354979
531 2842817502 2842815866 Bacteria 5947510
532 2842828159 2842826826 Bacteria 5974129
533 2842832408 2842832357 Bacteria 5959113
534 2842842823 2842837860 Bacteria 6066181
535 2842848611 2842843487 Bacteria 6004777
536 2842853608 2842849001 Bacteria 5924277
537 2852613632 2852612431 Bacteria 6885235
538 2852668632 2852667396 Bacteria 6885555
539 2860871202 2860867994 Bacteria 5645326
540 2878031724 2878029506 Bacteria 6418441
541 2908450550 2908446538 Bacteria 6829095
542 2917074946 2917070673 Bacteria 6868303
543 2919386696 2919385768 Bacteria 5897293
544 2919491477 2919487758 Bacteria 5929766
545 2919699488 2919697872 Bacteria 6553725
546 2929193276 2929189879 Bacteria 5930554
547 2931394573 2931390751 Bacteria 6273349
548 2935355066 2935353572 Unclassified 6955622
549 2945964869 2945961074 Bacteria 7342064
550 2946008958 2946006987 Bacteria 6705746
551 2946031556 2946027586 Bacteria 6049274
552 2947238527 2947233263 Bacteria 6439278
553 2984288412 2984286254 Bacteria 6702062
554 2998141908 2998139840 Bacteria 6073514
555 3007397066 3007395558 Bacteria 6755444
556 3007424164 3007419365 Bacteria 7026924
557 3007515511 3007511990 Bacteria 6481491
558 3007618343 3007614139 Bacteria 6053559
559 3007624107 3007619802 Bacteria 6411688
560 3007720740 3007718800 Bacteria 5971527
561 3007860720 3007855910 Bacteria 5637581
562 637321420 637000220 Bacteria 7074893
563 8015689798 8015687852 Bacteria 6613826
564 8019772000 8019769354 Bacteria 6924660
565 8019776241 8019775933 Bacteria 6858656
566 8029998789 8029995093 Bacteria 5990776
567 8054285412 8054285046 Bacteria 6919322
568 8054348548 8054347763 Bacteria 5901107
569 8054507092 8054503363 Bacteria 6101651
570 8055822027 8055817908 Bacteria 6609162
571 8055880411 8055878733 Bacteria 5907058
572 8056135522 8056131705 Bacteria 6107031
573 8056154487 8056148874 Bacteria 6479865
574 8056160493 8056155041 Bacteria 6486948
575 8056165320 8056161164 Bacteria 6106669
576 8056169091 8056166840 Bacteria 5820959
577 8057801545 8057798959 Bacteria 6713499
578 Ga0105246_10000394
579 Ga0055538_1000218
580 Ga0055539_1000260
581 Ga0055533_1000251
582 Ga0055532_1000275
583 Ga0055532_1000293
584 Ga0055525_1000348
585 Ga0055536_1000015
586 Ga0055536_1000714
587 Ga0055530_10000003
588 Ga0055530_10001314
589 Ga0055530_10002529
590 Ga0055540_1000124
591 Ga0055540_1001441
592 Ga0055531_10000378
593 Ga0055541_1000157
594 Ga0065714_10067445
595 Ga0065712_10069082
596 Ga0070670_100000961
597 Ga0070670_100001919
598 Ga0070661_100000814
599 Ga0070669_100000377
600 Ga0070662_100003307
601 Ga0070664_100000974
602 Ga0070664_100078066
603 Ga0068854_100082159
604 Ga0068851_10000212
605 Ga0105251_10001011
606 Ga0105251_10002100
607 Ga0105251_10004801
608 Ga0105251_10012861
609 Ga0105244_10000654
610 Ga0105244_10000710
611 Ga0105244_10001501
612 Ga0105244_10002183
613 Ga0105244_10064020
614 Ga0105244_10087597
615 Ga0105250_10000405
616 Ga0105250_10001701
617 Ga0105250_10062399
618 Ga0105243_10000161
619 Ga0105243_10001383
620 Ga0105243_10058390
621 Ga0105243_10082944
622 Ga0105242_10001513
623 Ga0105248_10167135
624 Ga0105237_10002588
625 Ga0105246_10019498
626 Ga0157345_1000055
627 Ga0157373_10010997
628 Ga0157373_10022976
629 Ga0157373_10025301
630 Ga0157373_10176789
631 Ga0157371_10001224
632 Ga0157371_10026408
633 Ga0157370_10105116
634 Ga0157369_10000775
635 Ga0157369_10019716
636 Ga0157369_10022600
637 Ga0157375_10007279
638 Ga0157375_10129536
639 Ga0157375_10158046
640 Ga0182008_10011922
641 Ga0182008_10027332
642 Ga0182008_10070217
643 Ga0182006_1000552
644 Ga0182006_1001138
645 Ga0182006_1001294
646 Ga0182007_10000235
647 Ga0182007_10017884
648 Ga0182005_1000187
649 Ga0182005_1007226
650 Ga0182005_1015177
651 Ga0163161_10001773
652 Ga0163161_10049817
653 Ga0163161_10050626
654 Ga0163161_10081852
655 Ga0209784_100057
656 Ga0209566_100073
657 Ga0209674_100095
658 Ga0209147_100092
659 Ga0209563_100093
660 Ga0209258_100552
661 Ga0209646_1000353
662 Ga0209677_100054
663 Ga0209676_1000017
664 Ga0209676_1000055
665 Ga0209676_1000127
666 Ga0209050_1000076
667 Ga0209050_1000120
668 Ga0209050_1000754
669 Ga0209051_1000050
670 Ga0209051_1000083
671 Ga0209051_1008940
672 Ga0209257_1000175
673 Ga0207656_10000194
674 Ga0207696_1000108
675 Ga0207696_1013874
676 Ga0207655_1000035
677 Ga0207655_1000114
678 Ga0207655_1000187
679 Ga0207655_1002162
680 Ga0207655_1004013
681 Ga0207655_1011208
682 Ga0207713_1000296
683 Ga0207713_1001895
684 Ga0207713_1002998
685 Ga0207671_10002161
686 Ga0207649_10000032
687 Ga0207681_10000222
688 Ga0207650_10000068
689 Ga0207650_10000240
690 Ga0207706_10005232
691 Ga0207686_10033785
692 Ga0207709_10000089
693 Ga0207709_10000420
694 Ga0207709_10058155
695 Ga0207679_10000169
696 Ga0207640_10024341
697 Ga0209281_1007742
698 Ga0207428_10022447
699 Ga0207428_10155128
700 Ga0307511_10019649
701 Ga0316179_1043273
702 Ga0316178_1032926
703 Ga0307509_10053544
704 Ga0307408_100001664
705 Ga0307405_10002419
706 Ga0307412_10018439
707 Ga0307510_10002818
708 Ga0439438_000047
709 Ga0439438_000079
710 Ga0439447_000029
711 Ga0439466_0022242
712 Ga0439445_0011524
713 Ga0439432_000084
714 Ga0439432_003522
715 Ga0439451_000416
716 Ga0439451_013687
717 Ga0439452_000366
718 Ga0439452_014101
719 Ga0439456_001010
720 Ga0439456_005550
721 Ga0439463_003203
722 Ga0439463_016952
723 Ga0450911_000029
724 Ga0450900_004023
725 Ga0450903_007191
726 Ga0450904_000853
727 Ga0450906_000006
728 Ga0450907_005167
729 Ga0439440_0013387
730 Ga0495617_000758
731 Ga0495617_017205
732 Ga0495617_020500
733 Ga0495617_020625
734 Ga0495617_026047
735 Ga0495627_000437
736 Ga0495627_003580
737 Ga0495627_010330
738 Ga0495627_023582
739 Ga0495627_032461
740 Ga0495592_0021649
741 Ga0495590_0000304
742 Ga0495590_0003994
743 Ga0495590_0017293
744 Ga0495590_0027147
745 Ga0495591_000902
746 Ga0495591_004082
747 Ga0495591_008662
748 Ga0495591_010895
749 Ga0495591_011082
750 Ga0495591_015405
751 Ga0495591_024646
752 Ga0495638_0000291
753 Ga0495638_0000802
754 Ga0495638_0006192
755 Ga0495638_0024517
756 Ga0495638_0086342
757 Ga0495653_0001409
758 Ga0495650_0001339
759 Ga0495650_0002671
760 Ga0495650_0005204
761 Ga0495650_0031090
762 Ga0495650_0031401
763 Ga0495605_0011456
764 Ga0495605_0020466
765 Ga0495605_0039322
766 Ga0495605_0039508
767 Ga0495605_0054925
768 Ga0495605_0060938
769 Ga0495639_0000314
770 Ga0495584_0000047
771 Ga0495584_0003556
772 Ga0495584_0007216
773 Ga0495585_0000045
774 Ga0495585_0000485
775 Ga0495585_0000951
776 Ga0495585_0001375
777 Ga0495585_0001807
778 Ga0495585_0005375
779 Ga0495585_0053524
780 Ga0495594_0052973
781 Ga0495596_0009111
782 Ga0495607_0000193
783 Ga0495607_0000203
784 Ga0495607_0000787
785 Ga0495607_0001897
786 Ga0495607_0003062
787 Ga0495607_0003272
788 Ga0495607_0007353
789 Ga0495607_0010949
790 Ga0495607_0066903
791 Ga0495583_0000469
792 Ga0495583_0002536
793 Ga0495583_0003897
794 Ga0495583_0018370
795 Ga0495583_0032271
796 Ga0495606_0000687
797 Ga0495606_0001080
798 Ga0495606_0001893
799 Ga0495606_0007784
800 Ga0495606_0007859
801 Ga0495606_0013532
802 Ga0495606_0016676
803 Ga0495606_0044326
804 Ga0495606_0072594
805 Ga0495610_0000653
806 Ga0495610_0001993
807 Ga0495610_0003790
808 Ga0495610_0010421
809 Ga0495610_0014623
810 Ga0495610_0019527
811 Ga0495610_0034931
812 Ga0495616_0000141
813 Ga0495616_0000468
814 Ga0495616_0001561
815 Ga0495616_0016850
816 Ga0495616_0025563
817 Ga0495616_0078371
818 Ga0495620_0000084
819 Ga0495620_0000193
820 Ga0495620_0001665
821 Ga0495620_0006775
822 Ga0495620_0015313
823 Ga0495620_0021979
824 Ga0495620_0030982
825 Ga0495620_0046588
826 Ga0495631_0000046
827 Ga0495631_0000062
828 Ga0495631_0008792
829 Ga0495631_0011240
830 Ga0495632_0000173
831 Ga0495632_0000490
832 Ga0495632_0001350
833 Ga0495632_0008875
834 Ga0495632_0024096
835 Ga0495632_0058205
836 Ga0495637_0000077
837 Ga0495637_0000382
838 Ga0495637_0001016
839 Ga0495637_0002482
840 Ga0495637_0004222
841 Ga0495637_0004688
842 Ga0495637_0009665
843 Ga0495637_0016239
844 Ga0495637_0024556
845 Ga0495643_0002199
846 Ga0495643_0006797
847 Ga0495643_0017150
848 Ga0495643_0018006
849 Ga0495643_0021103
850 Ga0495643_0053386
851 Ga0495644_0035703
852 Ga0495648_0001577
853 Ga0495648_0002946
854 Ga0495648_0019788
855 Ga0495648_0036537
856 Ga0495648_0042189
857 Ga0495648_0046196
858 Ga0495648_0064797
859 Ga0495648_0068114
860 Ga0495666_0010798
861 Ga0495666_0042845
862 Ga0495654_0000671
863 Ga0495654_0001065
864 Ga0495654_0010706
865 Ga0495654_0012949
866 Ga0495654_0043364
867 Ga0495654_0046785
868 Ga0495654_0049074
869 Ga0495587_0080235
870 Ga0495609_0000179
871 Ga0495609_0001420
872 Ga0495609_0007319
873 Ga0495597_0000136
874 Ga0495597_0002212
875 Ga0495645_0034324
876 Ga0495622_0001067
877 Ga0495622_0007438
878 Ga0495633_0000259
879 Ga0495633_0013126
880 Ga0495668_0006199
881 Ga0495668_0018114
882 Ga0495668_0019365
883 Ga0495634_0064162
884 Ga0495611_0000641
885 Ga0495611_0005457
886 Ga0495611_0007386
887 Ga0495611_0009634
888 Ga0495625_0000004
889 Ga0495625_0002854
890 Ga0495625_0007213
891 Ga0495625_0011349
892 Ga0495625_0031416
893 Ga0495625_0040398
894 Ga0495625_0041796
895 Ga0495659_0000195
896 Ga0495661_0002164
897 Ga0495661_0003572
898 Ga0495661_0005196
899 Ga0495661_0015908
900 Ga0495661_0021004
901 Ga0495661_0023135
902 Ga0495661_0030424
903 Ga0495661_0097803
904 Ga0495588_0050403
905 Ga0495588_0105436
906 Ga0495646_0009394
907 Ga0495669_0000767
908 Ga0495624_0000102
909 Ga0495670_0000720
910 Ga0495670_0002587
911 Ga0495671_0000262
912 Ga0495671_0000767
913 Ga0495671_0001822
914 Ga0495671_0029360
915 Ga0495671_0047511
916 Ga0495671_0048798
917 Ga0495671_0076379
918 Ga0495649_0013288
919 Ga0495649_0015373
920 Ga0495649_0027529
921 Ga0495649_0060134
922 Ga0495589_0000160
923 Ga0495589_0006655
924 Ga0495589_0007475
925 Ga0495660_0000620
926 Ga0495660_0005639
927 Ga0495660_0005937
928 Ga0495660_0010543
929 Ga0495660_0011419
930 Ga0495660_0020146
931 Ga0495660_0022341
932 Ga0495660_0026534
933 Ga0495660_0093593
934 Ga0495581_0013841
935 Ga0495636_0050787
936 Ga0495672_0001785
937 Ga0495672_0002198
938 Ga0495672_0002403
939 Ga0495672_0014676
940 Ga0495672_0032061
941 Ga0495672_0032415
942 Ga0495672_0051597
943 Ga0495676_0000161
944 Ga0495676_0028351
945 Ga0495680_0005280
946 Ga0495683_0000154
947 Ga0495683_0007288
948 Ga0495683_0020648
949 Ga0495683_0022985
950 Ga0495683_0039730
951 Ga0495683_0071396
952 Ga0495687_007615
953 Ga0495677_0001132
954 Ga0495679_000688
955 Ga0495679_002082
956 Ga0495679_008152
957 Ga0495679_009111
958 Ga0495679_010324
959 Ga0495673_0000280
960 Ga0495673_0000320
961 Ga0495673_0000621
962 Ga0495673_0002058
963 Ga0495673_0004632
964 Ga0495673_0004788
965 Ga0495673_0013002
966 Ga0495673_0039223
967 Ga0495681_0000081
968 Ga0495681_0000136
969 Ga0495681_0000165
970 Ga0495681_0001806
971 Ga0495681_0006029
972 Ga0495681_0008472
973 Ga0495681_0014392
974 Ga0495681_0018308
975 Ga0495681_0030444
976 Ga0495684_0014681
977 Ga0495686_0008218
978 Ga0495686_0086384
979 Ga0495593_0019609
980 Ga0495593_0045314
981 Ga0495602_0000192
982 Ga0495626_0000108
983 Ga0495626_0000181
984 Ga0495626_0000204
985 Ga0495626_0001682
986 Ga0495626_0009092
987 Ga0495626_0016149
988 Ga0495626_0019368
989 Ga0495626_0020721
990 Ga0496105_0174817
991 Ga0496106_0172612
992 Ga0496116_0002043
993 Ga0496116_0002641
994 Ga0496117_0001062
995 Ga0496117_0057388
996 Ga0496117_0096305
997 Ga0496118_0001086
998 Ga0496118_0046863
999 Ga0496118_0060715
1000 Ga0496118_0063214
1001 Ga0496118_0069340
1002 Ga0496119_0012883
1003 Ga0496121_0000255
1004 Ga0496121_0001455
1005 Ga0496121_0073782
1006 Ga0496121_0116675
1007 Ga0496121_0149155
1008 Ga0496122_0011290
1009 Ga0496122_0014745
1010 Ga0496122_0017785
1011 Ga0496122_0046319
1012 Ga0496122_0059746
1013 Ga0496122_0083928
1014 Ga0496123_0001902
1015 Ga0496123_0020665
1016 Ga0496123_0044497
1017 Ga0496123_0071975
1018 Ga0496124_0011145
1019 Ga0496125_0010312
1020 Ga0496125_0019685
1021 Ga0496125_0020978
1022 Ga0496125_0023414
1023 Ga0496125_0064347
1024 Ga0496125_0077428
1025 Ga0496125_0080145
1026 Ga0496126_0032445
1027 Ga0496126_0077744
1028 Ga0495678_000281
1029 Ga0495678_001448
1030 Ga0495678_004432
1031 Ga0495678_005188
1032 Ga0495678_012451
1033 Ga0495678_030318
1034 Ga0495678_035224
1035 Ga0495678_054015
1036 Ga0495682_0002100
1037 Ga0495682_0023854
1038 Ga0495682_0034527
1039 Ga0495682_0034668
1040 Ga0501241_001007
1041 nmdc:mga00v17_50161_c1
1042 Ga0500572_000755
1043 Ga0500621_049934
1044 Ga0500586_030622
1045 Ga0500634_0026960
1046 2511258370
1047 2511269172
1048 2511327421
1049 2511344358
1050 2511372667
1051 2511413202
1052 2555671086
1053 2597859157
1054 2597864714
1055 2597869391
1056 2599326605
1057 2599357354
1058 2599370419
1059 2599377338
1060 2599382929
1061 2599389377
1062 2599395644
1063 2599397897
1064 2599408381
1065 2599452344
1066 2599464157
1067 2599471189
1068 2599488068
1069 2599493176
1070 2599506909
1071 2599513277
1072 2599518223
1073 2599806263
1074 2599878026
1075 2599891953
1076 2599947233
1077 2600217301
1078 2601689998
1079 2601777471
1080 2601795776
1081 2606075377
1082 2606128240
1083 2621298756
1084 2624493240
1085 2643871415
1086 2644187014
1087 2644622458
1088 2671100301
1089 2671772673
1090 2677900767
1091 2715752491
1092 2715757983
1093 2723249490
1094 2738672005
1095 2738750399
1096 2738809991
1097 2738859439
1098 2738897351
1099 2808930975
1100 2808953097
1101 2808977034
1102 2808992189
1103 2809214045
1104 2817492087
1105 2819705961
1106 2826585192
1107 2834032898
1108 2842817502
1109 2842828159
1110 2842832408
1111 2842842823
1112 2842848611
1113 2842853608
1114 2852613632
1115 2852668632
1116 2860871202
1117 2878031724
1118 2908450550
1119 2917074946
1120 2919386696
1121 2919491477
1122 2919699488
1123 2929193276
1124 2931394573
1125 2935355066
1126 2945964869
1127 2946008958
1128 2946031556
1129 2947238527
1130 2984288412
1131 2998141908
1132 3007397066
1133 3007424164
1134 3007515511
1135 3007618343
1136 3007624107
1137 3007720740
1138 3007860720
1139 637321420
1140 8015689798
1141 8019772000
1142 8019776241
1143 8029998789
1144 8054285412
1145 8054348548
1146 8054507092
1147 8055822027
1148 8055880411
1149 8056135522
1150 8056154487
1151 8056160493
1152 8056165320
1153 8056169091
1154 8057801545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

63

257

0.98

PF02321

OEP

Outer membrane efflux protein

282

463

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wp1-assembly2.cif.gz_B crystal structure of the drug-discharge outer membrane protein, oprm 0.8274 39 452
5azp-assembly1.cif.gz_A crystal structure of a membrane protein from pseudomonas aeruginosa 0.817 40 454
4k7r-assembly1.cif.gz_A crystal structures of cusc review conformational changes accompanying folding and transmembrane channel formation 0.8058 42 450
7akz-assembly1.cif.gz_A deciphering the role of the channel constrictions in the opening mechanism of mexab-oprm efflux pump from pseudomonas aeruginosa 0.804 40 452
6zre-assembly2.cif.gz_B deciphering the role of the channel constrictions in the opening mechanism of mexab-oprm efflux pump from pseudomonas aeruginosa 0.7989 39 452
ID Description Score Start End Superfamily
5iuyA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.8609 40 451 1.20.1600.10
4k7rA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.852 42 450 1.20.1600.10
5azsA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.8512 42 447 1.20.1600.10
1yc9A01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.8397 40 451 1.20.1600.10
4k7rA02 Mainly Beta;Single Sheet;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.8326 86 338 2.20.200.10
ID Description Score Start End GO Terms
AF-A0A6N8NMU4-F1-model_v4 Multidrug efflux transporter outer membrane subunit MdtP 0.8638 121 426 GO:0009279
GO:0015562
AF-A0A6L7JTN8-F1-model_v4 deleted 0.8612 157 454
AF-A0A643IU04-F1-model_v4 Multidrug RND transporter 0.8545 286 454 GO:0009279
GO:0015562
AF-A0A2W0AJ40-F1-model_v4 TolC family protein 0.8491 143 288 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A6N8NMU4-F1-model_v4 Multidrug efflux transporter outer membrane subunit MdtP 0.8485 121 426 GO:0009279
GO:0015562

Map