F464762

General Info

Members Datasets Scaffolds Average Seq Length
569 330 558 158

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0842789|Ga0496102_0842789_79_645
Length 188
Sequence MHDPEKWTPVFRRDHAPAKIQSPDIGTTSAMTRKRRRLVLIGGALCVLAIAVALMLNALRDSIVFFNSPSDIAQKHIPAGTRIRIGGLVKPGSVARGENLKIRFDVTDGNRDIAIAYQGVLPDLFREGQGVVAEGALDAAGQFNADTILAKHDETYMPKEVADALKKSGHWKDSYGQRAAMPAGGSGK

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
3 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
4 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
5 2902330777 Methylobacterium sp. 2A Isolate Unclassified
6 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
7 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
8 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
9 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
10 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
321 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
322 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
328 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
329 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
330 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.54
Metatranscriptomes 0.53
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.68
Nodule 0
Rhizoplane 8.79
Rhizosphere 81.37
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1009726 3300002773 Bacteria 2259
2 JGI25153J46596_10006018 3300003215 Bacteria 6238
3 JGI25160J50197_1040432 3300003354 Bacteria 1081
4 Ga0055528_1024069 3300003790 Bacteria 1838
5 Ga0055540_1009668 3300003792 Bacteria 3300
6 Ga0065165_1045017 3300005262 Bacteria 1287
7 Ga0070683_101138592 3300005329 Bacteria 750
8 Ga0070690_100158342 3300005330 Bacteria 1550
9 Ga0070670_100023779 3300005331 Bacteria 5272
10 Ga0068869_100750716 3300005334 Bacteria 835
11 Ga0070680_100053808 3300005336 Bacteria 3285
12 Ga0070680_100216673 3300005336 Bacteria 1615
13 Ga0070682_100251766 3300005337 Bacteria 1274
14 Ga0070682_100292355 3300005337 Bacteria 1192
15 Ga0068868_100766764 3300005338 Bacteria 868
16 Ga0070660_100029803 3300005339 Bacteria 4091
17 Ga0070660_100165315 3300005339 Bacteria 1785
18 Ga0070689_100055555 3300005340 Bacteria 3069
19 Ga0070691_10104383 3300005341 Bacteria 1411
20 Ga0070687_100385824 3300005343 Bacteria 914
21 Ga0070668_100209823 3300005347 Bacteria 1602
22 Ga0070669_100189546 3300005353 Bacteria 1612
23 Ga0070675_100424373 3300005354 Bacteria 1189
24 Ga0070671_100006765 3300005355 Bacteria 9170
25 Ga0070671_100317749 3300005355 Bacteria 1327
26 Ga0070673_100029818 3300005364 Bacteria 4073
27 Ga0070673_100668934 3300005364 Bacteria 951
28 Ga0070667_100082613 3300005367 Bacteria 2751
29 Ga0070709_10282567 3300005434 Bacteria 1207
30 Ga0070714_100057464 3300005435 Bacteria 3331
31 Ga0070714_100464539 3300005435 Bacteria 1203
32 Ga0070714_100710491 3300005435 Bacteria 970
33 Ga0070713_100068124 3300005436 Bacteria 2999
34 Ga0070713_100262494 3300005436 Bacteria 1579
35 Ga0070713_100292024 3300005436 Bacteria 1498
36 Ga0070694_100684073 3300005444 Bacteria 833
37 Ga0070708_100689211 3300005445 Bacteria 962
38 Ga0070678_100192549 3300005456 Bacteria 1677
39 Ga0070662_100277958 3300005457 Bacteria 1354
40 Ga0070681_10174760 3300005458 Bacteria 2069
41 Ga0070706_100314135 3300005467 Bacteria 1462
42 Ga0070707_100275951 3300005468 Bacteria 1634
43 Ga0070698_100152274 3300005471 Bacteria 2260
44 Ga0070679_100071962 3300005530 Bacteria 3449
45 Ga0070679_100760662 3300005530 Bacteria 912
46 Ga0070684_101014672 3300005535 Bacteria 779
47 Ga0070697_100535974 3300005536 Bacteria 1026
48 Ga0070665_100265308 3300005548 Bacteria 1719
49 Ga0068855_100034955 3300005563 Bacteria 5988
50 Ga0068855_100037994 3300005563 Bacteria 5723
51 Ga0068855_100575671 3300005563 Bacteria 1217
52 Ga0070664_100351053 3300005564 Bacteria 1342
53 Ga0068857_100554424 3300005577 Bacteria 1083
54 Ga0068854_100098244 3300005578 Bacteria 2191
55 Ga0068856_100117971 3300005614 Bacteria 2655
56 Ga0068856_100169747 3300005614 Bacteria 2193
57 Ga0068856_100449337 3300005614 Bacteria 1310
58 Ga0070702_100064272 3300005615 Bacteria 2146
59 Ga0068852_100041603 3300005616 Bacteria 3885
60 Ga0068852_100085969 3300005616 Bacteria 2802
61 Ga0068859_100543362 3300005617 Bacteria 1257
62 Ga0068864_100875529 3300005618 Bacteria 886
63 Ga0068866_10232481 3300005718 Bacteria 1119
64 Ga0068866_10494242 3300005718 Bacteria 808
65 Ga0068851_10133737 3300005834 Bacteria 1343
66 Ga0068863_101089439 3300005841 Bacteria 803
67 Ga0068863_101209358 3300005841 Bacteria 762
68 Ga0068858_100077800 3300005842 Bacteria 3082
69 Ga0068858_100148583 3300005842 Bacteria 2202
70 Ga0068860_100206069 3300005843 Bacteria 1907
71 Ga0068860_100775170 3300005843 Bacteria 972
72 Ga0081455_10000861 3300005937 Bacteria 39120
73 Ga0081455_10000982 3300005937 Bacteria 36310
74 Ga0081455_10025271 3300005937 Bacteria 5486
75 Ga0081455_10053627 3300005937 Bacteria 3443
76 Ga0081455_10076901 3300005937 Bacteria 2748
77 Ga0081455_10295052 3300005937 Bacteria 1166
78 Ga0081538_10049206 3300005981 Bacteria 2559
79 Ga0081538_10104700 3300005981 Bacteria 1411
80 Ga0081539_10039393 3300005985 Bacteria 2789
81 Ga0070717_10121668 3300006028 Bacteria 2236
82 Ga0070717_10890549 3300006028 Bacteria 810
83 Ga0075365_10030867 3300006038 Bacteria 3436
84 Ga0075365_10152071 3300006038 Bacteria 1610
85 Ga0075365_10217371 3300006038 Bacteria 1340
86 Ga0075364_10301277 3300006051 Bacteria 1091
87 Ga0070715_10212732 3300006163 Bacteria 989
88 Ga0070716_100099001 3300006173 Bacteria 1783
89 Ga0070716_100229161 3300006173 Bacteria 1253
90 Ga0070716_101210788 3300006173 Bacteria 607
91 Ga0070712_100056237 3300006175 Bacteria 2759
92 Ga0070712_100065241 3300006175 Bacteria 2584
93 Ga0070712_100538384 3300006175 Bacteria 983
94 Ga0070712_100759444 3300006175 Bacteria 830
95 Ga0075362_10066728 3300006177 Bacteria 1636
96 Ga0097621_100396374 3300006237 Bacteria 1235
97 Ga0068871_100467640 3300006358 Bacteria 1132
98 Ga0075428_100035056 3300006844 Bacteria 5532
99 Ga0075428_100059893 3300006844 Bacteria 4168
100 Ga0075428_100097648 3300006844 Bacteria 3202
101 Ga0075430_100071927 3300006846 Bacteria 2901
102 Ga0075431_100082932 3300006847 Bacteria 3310
103 Ga0075431_100194228 3300006847 Bacteria 2079
104 Ga0075431_100683764 3300006847 Bacteria 1004
105 Ga0075433_10005286 3300006852 Bacteria 10127
106 Ga0075433_10881826 3300006852 Bacteria 781
107 Ga0075434_100013603 3300006871 Bacteria 7753
108 Ga0075434_100287176 3300006871 Bacteria 1665
109 Ga0075434_100461198 3300006871 Bacteria 1292
110 Ga0075436_100190801 3300006914 Bacteria 1450
111 Ga0097620_100543301 3300006931 Bacteria 1257
112 Ga0099794_10013434 3300007265 Bacteria 3564
113 Ga0105240_10226403 3300009093 Bacteria 2176
114 Ga0105240_10482003 3300009093 Bacteria 1382
115 Ga0105240_11632437 3300009093 Bacteria 674
116 Ga0111539_10370333 3300009094 Bacteria 1667
117 Ga0111539_11288564 3300009094 Bacteria 848
118 Ga0105247_10314890 3300009101 Bacteria 1090
119 Ga0114129_10004784 3300009147 Bacteria 19135
120 Ga0114129_10267201 3300009147 Bacteria 2290
121 Ga0114129_10667549 3300009147 Bacteria 1340
122 Ga0114129_10689981 3300009147 Bacteria 1313
123 Ga0114129_11208680 3300009147 Bacteria 941
124 Ga0114129_11264965 3300009147 Bacteria 916
125 Ga0105243_10057011 3300009148 Bacteria 3109
126 Ga0105241_10248416 3300009174 Bacteria 1507
127 Ga0105242_10063411 3300009176 Bacteria 3043
128 Ga0105248_10013942 3300009177 Bacteria 8845
129 Ga0105237_10321849 3300009545 Bacteria 1550
130 Ga0105238_10015570 3300009551 Bacteria 7700
131 Ga0105238_10361014 3300009551 Bacteria 1442
132 Ga0105238_11198834 3300009551 Bacteria 784
133 Ga0105239_10010413 3300010375 Bacteria 10403
134 Ga0105239_10161723 3300010375 Bacteria 2501
135 Ga0157373_10627880 3300013100 Bacteria 783
136 Ga0157371_10335130 3300013102 Bacteria 1099
137 Ga0157370_10220349 3300013104 Bacteria 1757
138 Ga0157370_10714311 3300013104 Bacteria 914
139 Ga0157378_10521811 3300013297 Bacteria 1189
140 Ga0163162_10520930 3300013306 Bacteria 1318
141 Ga0157372_10295209 3300013307 Bacteria 1885
142 Ga0157372_10936010 3300013307 Bacteria 1005
143 Ga0157372_11138234 3300013307 Bacteria 902
144 Ga0157372_11226486 3300013307 Bacteria 866
145 Ga0163163_10456539 3300014325 Bacteria 1338
146 Ga0157380_10316912 3300014326 Bacteria 1444
147 Ga0157379_10459941 3300014968 Bacteria 1176
148 Ga0157376_10360188 3300014969 Bacteria 1395
149 Ga0182005_1070083 3300015265 Bacteria 962
150 Ga0206353_11476676 3300020082 Bacteria 986
151 Ga0213872_10090619 3300021361 Bacteria 1368
152 Ga0228598_1034914 3300024227 Bacteria 991
153 Ga0207425_1059785 3300025245 Bacteria 675
154 Ga0209129_1000849 3300025258 Bacteria 19150
155 Ga0207666_1029210 3300025271 Bacteria 839
156 Ga0209673_1044550 3300025273 Bacteria 1227
157 Ga0209025_1052026 3300025294 Bacteria 1621
158 Ga0209564_1037622 3300025295 Bacteria 1360
159 Ga0209758_1007473 3300025297 Bacteria 7420
160 Ga0209758_1068494 3300025297 Bacteria 1129
161 Ga0209051_1008962 3300025303 Bacteria 5218
162 Ga0207682_10002428 3300025893 Bacteria 8362
163 Ga0207692_10242389 3300025898 Bacteria 1077
164 Ga0207642_10321412 3300025899 Bacteria 904
165 Ga0207710_10124807 3300025900 Bacteria 1232
166 Ga0207688_10035407 3300025901 Bacteria 2766
167 Ga0207680_10720211 3300025903 Bacteria 715
168 Ga0207685_10299447 3300025905 Bacteria 795
169 Ga0207699_10569457 3300025906 Bacteria 823
170 Ga0207705_10097803 3300025909 Bacteria 2156
171 Ga0207684_10102596 3300025910 Bacteria 2446
172 Ga0207654_10287909 3300025911 Bacteria 1113
173 Ga0207707_10138718 3300025912 Bacteria 2126
174 Ga0207707_10624471 3300025912 Bacteria 910
175 Ga0207695_10074947 3300025913 Bacteria 3444
176 Ga0207671_10146421 3300025914 Bacteria 1822
177 Ga0207693_10021787 3300025915 Bacteria 5095
178 Ga0207693_10043071 3300025915 Bacteria 3553
179 Ga0207693_10072965 3300025915 Bacteria 2687
180 Ga0207663_10213713 3300025916 Bacteria 1399
181 Ga0207663_11512945 3300025916 Bacteria 540
182 Ga0207660_10096673 3300025917 Bacteria 2199
183 Ga0207660_10343555 3300025917 Bacteria 1195
184 Ga0207662_10069937 3300025918 Bacteria 2122
185 Ga0207657_10010839 3300025919 Bacteria 9070
186 Ga0207649_10647977 3300025920 Bacteria 816
187 Ga0207652_10009175 3300025921 Bacteria 7962
188 Ga0207652_10251051 3300025921 Bacteria 1595
189 Ga0207652_10961387 3300025921 Bacteria 752
190 Ga0207646_10217228 3300025922 Bacteria 1727
191 Ga0207681_10030187 3300025923 Bacteria 3531
192 Ga0207694_10010334 3300025924 Bacteria 7037
193 Ga0207694_10254659 3300025924 Bacteria 1437
194 Ga0207694_10843197 3300025924 Bacteria 775
195 Ga0207650_10090398 3300025925 Bacteria 2338
196 Ga0207650_10298370 3300025925 Bacteria 1315
197 Ga0207650_10812566 3300025925 Bacteria 793
198 Ga0207687_10203182 3300025927 Bacteria 1550
199 Ga0207700_10181645 3300025928 Bacteria 1762
200 Ga0207700_10186121 3300025928 Bacteria 1742
201 Ga0207700_10862506 3300025928 Bacteria 810
202 Ga0207664_10069897 3300025929 Bacteria 2824
203 Ga0207664_10117245 3300025929 Bacteria 2223
204 Ga0207664_10128247 3300025929 Bacteria 2132
205 Ga0207664_10187936 3300025929 Bacteria 1777
206 Ga0207690_10190884 3300025932 Bacteria 1549
207 Ga0207690_10667540 3300025932 Bacteria 853
208 Ga0207706_10420626 3300025933 Bacteria 1158
209 Ga0207686_10072583 3300025934 Bacteria 2218
210 Ga0207709_10091209 3300025935 Bacteria 1992
211 Ga0207709_11110605 3300025935 Bacteria 649
212 Ga0207670_10047221 3300025936 Bacteria 2866
213 Ga0207665_10035317 3300025939 Bacteria 3318
214 Ga0207665_10182025 3300025939 Bacteria 1522
215 Ga0207691_10114200 3300025940 Bacteria 2399
216 Ga0207711_10019572 3300025941 Bacteria 5635
217 Ga0207661_10049456 3300025944 Bacteria 3347
218 Ga0207667_10008645 3300025949 Bacteria 12074
219 Ga0207667_10029807 3300025949 Bacteria 5912
220 Ga0207667_10133945 3300025949 Bacteria 2552
221 Ga0207667_11049378 3300025949 Bacteria 800
222 Ga0207651_10015265 3300025960 Bacteria 4459
223 Ga0207640_10064331 3300025981 Bacteria 2441
224 Ga0207658_10167363 3300025986 Bacteria 1807
225 Ga0207677_10991060 3300026023 Bacteria 761
226 Ga0207703_10044593 3300026035 Bacteria 3565
227 Ga0207703_10366675 3300026035 Bacteria 1329
228 Ga0207639_10148539 3300026041 Bacteria 1961
229 Ga0207639_10940505 3300026041 Bacteria 808
230 Ga0207702_10089361 3300026078 Bacteria 2694
231 Ga0207702_10360459 3300026078 Bacteria 1393
232 Ga0207702_10380926 3300026078 Bacteria 1357
233 Ga0207641_10264366 3300026088 Bacteria 1612
234 Ga0207676_10716272 3300026095 Bacteria 971
235 Ga0207674_10897232 3300026116 Bacteria 854
236 Ga0207683_10006111 3300026121 Bacteria 10314
237 Ga0207698_10200456 3300026142 Bacteria 1786
238 Ga0207698_10341482 3300026142 Bacteria 1411
239 Ga0207698_10967731 3300026142 Bacteria 861
240 Ga0209588_1151931 3300027671 Bacteria 733
241 Ga0268266_10127455 3300028379 Bacteria 2273
242 Ga0268264_10251582 3300028381 Bacteria 1642
243 Ga0268264_10355249 3300028381 Bacteria 1396
244 Ga0265762_1004149 3300030760 Bacteria 2597
245 Ga0265765_1012453 3300030879 Bacteria 964
246 Ga0265330_10424187 3300031235 Bacteria 563
247 Ga0265325_10033119 3300031241 Bacteria 2755
248 Ga0265325_10188726 3300031241 Bacteria 956
249 Ga0265339_10268464 3300031249 Bacteria 821
250 Ga0265316_10802380 3300031344 Bacteria 660
251 Ga0265313_10021186 3300031595 Bacteria 3561
252 Ga0316579_10015215 3300031691 Bacteria 3336
253 Ga0265314_10059407 3300031711 Bacteria 2615
254 Ga0265342_10001704 3300031712 Bacteria 20117
255 Ga0307406_10321516 3300031901 Bacteria 1197
256 Ga0307510_10104614 3300033180 Bacteria 2602
257 Ga0373930_0022115 3300034816 Bacteria 1255
258 Ga0373929_0022230 3300035085 Bacteria 1293
259 Ga0373944_0041580 3300035089 Bacteria 1423
260 Ga0373944_0089767 3300035089 Bacteria 1026
261 Ga0373923_0024617 3300035111 Bacteria 2377
262 Ga0373936_0006771 3300035113 Bacteria 4313
263 Ga0373936_0043174 3300035113 Bacteria 1812
264 Ga0373936_0226461 3300035113 Bacteria 831
265 Ga0373939_0072697 3300035114 Bacteria 1124
266 Ga0373945_0000336 3300035116 Bacteria 13381
267 Ga0373945_0017614 3300035116 Bacteria 2420
268 Ga0373945_0210179 3300035116 Bacteria 811
269 Ga0373953_0083526 3300035117 Bacteria 1330
270 Ga0373954_0080175 3300035118 Bacteria 1559
271 Ga0373956_0014584 3300035119 Bacteria 3286
272 Ga0373956_0152818 3300035119 Bacteria 1086
273 Ga0373943_0000219 3300035170 Bacteria 23269
274 Ga0373943_0013729 3300035170 Bacteria 3661
275 Ga0373946_0003868 3300035171 Bacteria 5318
276 Ga0373946_0012342 3300035171 Bacteria 3196
277 Ga0373946_0151875 3300035171 Bacteria 1081
278 Ga0373955_0010609 3300035172 Bacteria 4358
279 Ga0373955_0067102 3300035172 Bacteria 1996
280 Ga0373962_0013496 3300035242 Bacteria 2071
281 Ga0373962_0025009 3300035242 Bacteria 1601
282 Ga0373962_0114559 3300035242 Bacteria 854
283 Ga0373924_0060707 3300035410 Bacteria 1581
284 Ga0373924_0530529 3300035410 Bacteria 530
285 Ga0373931_0005057 3300035691 Bacteria 6065
286 Ga0373935_0027695 3300035692 Bacteria 3503
287 Ga0373935_0034637 3300035692 Bacteria 3148
288 Ga0373935_0061538 3300035692 Bacteria 2403
289 Ga0373935_0100274 3300035692 Bacteria 1908
290 Ga0373935_0454430 3300035692 Bacteria 926
291 Ga0373927_0001854 3300035695 Bacteria 15665
292 Ga0373927_0014387 3300035695 Bacteria 5238
293 Ga0373927_0016084 3300035695 Bacteria 4936
294 Ga0373927_0080086 3300035695 Bacteria 2116
295 Ga0373927_0508446 3300035695 Bacteria 796
296 Ga0373927_0967623 3300035695 Bacteria 562
297 Ga0373933_0067825 3300035724 Bacteria 2165
298 Ga0373933_0113459 3300035724 Bacteria 1692
299 Ga0373947_0002000 3300035725 Bacteria 12444
300 Ga0373947_0202068 3300035725 Bacteria 1300
301 Ga0373947_0475941 3300035725 Bacteria 847
302 Ga0373947_1010679 3300035725 Bacteria 567
303 Ga0373937_0046242 3300036401 Bacteria 3979
304 Ga0373937_0051286 3300036401 Bacteria 3781
305 Ga0373925_0000990 3300037068 Bacteria 25795
306 Ga0373925_0058038 3300037068 Bacteria 2901
307 Ga0373925_0152103 3300037068 Bacteria 1818
308 Ga0373925_0272183 3300037068 Bacteria 1362
309 Ga0373925_0317183 3300037068 Bacteria 1261
310 Ga0373925_0538733 3300037068 Bacteria 960
311 Ga0395899_0035868 3300037312 Bacteria 3721
312 Ga0395899_0344734 3300037312 Bacteria 998
313 Ga0395900_0001625 3300037418 Bacteria 26414
314 Ga0395900_0335459 3300037418 Bacteria 1489
315 Ga0395898_0001570 3300037466 Bacteria 31287
316 Ga0395898_0100938 3300037466 Bacteria 2771
317 Ga0395898_0101148 3300037466 Bacteria 2768
318 Ga0436364_0879689 3300037853 Unclassified 1356
319 Ga0395901_0027632 3300038443 Bacteria 5831
320 Ga0395901_0204088 3300038443 Bacteria 2071
321 Ga0395901_2013977 3300038443 Bacteria 523
322 Ga0436365_0874071 3300039437 Bacteria 903
323 Ga0436365_1546527 3300039437 Bacteria 1012
324 Ga0466966_0477461 3300044684 Bacteria 750
325 Ga0466970_0667000 3300044765 Bacteria 605
326 Ga0466960_0263064 3300044901 Bacteria 962
327 Ga0495592_0033417 3300046454 Bacteria 3879
328 Ga0495592_0430752 3300046454 Bacteria 830
329 Ga0495603_0014642 3300046455 Bacteria 4741
330 Ga0495603_0118905 3300046455 Bacteria 1540
331 Ga0495590_0038785 3300046457 Bacteria 1662
332 Ga0495629_0012028 3300046459 Bacteria 6273
333 Ga0495629_0029993 3300046459 Bacteria 3856
334 Ga0495629_0589952 3300046459 Bacteria 744
335 Ga0495651_0002345 3300046462 Bacteria 14618
336 Ga0495651_0100339 3300046462 Bacteria 2156
337 Ga0495653_0010170 3300046463 Bacteria 7699
338 Ga0495653_0038115 3300046463 Bacteria 3773
339 Ga0495653_0038608 3300046463 Bacteria 3748
340 Ga0495580_0312304 3300046472 Bacteria 1069
341 Ga0495582_0198917 3300046473 Bacteria 1144
342 Ga0495605_0097853 3300046474 Bacteria 1352
343 Ga0495639_0083727 3300046475 Bacteria 1488
344 Ga0495639_0201400 3300046475 Bacteria 974
345 Ga0495662_0014560 3300046476 Bacteria 3824
346 Ga0495662_0031569 3300046476 Bacteria 2559
347 Ga0495662_0071079 3300046476 Bacteria 1686
348 Ga0495664_0001112 3300046477 Bacteria 13918
349 Ga0495664_0010311 3300046477 Bacteria 5244
350 Ga0495664_0340465 3300046477 Bacteria 904
351 Ga0495584_0165865 3300046491 Bacteria 1123
352 Ga0495585_0070715 3300046492 Bacteria 1903
353 Ga0495594_0123080 3300046499 Bacteria 1467
354 Ga0495606_0107881 3300046507 Bacteria 1684
355 Ga0495608_0005842 3300046511 Bacteria 8762
356 Ga0495608_0119674 3300046511 Bacteria 1689
357 Ga0495610_0048522 3300046512 Bacteria 2084
358 Ga0495618_0003895 3300046514 Bacteria 9216
359 Ga0495618_0081408 3300046514 Bacteria 2067
360 Ga0495618_0154394 3300046514 Bacteria 1465
361 Ga0495628_0061400 3300046516 Bacteria 2947
362 Ga0495628_0073224 3300046516 Bacteria 2669
363 Ga0495630_0012538 3300046517 Bacteria 6157
364 Ga0495630_0013325 3300046517 Bacteria 5984
365 Ga0495630_0022791 3300046517 Bacteria 4626
366 Ga0495630_0187947 3300046517 Bacteria 1576
367 Ga0495666_0061277 3300046526 Bacteria 1798
368 Ga0495666_0086203 3300046526 Bacteria 1483
369 Ga0495666_0169603 3300046526 Bacteria 1010
370 Ga0495652_0019079 3300046529 Bacteria 6108
371 Ga0495652_0042006 3300046529 Bacteria 3943
372 Ga0495652_0117286 3300046529 Bacteria 2130
373 Ga0495665_0015155 3300046531 Bacteria 4155
374 Ga0495665_0036628 3300046531 Bacteria 2619
375 Ga0495665_0170411 3300046531 Bacteria 1133
376 Ga0495640_0002634 3300046533 Bacteria 14405
377 Ga0495640_0005026 3300046533 Bacteria 10505
378 Ga0495640_0095442 3300046533 Bacteria 1957
379 Ga0495587_0000997 3300046536 Bacteria 18600
380 Ga0495598_0152439 3300046537 Bacteria 808
381 Ga0495645_0006748 3300046543 Bacteria 7977
382 Ga0495645_0277523 3300046543 Bacteria 1103
383 Ga0495667_0001459 3300046559 Bacteria 15554
384 Ga0495656_0096879 3300046615 Bacteria 1358
385 Ga0495634_0007242 3300046642 Bacteria 8362
386 Ga0495634_0045830 3300046642 Bacteria 2953
387 Ga0495611_0038625 3300046648 Bacteria 2124
388 Ga0495635_0001639 3300046663 Bacteria 15096
389 Ga0495635_0032088 3300046663 Bacteria 3645
390 Ga0495635_0047392 3300046663 Bacteria 2964
391 Ga0495635_0551480 3300046663 Bacteria 756
392 Ga0495659_0014126 3300046664 Bacteria 2610
393 Ga0495661_0118825 3300046665 Bacteria 1463
394 Ga0495657_0035539 3300046675 Bacteria 3452
395 Ga0495599_0027084 3300046678 Bacteria 3592
396 Ga0495599_0066821 3300046678 Bacteria 2246
397 Ga0495599_0239673 3300046678 Bacteria 1106
398 Ga0495623_0005325 3300046679 Bacteria 8427
399 Ga0495623_0106696 3300046679 Bacteria 1701
400 Ga0495646_0010238 3300046680 Bacteria 5965
401 Ga0495646_0024450 3300046680 Bacteria 3804
402 Ga0495647_0061778 3300046681 Bacteria 1480
403 Ga0495658_0082498 3300046683 Bacteria 1889
404 Ga0495658_0408938 3300046683 Bacteria 865
405 Ga0495613_0019367 3300046689 Bacteria 5073
406 Ga0495613_0549046 3300046689 Bacteria 773
407 Ga0495624_0000757 3300046690 Bacteria 25443
408 Ga0495624_0012335 3300046690 Bacteria 5847
409 Ga0495624_0024299 3300046690 Bacteria 3988
410 Ga0495600_0026683 3300046809 Bacteria 3729
411 Ga0495581_0077258 3300047315 Bacteria 1926
412 Ga0495581_0519952 3300047315 Bacteria 691
413 Ga0495604_0020448 3300047317 Bacteria 5286
414 Ga0495604_0043148 3300047317 Bacteria 3532
415 Ga0495604_0202574 3300047317 Bacteria 1376
416 Ga0495604_0335825 3300047317 Bacteria 1007
417 Ga0495674_0006497 3300047319 Bacteria 11214
418 Ga0495674_0061430 3300047319 Bacteria 3274
419 Ga0495674_0143195 3300047319 Bacteria 2008
420 Ga0495674_0474294 3300047319 Bacteria 1003
421 Ga0495672_0118938 3300047320 Bacteria 1407
422 Ga0495676_0120507 3300047321 Bacteria 1909
423 Ga0495676_0123863 3300047321 Bacteria 1876
424 Ga0495680_0005408 3300047322 Bacteria 12027
425 Ga0495680_0162227 3300047322 Bacteria 1622
426 Ga0495675_0007624 3300047444 Bacteria 6673
427 Ga0495675_0037632 3300047444 Bacteria 3082
428 Ga0495684_0006008 3300047471 Bacteria 9436
429 Ga0495684_0015273 3300047471 Bacteria 5914
430 Ga0495684_0054152 3300047471 Bacteria 3060
431 Ga0495684_0567147 3300047471 Bacteria 771
432 Ga0495593_0012454 3300047673 Bacteria 4862
433 Ga0495593_0020314 3300047673 Bacteria 3720
434 Ga0495593_0179641 3300047673 Bacteria 1066
435 Ga0495602_0001563 3300048088 Bacteria 22788
436 Ga0495602_0057217 3300048088 Bacteria 3422
437 Ga0495626_0209209 3300048091 Bacteria 797
438 Ga0496100_0003110 3300048903 Bacteria 8590
439 Ga0496100_0023650 3300048903 Bacteria 3736
440 Ga0496100_0858765 3300048903 Bacteria 712
441 Ga0496101_0007200 3300048904 Bacteria 7200
442 Ga0496101_0063858 3300048904 Bacteria 2681
443 Ga0496101_0129772 3300048904 Bacteria 1913
444 Ga0496102_0030056 3300048905 Bacteria 4862
445 Ga0496102_0037005 3300048905 Bacteria 4400
446 Ga0496102_0147474 3300048905 Bacteria 2209
447 Ga0496102_0306793 3300048905 Bacteria 1496
448 Ga0496102_0510302 3300048905 Bacteria 1125
449 Ga0496102_0842789 3300048905 Bacteria 839
450 Ga0496103_0028983 3300048906 Bacteria 3362
451 Ga0496103_0291759 3300048906 Unclassified 1049
452 Ga0496104_0008844 3300048907 Bacteria 8952
453 Ga0496104_0037382 3300048907 Bacteria 4540
454 Ga0496104_0943208 3300048907 Bacteria 767
455 Ga0496105_0064003 3300048908 Bacteria 3034
456 Ga0496105_0233842 3300048908 Bacteria 1493
457 Ga0496105_0389319 3300048908 Bacteria 1108
458 Ga0496106_0001779 3300048909 Bacteria 16086
459 Ga0496106_0018179 3300048909 Bacteria 5199
460 Ga0496106_0083928 3300048909 Bacteria 2450
461 Ga0496107_0001325 3300048910 Bacteria 15191
462 Ga0496107_0034085 3300048910 Bacteria 3644
463 Ga0496108_0005750 3300048911 Bacteria 10043
464 Ga0496108_0046871 3300048911 Bacteria 3612
465 Ga0496108_1317082 3300048911 Bacteria 607
466 Ga0496109_0037234 3300048912 Bacteria 4395
467 Ga0496109_0121943 3300048912 Bacteria 2429
468 Ga0496109_0312140 3300048912 Bacteria 1483
469 Ga0496109_1258777 3300048912 Bacteria 676
470 Ga0496110_0009654 3300048913 Bacteria 7813
471 Ga0496110_0016853 3300048913 Bacteria 6105
472 Ga0496110_0209916 3300048913 Bacteria 1770
473 Ga0496110_1263756 3300048913 Bacteria 647
474 Ga0496111_0059748 3300048914 Bacteria 2762
475 Ga0496111_0162106 3300048914 Bacteria 1660
476 Ga0496112_0016282 3300048915 Bacteria 6960
477 Ga0496112_0034679 3300048915 Bacteria 4911
478 Ga0496112_0071772 3300048915 Bacteria 3422
479 Ga0496113_0003760 3300048916 Bacteria 9157
480 Ga0496113_0018764 3300048916 Bacteria 4824
481 Ga0496114_0042786 3300048917 Bacteria 3754
482 Ga0496114_0190164 3300048917 Bacteria 1796
483 Ga0496114_0236038 3300048917 Bacteria 1607
484 Ga0496115_0059438 3300048918 Bacteria 3078
485 Ga0496115_0184447 3300048918 Bacteria 1724
486 Ga0496115_0326947 3300048918 Bacteria 1253
487 Ga0496115_0452534 3300048918 Bacteria 1037
488 Ga0496116_0030430 3300048919 Bacteria 3878
489 Ga0496117_0016221 3300048920 Bacteria 6295
490 Ga0496118_0019511 3300048921 Bacteria 6056
491 Ga0496122_0030993 3300048925 Bacteria 4463
492 Ga0496123_0037417 3300048926 Bacteria 3426
493 Ga0496125_0114344 3300048928 Bacteria 1944
494 Ga0501047_0346876 3300049581 Bacteria 1322
495 Ga0501047_0707376 3300049581 Bacteria 825
496 Ga0501067_0613896 3300049583 Unclassified 610
497 Ga0501068_0433014 3300049584 Bacteria 850
498 Ga0501070_0085520 3300049586 Bacteria 2611
499 Ga0501071_0329306 3300049587 Bacteria 1161
500 Ga0501073_0532089 3300049589 Bacteria 812
501 Ga0501074_0275709 3300049590 Bacteria 1196
502 Ga0501076_0352788 3300049592 Bacteria 1208
503 Ga0501079_0324533 3300049741 Bacteria 1205
504 Ga0501080_0940011 3300049742 Bacteria 752
505 Ga0501080_1470411 3300049742 Bacteria 580
506 Ga0501083_0098047 3300049744 Bacteria 1934
507 Ga0501044_0301465 3300049823 Bacteria 1531
508 Ga0501045_0398777 3300049824 Bacteria 1024
509 nmdc:mga03683_138447_c1 3300050489 Bacteria 1093
510 nmdc:mga00v17_69379_c2 3300050491 Bacteria 707
511 nmdc:mga0yw44_132466_c1 3300050492 Bacteria 1615
512 nmdc:mga0yw44_336641_c1 3300050492 Bacteria 1015
513 nmdc:mga0yw44_345263_c1 3300050492 Bacteria 1001
514 nmdc:mga0yw44_424759_c1 3300050492 Bacteria 900
515 nmdc:mga05p37_1646631_c1 3300050507 Bacteria 629
516 nmdc:mga05p37_254501_c1 3300050507 Bacteria 2105
517 nmdc:mga05p37_342992_c1 3300050507 Bacteria 1761
518 nmdc:mga05p37_445966_c1 3300050507 Bacteria 1499
519 nmdc:mga0qj67_218416_c1 3300050509 Bacteria 1547
520 nmdc:mga0qj67_762301_c1 3300050509 Bacteria 767
521 nmdc:mga06r32_670301_c1 3300050510 Bacteria 1004
522 nmdc:mga08y16_1120992_c1 3300050511 Bacteria 761
523 nmdc:mga0n895_32058_c1 3300050512 Bacteria 5040
524 nmdc:mga0n895_441567_c1 3300050512 Bacteria 1314
525 nmdc:mga0rr50_784491_c1 3300050513 Bacteria 813
526 nmdc:mga08x19_117457_c1 3300050514 Bacteria 1779
527 nmdc:mga08x19_409850_c1 3300050514 Bacteria 951
528 nmdc:mga08x19_527614_c1 3300050514 Bacteria 835
529 nmdc:mga08x19_697561_c1 3300050514 Unclassified 720
530 nmdc:mga0a205_612851_c1 3300050515 Bacteria 941
531 nmdc:mga0a205_7350_c1 3300050515 Bacteria 9975
532 Ga0495601_0005264 3300053077 Bacteria 7527
533 Ga0495601_0020109 3300053077 Bacteria 4075
534 Ga0495601_0027672 3300053077 Bacteria 3506
535 Ga0495601_0135771 3300053077 Bacteria 1603
536 Ga0495601_0674176 3300053077 Bacteria 661
537 Ga0495612_0000550 3300053078 Bacteria 15056
538 Ga0495612_0004137 3300053078 Bacteria 6010
539 Ga0495612_0074094 3300053078 Bacteria 1423
540 Ga0495612_0133331 3300053078 Bacteria 1074
541 Ga0500635_0005717 3300053080 Bacteria 3283
542 Ga0495595_0000348 3300053084 Bacteria 17637
543 Ga0495595_0015463 3300053084 Bacteria 3255
544 Ga0495595_0137615 3300053084 Bacteria 1197
545 Ga0495619_0000950 3300053085 Bacteria 18988
546 Ga0495619_0002230 3300053085 Bacteria 12815
547 Ga0500651_0327018 3300053093 Bacteria 874
548 Ga0500566_0219242 3300053094 Bacteria 947
549 Ga0500554_032778 3300053102 Bacteria 1544
550 Ga0500614_022970 3300053123 Bacteria 1462
551 Ga0500658_0003487 3300053134 Bacteria 5934
552 Ga0500559_0092141 3300053136 Bacteria 1388
553 Ga0500568_0000524 3300053139 Bacteria 28340
554 Ga0500604_0015008 3300053151 Bacteria 2115
555 Ga0500622_0003585 3300053156 Bacteria 10241
556 Ga0500633_0112295 3300053160 Bacteria 1010
557 Ga0500638_116105 3300053162 Bacteria 1230
558 Ga0500637_0000165 3300053178 Bacteria 24401

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10301277 Ga0075364_103012771 130
2 3300050512 nmdc:mga0n895_441567_c1 nmdc:mga0n895_441567_c1_456_911 133
3 iso_pu_bacteria 2595698237 2596375840 136
4 iso_pu_bacteria 2738543032 2739355057 136
5 iso_pu_bacteria 2889306138 2889308570 136
6 iso_pu_bacteria 2902330777 2902331164 136
7 iso_pu_bacteria 2902405164 2902408455 136
8 iso_pu_bacteria 2928125067 2928125402 136
9 iso_pu_bacteria 2939669807 2939670099 136
10 iso_pu_bacteria 3003665799 3003670940 136
11 3300005347 Ga0070668_100209823 Ga0070668_1002098232 137
12 3300005548 Ga0070665_100265308 Ga0070665_1002653082 137
13 3300025297 Ga0209758_1068494 Ga0209758_10684942 137
14 3300025923 Ga0207681_10030187 Ga0207681_100301872 137
15 3300048920 Ga0496117_0016221 Ga0496117_0016221_2160_2714 137
16 3300048921 Ga0496118_0019511 Ga0496118_0019511_2267_2821 137
17 3300048925 Ga0496122_0030993 Ga0496122_0030993_1946_2500 137
18 3300048926 Ga0496123_0037417 Ga0496123_0037417_2608_3162 137
19 3300048928 Ga0496125_0114344 Ga0496125_0114344_481_1050 137
20 3300050509 nmdc:mga0qj67_762301_c1 nmdc:mga0qj67_762301_c1_63_632 137
21 3300025925 Ga0207650_10812566 Ga0207650_108125662 138
22 3300005937 Ga0081455_10000861 Ga0081455_100008615 139
23 3300031235 Ga0265330_10424187 Ga0265330_104241871 139
24 3300031241 Ga0265325_10033119 Ga0265325_100331192 139
25 3300031249 Ga0265339_10268464 Ga0265339_102684642 139
26 3300031344 Ga0265316_10802380 Ga0265316_108023802 139
27 3300031711 Ga0265314_10059407 Ga0265314_100594072 139
28 iso_pu_bacteria 8054563764 8054567209 139
29 3300005329 Ga0070683_101138592 Ga0070683_1011385921 140
30 3300005330 Ga0070690_100158342 Ga0070690_1001583422 140
31 3300005331 Ga0070670_100023779 Ga0070670_1000237793 140
32 3300005334 Ga0068869_100750716 Ga0068869_1007507162 140
33 3300005336 Ga0070680_100053808 Ga0070680_1000538083 140
34 3300005336 Ga0070680_100216673 Ga0070680_1002166731 140
35 3300005337 Ga0070682_100292355 Ga0070682_1002923552 140
36 3300005338 Ga0068868_100766764 Ga0068868_1007667642 140
37 3300005339 Ga0070660_100029803 Ga0070660_1000298033 140
38 3300005339 Ga0070660_100165315 Ga0070660_1001653152 140
39 3300005340 Ga0070689_100055555 Ga0070689_1000555553 140
40 3300005341 Ga0070691_10104383 Ga0070691_101043831 140
41 3300005343 Ga0070687_100385824 Ga0070687_1003858242 140
42 3300005353 Ga0070669_100189546 Ga0070669_1001895462 140
43 3300005354 Ga0070675_100424373 Ga0070675_1004243732 140
44 3300005355 Ga0070671_100006765 Ga0070671_1000067652 140
45 3300005355 Ga0070671_100317749 Ga0070671_1003177492 140
46 3300005364 Ga0070673_100029818 Ga0070673_1000298181 140
47 3300005364 Ga0070673_100668934 Ga0070673_1006689342 140
48 3300005367 Ga0070667_100082613 Ga0070667_1000826132 140
49 3300005434 Ga0070709_10282567 Ga0070709_102825672 140
50 3300005435 Ga0070714_100057464 Ga0070714_1000574643 140
51 3300005435 Ga0070714_100464539 Ga0070714_1004645392 140
52 3300005435 Ga0070714_100710491 Ga0070714_1007104912 140
53 3300005436 Ga0070713_100068124 Ga0070713_1000681242 140
54 3300005436 Ga0070713_100262494 Ga0070713_1002624942 140
55 3300005436 Ga0070713_100292024 Ga0070713_1002920242 140
56 3300005444 Ga0070694_100684073 Ga0070694_1006840731 140
57 3300005445 Ga0070708_100689211 Ga0070708_1006892111 140
58 3300005456 Ga0070678_100192549 Ga0070678_1001925492 140
59 3300005457 Ga0070662_100277958 Ga0070662_1002779582 140
60 3300005458 Ga0070681_10174760 Ga0070681_101747602 140
61 3300005467 Ga0070706_100314135 Ga0070706_1003141352 140
62 3300005468 Ga0070707_100275951 Ga0070707_1002759512 140
63 3300005471 Ga0070698_100152274 Ga0070698_1001522742 140
64 3300005530 Ga0070679_100071962 Ga0070679_1000719622 140
65 3300005530 Ga0070679_100760662 Ga0070679_1007606621 140
66 3300005535 Ga0070684_101014672 Ga0070684_1010146721 140
67 3300005536 Ga0070697_100535974 Ga0070697_1005359742 140
68 3300005563 Ga0068855_100034955 Ga0068855_1000349552 140
69 3300005563 Ga0068855_100037994 Ga0068855_1000379942 140
70 3300005563 Ga0068855_100575671 Ga0068855_1005756712 140
71 3300005564 Ga0070664_100351053 Ga0070664_1003510532 140
72 3300005577 Ga0068857_100554424 Ga0068857_1005544242 140
73 3300005578 Ga0068854_100098244 Ga0068854_1000982442 140
74 3300005614 Ga0068856_100117971 Ga0068856_1001179712 140
75 3300005614 Ga0068856_100169747 Ga0068856_1001697472 140
76 3300005614 Ga0068856_100449337 Ga0068856_1004493372 140
77 3300005615 Ga0070702_100064272 Ga0070702_1000642722 140
78 3300005616 Ga0068852_100041603 Ga0068852_1000416032 140
79 3300005616 Ga0068852_100085969 Ga0068852_1000859692 140
80 3300005617 Ga0068859_100543362 Ga0068859_1005433622 140
81 3300005618 Ga0068864_100875529 Ga0068864_1008755292 140
82 3300005718 Ga0068866_10232481 Ga0068866_102324812 140
83 3300005718 Ga0068866_10494242 Ga0068866_104942421 140
84 3300005834 Ga0068851_10133737 Ga0068851_101337372 140
85 3300005841 Ga0068863_101089439 Ga0068863_1010894392 140
86 3300005841 Ga0068863_101209358 Ga0068863_1012093581 140
87 3300005842 Ga0068858_100077800 Ga0068858_1000778002 140
88 3300005842 Ga0068858_100148583 Ga0068858_1001485832 140
89 3300005843 Ga0068860_100206069 Ga0068860_1002060692 140
90 3300005843 Ga0068860_100775170 Ga0068860_1007751702 140
91 3300005937 Ga0081455_10000982 Ga0081455_1000098228 140
92 3300005937 Ga0081455_10025271 Ga0081455_100252712 140
93 3300005937 Ga0081455_10053627 Ga0081455_100536273 140
94 3300005937 Ga0081455_10076901 Ga0081455_100769012 140
95 3300005937 Ga0081455_10295052 Ga0081455_102950522 140
96 3300005981 Ga0081538_10049206 Ga0081538_100492062 140
97 3300005981 Ga0081538_10104700 Ga0081538_101047001 140
98 3300005985 Ga0081539_10039393 Ga0081539_100393932 140
99 3300006028 Ga0070717_10121668 Ga0070717_101216682 140
100 3300006028 Ga0070717_10890549 Ga0070717_108905491 140
101 3300006038 Ga0075365_10030867 Ga0075365_100308673 140
102 3300006038 Ga0075365_10152071 Ga0075365_101520712 140
103 3300006038 Ga0075365_10217371 Ga0075365_102173712 140
104 3300006163 Ga0070715_10212732 Ga0070715_102127322 140
105 3300006173 Ga0070716_100099001 Ga0070716_1000990012 140
106 3300006173 Ga0070716_100229161 Ga0070716_1002291612 140
107 3300006173 Ga0070716_101210788 Ga0070716_1012107881 140
108 3300006175 Ga0070712_100056237 Ga0070712_1000562373 140
109 3300006175 Ga0070712_100065241 Ga0070712_1000652412 140
110 3300006175 Ga0070712_100538384 Ga0070712_1005383842 140
111 3300006175 Ga0070712_100759444 Ga0070712_1007594442 140
112 3300006177 Ga0075362_10066728 Ga0075362_100667282 140
113 3300006237 Ga0097621_100396374 Ga0097621_1003963742 140
114 3300006358 Ga0068871_100467640 Ga0068871_1004676402 140
115 3300006844 Ga0075428_100035056 Ga0075428_1000350564 140
116 3300006844 Ga0075428_100059893 Ga0075428_1000598932 140
117 3300006844 Ga0075428_100097648 Ga0075428_1000976482 140
118 3300006846 Ga0075430_100071927 Ga0075430_1000719272 140
119 3300006847 Ga0075431_100082932 Ga0075431_1000829322 140
120 3300006847 Ga0075431_100194228 Ga0075431_1001942282 140
121 3300006847 Ga0075431_100683764 Ga0075431_1006837642 140
122 3300006852 Ga0075433_10005286 Ga0075433_1000528610 140
123 3300006852 Ga0075433_10881826 Ga0075433_108818262 140
124 3300006871 Ga0075434_100013603 Ga0075434_1000136036 140
125 3300006871 Ga0075434_100287176 Ga0075434_1002871762 140
126 3300006871 Ga0075434_100461198 Ga0075434_1004611982 140
127 3300006914 Ga0075436_100190801 Ga0075436_1001908012 140
128 3300006931 Ga0097620_100543301 Ga0097620_1005433012 140
129 3300007265 Ga0099794_10013434 Ga0099794_100134342 140
130 3300009093 Ga0105240_10226403 Ga0105240_102264032 140
131 3300009093 Ga0105240_10482003 Ga0105240_104820032 140
132 3300009093 Ga0105240_11632437 Ga0105240_116324372 140
133 3300009094 Ga0111539_10370333 Ga0111539_103703332 140
134 3300009094 Ga0111539_11288564 Ga0111539_112885641 140
135 3300009101 Ga0105247_10314890 Ga0105247_103148902 140
136 3300009147 Ga0114129_10004784 Ga0114129_1000478411 140
137 3300009147 Ga0114129_10267201 Ga0114129_102672013 140
138 3300009147 Ga0114129_10667549 Ga0114129_106675492 140
139 3300009147 Ga0114129_10689981 Ga0114129_106899812 140
140 3300009147 Ga0114129_11208680 Ga0114129_112086802 140
141 3300009147 Ga0114129_11264965 Ga0114129_112649652 140
142 3300009148 Ga0105243_10057011 Ga0105243_100570112 140
143 3300009174 Ga0105241_10248416 Ga0105241_102484162 140
144 3300009176 Ga0105242_10063411 Ga0105242_100634112 140
145 3300009177 Ga0105248_10013942 Ga0105248_100139424 140
146 3300009545 Ga0105237_10321849 Ga0105237_103218492 140
147 3300009551 Ga0105238_10015570 Ga0105238_100155704 140
148 3300009551 Ga0105238_10361014 Ga0105238_103610142 140
149 3300009551 Ga0105238_11198834 Ga0105238_111988342 140
150 3300010375 Ga0105239_10010413 Ga0105239_100104135 140
151 3300010375 Ga0105239_10161723 Ga0105239_101617232 140
152 3300013100 Ga0157373_10627880 Ga0157373_106278802 140
153 3300013102 Ga0157371_10335130 Ga0157371_103351302 140
154 3300013104 Ga0157370_10220349 Ga0157370_102203492 140
155 3300013104 Ga0157370_10714311 Ga0157370_107143112 140
156 3300013297 Ga0157378_10521811 Ga0157378_105218112 140
157 3300013306 Ga0163162_10520930 Ga0163162_105209302 140
158 3300013307 Ga0157372_10295209 Ga0157372_102952092 140
159 3300013307 Ga0157372_10936010 Ga0157372_109360102 140
160 3300013307 Ga0157372_11138234 Ga0157372_111382342 140
161 3300013307 Ga0157372_11226486 Ga0157372_112264861 140
162 3300014325 Ga0163163_10456539 Ga0163163_104565392 140
163 3300014326 Ga0157380_10316912 Ga0157380_103169122 140
164 3300014968 Ga0157379_10459941 Ga0157379_104599412 140
165 3300014969 Ga0157376_10360188 Ga0157376_103601882 140
166 3300015265 Ga0182005_1070083 Ga0182005_10700832 140
167 3300020082 Ga0206353_11476676 Ga0206353_114766762 140
168 3300021361 Ga0213872_10090619 Ga0213872_100906192 140
169 3300024227 Ga0228598_1034914 Ga0228598_10349142 140
170 3300025271 Ga0207666_1029210 Ga0207666_10292102 140
171 3300025294 Ga0209025_1052026 Ga0209025_10520262 140
172 3300025893 Ga0207682_10002428 Ga0207682_100024287 140
173 3300025898 Ga0207692_10242389 Ga0207692_102423891 140
174 3300025899 Ga0207642_10321412 Ga0207642_103214122 140
175 3300025900 Ga0207710_10124807 Ga0207710_101248072 140
176 3300025901 Ga0207688_10035407 Ga0207688_100354072 140
177 3300025903 Ga0207680_10720211 Ga0207680_107202111 140
178 3300025905 Ga0207685_10299447 Ga0207685_102994472 140
179 3300025906 Ga0207699_10569457 Ga0207699_105694572 140
180 3300025909 Ga0207705_10097803 Ga0207705_100978031 140
181 3300025910 Ga0207684_10102596 Ga0207684_101025962 140
182 3300025911 Ga0207654_10287909 Ga0207654_102879092 140
183 3300025912 Ga0207707_10138718 Ga0207707_101387182 140
184 3300025912 Ga0207707_10624471 Ga0207707_106244712 140
185 3300025913 Ga0207695_10074947 Ga0207695_100749472 140
186 3300025914 Ga0207671_10146421 Ga0207671_101464212 140
187 3300025915 Ga0207693_10021787 Ga0207693_100217874 140
188 3300025915 Ga0207693_10043071 Ga0207693_100430712 140
189 3300025915 Ga0207693_10072965 Ga0207693_100729652 140
190 3300025916 Ga0207663_10213713 Ga0207663_102137131 140
191 3300025916 Ga0207663_11512945 Ga0207663_115129451 140
192 3300025917 Ga0207660_10096673 Ga0207660_100966732 140
193 3300025917 Ga0207660_10343555 Ga0207660_103435552 140
194 3300025918 Ga0207662_10069937 Ga0207662_100699372 140
195 3300025919 Ga0207657_10010839 Ga0207657_100108394 140
196 3300025920 Ga0207649_10647977 Ga0207649_106479772 140
197 3300025921 Ga0207652_10009175 Ga0207652_1000917510 140
198 3300025921 Ga0207652_10251051 Ga0207652_102510512 140
199 3300025921 Ga0207652_10961387 Ga0207652_109613872 140
200 3300025922 Ga0207646_10217228 Ga0207646_102172282 140
201 3300025924 Ga0207694_10010334 Ga0207694_100103346 140
202 3300025924 Ga0207694_10254659 Ga0207694_102546592 140
203 3300025924 Ga0207694_10843197 Ga0207694_108431971 140
204 3300025925 Ga0207650_10090398 Ga0207650_100903981 140
205 3300025925 Ga0207650_10298370 Ga0207650_102983702 140
206 3300025927 Ga0207687_10203182 Ga0207687_102031822 140
207 3300025928 Ga0207700_10181645 Ga0207700_101816452 140
208 3300025928 Ga0207700_10186121 Ga0207700_101861212 140
209 3300025928 Ga0207700_10862506 Ga0207700_108625062 140
210 3300025929 Ga0207664_10069897 Ga0207664_100698972 140
211 3300025929 Ga0207664_10117245 Ga0207664_101172453 140
212 3300025929 Ga0207664_10128247 Ga0207664_101282472 140
213 3300025929 Ga0207664_10187936 Ga0207664_101879362 140
214 3300025932 Ga0207690_10190884 Ga0207690_101908842 140
215 3300025932 Ga0207690_10667540 Ga0207690_106675402 140
216 3300025933 Ga0207706_10420626 Ga0207706_104206262 140
217 3300025934 Ga0207686_10072583 Ga0207686_100725832 140
218 3300025935 Ga0207709_10091209 Ga0207709_100912092 140
219 3300025935 Ga0207709_11110605 Ga0207709_111106052 140
220 3300025936 Ga0207670_10047221 Ga0207670_100472212 140
221 3300025939 Ga0207665_10035317 Ga0207665_100353174 140
222 3300025939 Ga0207665_10182025 Ga0207665_101820252 140
223 3300025940 Ga0207691_10114200 Ga0207691_101142002 140
224 3300025941 Ga0207711_10019572 Ga0207711_100195722 140
225 3300025944 Ga0207661_10049456 Ga0207661_100494562 140
226 3300025949 Ga0207667_10008645 Ga0207667_100086456 140
227 3300025949 Ga0207667_10029807 Ga0207667_100298074 140
228 3300025949 Ga0207667_10133945 Ga0207667_101339452 140
229 3300025949 Ga0207667_11049378 Ga0207667_110493782 140
230 3300025960 Ga0207651_10015265 Ga0207651_100152652 140
231 3300025981 Ga0207640_10064331 Ga0207640_100643312 140
232 3300025986 Ga0207658_10167363 Ga0207658_101673632 140
233 3300026023 Ga0207677_10991060 Ga0207677_109910602 140
234 3300026035 Ga0207703_10044593 Ga0207703_100445932 140
235 3300026035 Ga0207703_10366675 Ga0207703_103666752 140
236 3300026041 Ga0207639_10148539 Ga0207639_101485392 140
237 3300026041 Ga0207639_10940505 Ga0207639_109405052 140
238 3300026078 Ga0207702_10089361 Ga0207702_100893612 140
239 3300026078 Ga0207702_10360459 Ga0207702_103604592 140
240 3300026078 Ga0207702_10380926 Ga0207702_103809262 140
241 3300026088 Ga0207641_10264366 Ga0207641_102643662 140
242 3300026095 Ga0207676_10716272 Ga0207676_107162722 140
243 3300026116 Ga0207674_10897232 Ga0207674_108972322 140
244 3300026121 Ga0207683_10006111 Ga0207683_100061113 140
245 3300026142 Ga0207698_10200456 Ga0207698_102004562 140
246 3300026142 Ga0207698_10341482 Ga0207698_103414822 140
247 3300026142 Ga0207698_10967731 Ga0207698_109677311 140
248 3300027671 Ga0209588_1151931 Ga0209588_11519312 140
249 3300028379 Ga0268266_10127455 Ga0268266_101274553 140
250 3300028381 Ga0268264_10251582 Ga0268264_102515822 140
251 3300028381 Ga0268264_10355249 Ga0268264_103552492 140
252 3300030760 Ga0265762_1004149 Ga0265762_10041492 140
253 3300030879 Ga0265765_1012453 Ga0265765_10124532 140
254 3300031241 Ga0265325_10188726 Ga0265325_101887262 140
255 3300031595 Ga0265313_10021186 Ga0265313_100211862 140
256 3300031691 Ga0316579_10015215 Ga0316579_100152152 140
257 3300031712 Ga0265342_10001704 Ga0265342_1000170420 140
258 3300031901 Ga0307406_10321516 Ga0307406_103215162 140
259 3300033180 Ga0307510_10104614 Ga0307510_101046142 140
260 3300034816 Ga0373930_0022115 Ga0373930_0022115_412_894 140
261 3300035085 Ga0373929_0022230 Ga0373929_0022230_243_725 140
262 3300035089 Ga0373944_0041580 Ga0373944_0041580_219_704 140
263 3300035089 Ga0373944_0089767 Ga0373944_0089767_406_879 140
264 3300035111 Ga0373923_0024617 Ga0373923_0024617_1349_1825 140
265 3300035113 Ga0373936_0006771 Ga0373936_0006771_2962_3438 140
266 3300035113 Ga0373936_0043174 Ga0373936_0043174_383_847 140
267 3300035113 Ga0373936_0226461 Ga0373936_0226461_267_740 140
268 3300035114 Ga0373939_0072697 Ga0373939_0072697_462_971 140
269 3300035116 Ga0373945_0000336 Ga0373945_0000336_10776_11252 140
270 3300035116 Ga0373945_0017614 Ga0373945_0017614_514_999 140
271 3300035116 Ga0373945_0210179 Ga0373945_0210179_98_571 140
272 3300035117 Ga0373953_0083526 Ga0373953_0083526_21_497 140
273 3300035118 Ga0373954_0080175 Ga0373954_0080175_1055_1528 140
274 3300035119 Ga0373956_0014584 Ga0373956_0014584_2590_3066 140
275 3300035119 Ga0373956_0152818 Ga0373956_0152818_20_493 140
276 3300035170 Ga0373943_0000219 Ga0373943_0000219_13900_14376 140
277 3300035170 Ga0373943_0013729 Ga0373943_0013729_2295_2771 140
278 3300035171 Ga0373946_0003868 Ga0373946_0003868_1991_2467 140
279 3300035171 Ga0373946_0012342 Ga0373946_0012342_1096_1581 140
280 3300035171 Ga0373946_0151875 Ga0373946_0151875_104_580 140
281 3300035172 Ga0373955_0010609 Ga0373955_0010609_2130_2603 140
282 3300035172 Ga0373955_0067102 Ga0373955_0067102_1421_1897 140
283 3300035242 Ga0373962_0013496 Ga0373962_0013496_734_1216 140
284 3300035242 Ga0373962_0025009 Ga0373962_0025009_1095_1580 140
285 3300035242 Ga0373962_0114559 Ga0373962_0114559_96_569 140
286 3300035410 Ga0373924_0060707 Ga0373924_0060707_997_1473 140
287 3300035410 Ga0373924_0530529 Ga0373924_0530529_34_507 140
288 3300035691 Ga0373931_0005057 Ga0373931_0005057_2776_3258 140
289 3300035692 Ga0373935_0027695 Ga0373935_0027695_1641_2117 140
290 3300035692 Ga0373935_0034637 Ga0373935_0034637_1266_1742 140
291 3300035692 Ga0373935_0061538 Ga0373935_0061538_184_669 140
292 3300035692 Ga0373935_0100274 Ga0373935_0100274_642_1124 140
293 3300035692 Ga0373935_0454430 Ga0373935_0454430_359_832 140
294 3300035695 Ga0373927_0001854 Ga0373927_0001854_8981_9457 140
295 3300035695 Ga0373927_0014387 Ga0373927_0014387_1548_2024 140
296 3300035695 Ga0373927_0016084 Ga0373927_0016084_1741_2223 140
297 3300035695 Ga0373927_0080086 Ga0373927_0080086_1455_1940 140
298 3300035695 Ga0373927_0508446 Ga0373927_0508446_191_664 140
299 3300035695 Ga0373927_0967623 Ga0373927_0967623_80_544 140
300 3300035724 Ga0373933_0067825 Ga0373933_0067825_1452_1928 140
301 3300035724 Ga0373933_0113459 Ga0373933_0113459_149_622 140
302 3300035725 Ga0373947_0002000 Ga0373947_0002000_1265_1741 140
303 3300035725 Ga0373947_0202068 Ga0373947_0202068_632_1117 140
304 3300035725 Ga0373947_0475941 Ga0373947_0475941_161_634 140
305 3300035725 Ga0373947_1010679 Ga0373947_1010679_32_496 140
306 3300036401 Ga0373937_0046242 Ga0373937_0046242_1032_1508 140
307 3300036401 Ga0373937_0051286 Ga0373937_0051286_1522_1995 140
308 3300037068 Ga0373925_0000990 Ga0373925_0000990_11001_11477 140
309 3300037068 Ga0373925_0058038 Ga0373925_0058038_1471_1947 140
310 3300037068 Ga0373925_0152103 Ga0373925_0152103_1230_1703 140
311 3300037068 Ga0373925_0272183 Ga0373925_0272183_199_684 140
312 3300037068 Ga0373925_0317183 Ga0373925_0317183_87_569 140
313 3300037068 Ga0373925_0538733 Ga0373925_0538733_207_689 140
314 3300037312 Ga0395899_0035868 Ga0395899_0035868_244_705 140
315 3300037312 Ga0395899_0344734 Ga0395899_0344734_84_596 140
316 3300037418 Ga0395900_0001625 Ga0395900_0001625_24403_24864 140
317 3300037418 Ga0395900_0335459 Ga0395900_0335459_91_603 140
318 3300037466 Ga0395898_0001570 Ga0395898_0001570_2243_2704 140
319 3300037466 Ga0395898_0100938 Ga0395898_0100938_1088_1564 140
320 3300037466 Ga0395898_0101148 Ga0395898_0101148_1344_1805 140
321 3300037853 Ga0436364_0879689 Ga0436364_0879689_867_1346 140
322 3300038443 Ga0395901_0027632 Ga0395901_0027632_4310_4786 140
323 3300038443 Ga0395901_0204088 Ga0395901_0204088_177_638 140
324 3300038443 Ga0395901_2013977 Ga0395901_2013977_18_479 140
325 3300039437 Ga0436365_0874071 Ga0436365_0874071_73_552 140
326 3300039437 Ga0436365_1546527 Ga0436365_1546527_392_868 140
327 3300044684 Ga0466966_0477461 Ga0466966_0477461_25_537 140
328 3300044765 Ga0466970_0667000 Ga0466970_0667000_83_586 140
329 3300044901 Ga0466960_0263064 Ga0466960_0263064_132_644 140
330 3300046454 Ga0495592_0033417 Ga0495592_0033417_1349_1825 140
331 3300046454 Ga0495592_0430752 Ga0495592_0430752_159_644 140
332 3300046455 Ga0495603_0014642 Ga0495603_0014642_1950_2444 140
333 3300046455 Ga0495603_0118905 Ga0495603_0118905_469_942 140
334 3300046459 Ga0495629_0012028 Ga0495629_0012028_1460_1936 140
335 3300046459 Ga0495629_0029993 Ga0495629_0029993_1029_1514 140
336 3300046459 Ga0495629_0589952 Ga0495629_0589952_264_728 140
337 3300046462 Ga0495651_0002345 Ga0495651_0002345_11035_11511 140
338 3300046462 Ga0495651_0100339 Ga0495651_0100339_480_953 140
339 3300046463 Ga0495653_0010170 Ga0495653_0010170_1269_1745 140
340 3300046463 Ga0495653_0038115 Ga0495653_0038115_1946_2419 140
341 3300046463 Ga0495653_0038608 Ga0495653_0038608_3001_3486 140
342 3300046472 Ga0495580_0312304 Ga0495580_0312304_262_738 140
343 3300046473 Ga0495582_0198917 Ga0495582_0198917_278_751 140
344 3300046474 Ga0495605_0097853 Ga0495605_0097853_417_914 140
345 3300046475 Ga0495639_0083727 Ga0495639_0083727_696_1181 140
346 3300046475 Ga0495639_0201400 Ga0495639_0201400_326_802 140
347 3300046476 Ga0495662_0014560 Ga0495662_0014560_1432_1917 140
348 3300046476 Ga0495662_0031569 Ga0495662_0031569_956_1432 140
349 3300046476 Ga0495662_0071079 Ga0495662_0071079_387_863 140
350 3300046477 Ga0495664_0001112 Ga0495664_0001112_98_583 140
351 3300046477 Ga0495664_0010311 Ga0495664_0010311_880_1356 140
352 3300046477 Ga0495664_0340465 Ga0495664_0340465_262_735 140
353 3300046491 Ga0495584_0165865 Ga0495584_0165865_447_923 140
354 3300046492 Ga0495585_0070715 Ga0495585_0070715_1131_1607 140
355 3300046499 Ga0495594_0123080 Ga0495594_0123080_42_518 140
356 3300046511 Ga0495608_0005842 Ga0495608_0005842_2865_3341 140
357 3300046511 Ga0495608_0119674 Ga0495608_0119674_114_587 140
358 3300046514 Ga0495618_0003895 Ga0495618_0003895_4336_4812 140
359 3300046514 Ga0495618_0081408 Ga0495618_0081408_1119_1595 140
360 3300046514 Ga0495618_0154394 Ga0495618_0154394_784_1269 140
361 3300046516 Ga0495628_0061400 Ga0495628_0061400_1567_2043 140
362 3300046516 Ga0495628_0073224 Ga0495628_0073224_170_643 140
363 3300046517 Ga0495630_0012538 Ga0495630_0012538_487_963 140
364 3300046517 Ga0495630_0013325 Ga0495630_0013325_2042_2527 140
365 3300046517 Ga0495630_0022791 Ga0495630_0022791_1911_2387 140
366 3300046517 Ga0495630_0187947 Ga0495630_0187947_552_1064 140
367 3300046526 Ga0495666_0061277 Ga0495666_0061277_558_1034 140
368 3300046526 Ga0495666_0086203 Ga0495666_0086203_387_863 140
369 3300046526 Ga0495666_0169603 Ga0495666_0169603_221_706 140
370 3300046529 Ga0495652_0019079 Ga0495652_0019079_3307_3792 140
371 3300046529 Ga0495652_0042006 Ga0495652_0042006_2959_3435 140
372 3300046529 Ga0495652_0117286 Ga0495652_0117286_234_698 140
373 3300046531 Ga0495665_0015155 Ga0495665_0015155_2766_3242 140
374 3300046531 Ga0495665_0036628 Ga0495665_0036628_1372_1848 140
375 3300046531 Ga0495665_0170411 Ga0495665_0170411_156_641 140
376 3300046533 Ga0495640_0002634 Ga0495640_0002634_8712_9188 140
377 3300046533 Ga0495640_0005026 Ga0495640_0005026_9105_9590 140
378 3300046533 Ga0495640_0095442 Ga0495640_0095442_1137_1613 140
379 3300046536 Ga0495587_0000997 Ga0495587_0000997_15252_15728 140
380 3300046537 Ga0495598_0152439 Ga0495598_0152439_215_715 140
381 3300046543 Ga0495645_0006748 Ga0495645_0006748_2067_2552 140
382 3300046543 Ga0495645_0277523 Ga0495645_0277523_272_745 140
383 3300046559 Ga0495667_0001459 Ga0495667_0001459_7437_7913 140
384 3300046615 Ga0495656_0096879 Ga0495656_0096879_185_661 140
385 3300046642 Ga0495634_0007242 Ga0495634_0007242_3549_4025 140
386 3300046642 Ga0495634_0045830 Ga0495634_0045830_695_1180 140
387 3300046648 Ga0495611_0038625 Ga0495611_0038625_1379_1855 140
388 3300046663 Ga0495635_0001639 Ga0495635_0001639_7426_7911 140
389 3300046663 Ga0495635_0032088 Ga0495635_0032088_1638_2114 140
390 3300046663 Ga0495635_0047392 Ga0495635_0047392_1364_1837 140
391 3300046663 Ga0495635_0551480 Ga0495635_0551480_38_550 140
392 3300046664 Ga0495659_0014126 Ga0495659_0014126_1580_2056 140
393 3300046675 Ga0495657_0035539 Ga0495657_0035539_1280_1756 140
394 3300046678 Ga0495599_0027084 Ga0495599_0027084_2244_2720 140
395 3300046678 Ga0495599_0066821 Ga0495599_0066821_423_896 140
396 3300046678 Ga0495599_0239673 Ga0495599_0239673_171_683 140
397 3300046679 Ga0495623_0005325 Ga0495623_0005325_5594_6070 140
398 3300046679 Ga0495623_0106696 Ga0495623_0106696_544_1017 140
399 3300046680 Ga0495646_0010238 Ga0495646_0010238_4424_4900 140
400 3300046680 Ga0495646_0024450 Ga0495646_0024450_1732_2217 140
401 3300046681 Ga0495647_0061778 Ga0495647_0061778_272_748 140
402 3300046683 Ga0495658_0082498 Ga0495658_0082498_1167_1643 140
403 3300046683 Ga0495658_0408938 Ga0495658_0408938_60_533 140
404 3300046689 Ga0495613_0019367 Ga0495613_0019367_1711_2187 140
405 3300046689 Ga0495613_0549046 Ga0495613_0549046_232_705 140
406 3300046690 Ga0495624_0000757 Ga0495624_0000757_12273_12749 140
407 3300046690 Ga0495624_0012335 Ga0495624_0012335_3728_4204 140
408 3300046690 Ga0495624_0024299 Ga0495624_0024299_1312_1797 140
409 3300046809 Ga0495600_0026683 Ga0495600_0026683_2086_2562 140
410 3300047315 Ga0495581_0077258 Ga0495581_0077258_338_814 140
411 3300047315 Ga0495581_0519952 Ga0495581_0519952_84_560 140
412 3300047317 Ga0495604_0020448 Ga0495604_0020448_1934_2410 140
413 3300047317 Ga0495604_0043148 Ga0495604_0043148_1753_2226 140
414 3300047317 Ga0495604_0202574 Ga0495604_0202574_596_1081 140
415 3300047317 Ga0495604_0335825 Ga0495604_0335825_288_800 140
416 3300047319 Ga0495674_0006497 Ga0495674_0006497_6030_6515 140
417 3300047319 Ga0495674_0061430 Ga0495674_0061430_1592_2068 140
418 3300047319 Ga0495674_0143195 Ga0495674_0143195_57_533 140
419 3300047319 Ga0495674_0474294 Ga0495674_0474294_35_547 140
420 3300047320 Ga0495672_0118938 Ga0495672_0118938_757_1233 140
421 3300047321 Ga0495676_0120507 Ga0495676_0120507_1146_1622 140
422 3300047321 Ga0495676_0123863 Ga0495676_0123863_564_1040 140
423 3300047322 Ga0495680_0005408 Ga0495680_0005408_1169_1645 140
424 3300047322 Ga0495680_0162227 Ga0495680_0162227_122_595 140
425 3300047444 Ga0495675_0007624 Ga0495675_0007624_3360_3836 140
426 3300047444 Ga0495675_0037632 Ga0495675_0037632_1222_1695 140
427 3300047471 Ga0495684_0006008 Ga0495684_0006008_8168_8653 140
428 3300047471 Ga0495684_0015273 Ga0495684_0015273_3517_3993 140
429 3300047471 Ga0495684_0054152 Ga0495684_0054152_360_836 140
430 3300047471 Ga0495684_0567147 Ga0495684_0567147_246_719 140
431 3300047673 Ga0495593_0012454 Ga0495593_0012454_3839_4315 140
432 3300047673 Ga0495593_0020314 Ga0495593_0020314_1365_1841 140
433 3300047673 Ga0495593_0179641 Ga0495593_0179641_369_833 140
434 3300048088 Ga0495602_0001563 Ga0495602_0001563_19182_19658 140
435 3300048088 Ga0495602_0057217 Ga0495602_0057217_988_1461 140
436 3300048903 Ga0496100_0003110 Ga0496100_0003110_1962_2426 140
437 3300048903 Ga0496100_0023650 Ga0496100_0023650_835_1317 140
438 3300048903 Ga0496100_0858765 Ga0496100_0858765_154_639 140
439 3300048904 Ga0496101_0007200 Ga0496101_0007200_5672_6136 140
440 3300048904 Ga0496101_0063858 Ga0496101_0063858_1778_2260 140
441 3300048904 Ga0496101_0129772 Ga0496101_0129772_617_1159 140
442 3300048905 Ga0496102_0030056 Ga0496102_0030056_1335_1799 140
443 3300048905 Ga0496102_0037005 Ga0496102_0037005_1161_1643 140
444 3300048905 Ga0496102_0147474 Ga0496102_0147474_1548_2036 140
445 3300048905 Ga0496102_0306793 Ga0496102_0306793_518_1060 140
446 3300048905 Ga0496102_0510302 Ga0496102_0510302_356_832 140
447 3300048905 Ga0496102_0842789 Ga0496102_0842789_79_645 140
448 3300048906 Ga0496103_0028983 Ga0496103_0028983_2729_3211 140
449 3300048906 Ga0496103_0291759 Ga0496103_0291759_248_712 140
450 3300048907 Ga0496104_0008844 Ga0496104_0008844_7142_7606 140
451 3300048907 Ga0496104_0037382 Ga0496104_0037382_463_945 140
452 3300048907 Ga0496104_0943208 Ga0496104_0943208_91_576 140
453 3300048908 Ga0496105_0064003 Ga0496105_0064003_2215_2679 140
454 3300048908 Ga0496105_0233842 Ga0496105_0233842_245_787 140
455 3300048908 Ga0496105_0389319 Ga0496105_0389319_179_664 140
456 3300048909 Ga0496106_0001779 Ga0496106_0001779_4540_5004 140
457 3300048909 Ga0496106_0083928 Ga0496106_0083928_1727_2209 140
458 3300048910 Ga0496107_0001325 Ga0496107_0001325_14083_14547 140
459 3300048910 Ga0496107_0034085 Ga0496107_0034085_463_945 140
460 3300048911 Ga0496108_0005750 Ga0496108_0005750_3932_4396 140
461 3300048911 Ga0496108_0046871 Ga0496108_0046871_2907_3389 140
462 3300048911 Ga0496108_1317082 Ga0496108_1317082_97_573 140
463 3300048912 Ga0496109_0037234 Ga0496109_0037234_2693_3157 140
464 3300048912 Ga0496109_0121943 Ga0496109_0121943_1739_2215 140
465 3300048912 Ga0496109_0312140 Ga0496109_0312140_27_509 140
466 3300048912 Ga0496109_1258777 Ga0496109_1258777_136_609 140
467 3300048913 Ga0496110_0009654 Ga0496110_0009654_4656_5138 140
468 3300048913 Ga0496110_0016853 Ga0496110_0016853_1411_1875 140
469 3300048913 Ga0496110_0209916 Ga0496110_0209916_282_824 140
470 3300048913 Ga0496110_1263756 Ga0496110_1263756_85_570 140
471 3300048914 Ga0496111_0059748 Ga0496111_0059748_1870_2334 140
472 3300048914 Ga0496111_0162106 Ga0496111_0162106_137_619 140
473 3300048915 Ga0496112_0016282 Ga0496112_0016282_1896_2378 140
474 3300048915 Ga0496112_0034679 Ga0496112_0034679_4109_4573 140
475 3300048915 Ga0496112_0071772 Ga0496112_0071772_2870_3412 140
476 3300048916 Ga0496113_0003760 Ga0496113_0003760_6111_6593 140
477 3300048916 Ga0496113_0018764 Ga0496113_0018764_4076_4540 140
478 3300048917 Ga0496114_0042786 Ga0496114_0042786_1768_2250 140
479 3300048917 Ga0496114_0190164 Ga0496114_0190164_621_1163 140
480 3300048917 Ga0496114_0236038 Ga0496114_0236038_804_1268 140
481 3300048918 Ga0496115_0059438 Ga0496115_0059438_2204_2686 140
482 3300048918 Ga0496115_0184447 Ga0496115_0184447_285_749 140
483 3300048918 Ga0496115_0326947 Ga0496115_0326947_237_779 140
484 3300048918 Ga0496115_0452534 Ga0496115_0452534_513_989 140
485 3300049581 Ga0501047_0346876 Ga0501047_0346876_808_1278 140
486 3300049581 Ga0501047_0707376 Ga0501047_0707376_335_799 140
487 3300049583 Ga0501067_0613896 Ga0501067_0613896_57_521 140
488 3300049584 Ga0501068_0433014 Ga0501068_0433014_212_682 140
489 3300049586 Ga0501070_0085520 Ga0501070_0085520_1970_2434 140
490 3300049587 Ga0501071_0329306 Ga0501071_0329306_558_1028 140
491 3300049589 Ga0501073_0532089 Ga0501073_0532089_155_625 140
492 3300049590 Ga0501074_0275709 Ga0501074_0275709_119_589 140
493 3300049592 Ga0501076_0352788 Ga0501076_0352788_617_1087 140
494 3300049741 Ga0501079_0324533 Ga0501079_0324533_142_612 140
495 3300049742 Ga0501080_0940011 Ga0501080_0940011_144_614 140
496 3300049742 Ga0501080_1470411 Ga0501080_1470411_70_534 140
497 3300049744 Ga0501083_0098047 Ga0501083_0098047_805_1278 140
498 3300049823 Ga0501044_0301465 Ga0501044_0301465_832_1302 140
499 3300049824 Ga0501045_0398777 Ga0501045_0398777_78_554 140
500 3300050489 nmdc:mga03683_138447_c1 nmdc:mga03683_138447_c1_432_908 140
501 3300050491 nmdc:mga00v17_69379_c2 nmdc:mga00v17_69379_c2_14_490 140
502 3300050492 nmdc:mga0yw44_132466_c1 nmdc:mga0yw44_132466_c1_239_703 140
503 3300050492 nmdc:mga0yw44_336641_c1 nmdc:mga0yw44_336641_c1_181_657 140
504 3300050492 nmdc:mga0yw44_345263_c1 nmdc:mga0yw44_345263_c1_198_662 140
505 3300050492 nmdc:mga0yw44_424759_c1 nmdc:mga0yw44_424759_c1_228_704 140
506 3300050507 nmdc:mga05p37_1646631_c1 nmdc:mga05p37_1646631_c1_55_513 140
507 3300050507 nmdc:mga05p37_254501_c1 nmdc:mga05p37_254501_c1_77_553 140
508 3300050507 nmdc:mga05p37_342992_c1 nmdc:mga05p37_342992_c1_311_787 140
509 3300050507 nmdc:mga05p37_445966_c1 nmdc:mga05p37_445966_c1_699_1175 140
510 3300050509 nmdc:mga0qj67_218416_c1 nmdc:mga0qj67_218416_c1_281_757 140
511 3300050510 nmdc:mga06r32_670301_c1 nmdc:mga06r32_670301_c1_175_651 140
512 3300050511 nmdc:mga08y16_1120992_c1 nmdc:mga08y16_1120992_c1_248_718 140
513 3300050512 nmdc:mga0n895_32058_c1 nmdc:mga0n895_32058_c1_3236_3724 140
514 3300050513 nmdc:mga0rr50_784491_c1 nmdc:mga0rr50_784491_c1_205_681 140
515 3300050514 nmdc:mga08x19_117457_c1 nmdc:mga08x19_117457_c1_123_599 140
516 3300050514 nmdc:mga08x19_409850_c1 nmdc:mga08x19_409850_c1_372_860 140
517 3300050514 nmdc:mga08x19_527614_c1 nmdc:mga08x19_527614_c1_218_694 140
518 3300050514 nmdc:mga08x19_697561_c1 nmdc:mga08x19_697561_c1_142_606 140
519 3300050515 nmdc:mga0a205_612851_c1 nmdc:mga0a205_612851_c1_325_801 140
520 3300050515 nmdc:mga0a205_7350_c1 nmdc:mga0a205_7350_c1_6940_7428 140
521 3300053077 Ga0495601_0005264 Ga0495601_0005264_4065_4550 140
522 3300053077 Ga0495601_0020109 Ga0495601_0020109_394_870 140
523 3300053077 Ga0495601_0027672 Ga0495601_0027672_1086_1598 140
524 3300053077 Ga0495601_0135771 Ga0495601_0135771_813_1286 140
525 3300053077 Ga0495601_0674176 Ga0495601_0674176_44_520 140
526 3300053078 Ga0495612_0000550 Ga0495612_0000550_5675_6160 140
527 3300053078 Ga0495612_0004137 Ga0495612_0004137_2960_3436 140
528 3300053078 Ga0495612_0074094 Ga0495612_0074094_812_1285 140
529 3300053078 Ga0495612_0133331 Ga0495612_0133331_353_865 140
530 3300053080 Ga0500635_0005717 Ga0500635_0005717_2168_2662 140
531 3300053084 Ga0495595_0000348 Ga0495595_0000348_12338_12814 140
532 3300053084 Ga0495595_0015463 Ga0495595_0015463_1144_1617 140
533 3300053084 Ga0495595_0137615 Ga0495595_0137615_197_673 140
534 3300053085 Ga0495619_0000950 Ga0495619_0000950_11836_12321 140
535 3300053085 Ga0495619_0002230 Ga0495619_0002230_4460_4936 140
536 3300053102 Ga0500554_032778 Ga0500554_032778_328_822 140
537 3300053136 Ga0500559_0092141 Ga0500559_0092141_172_645 140
538 3300053162 Ga0500638_116105 Ga0500638_116105_492_986 140
539 3300053178 Ga0500637_0000165 Ga0500637_0000165_3798_4292 140
540 iso_pu_bacteria 2510917030 2511196435 141
541 iso_pu_bacteria 3005445848 3005446630 141
542 3300046457 Ga0495590_0038785 Ga0495590_0038785_749_1276 144
543 3300046512 Ga0495610_0048522 Ga0495610_0048522_938_1492 144
544 3300048091 Ga0495626_0209209 Ga0495626_0209209_13_540 144
545 3300048919 Ga0496116_0030430 Ga0496116_0030430_3080_3607 144
546 3300053156 Ga0500622_0003585 Ga0500622_0003585_3192_3719 144
547 3300002773 JGI25152J39213_1009726 JGI25152J39213_10097263 145
548 3300003215 JGI25153J46596_10006018 JGI25153J46596_100060182 145
549 3300003354 JGI25160J50197_1040432 JGI25160J50197_10404321 145
550 3300003790 Ga0055528_1024069 Ga0055528_10240692 145
551 3300003792 Ga0055540_1009668 Ga0055540_10096684 145
552 3300005262 Ga0065165_1045017 Ga0065165_10450172 145
553 3300005337 Ga0070682_100251766 Ga0070682_1002517662 145
554 3300025245 Ga0207425_1059785 Ga0207425_10597851 145
555 3300025258 Ga0209129_1000849 Ga0209129_10008492 145
556 3300025273 Ga0209673_1044550 Ga0209673_10445502 145
557 3300025295 Ga0209564_1037622 Ga0209564_10376222 145
558 3300025297 Ga0209758_1007473 Ga0209758_10074738 145
559 3300025303 Ga0209051_1008962 Ga0209051_10089622 145
560 3300046507 Ga0495606_0107881 Ga0495606_0107881_645_1172 145
561 3300046665 Ga0495661_0118825 Ga0495661_0118825_806_1333 145
562 3300048909 Ga0496106_0018179 Ga0496106_0018179_3336_3863 145
563 3300053093 Ga0500651_0327018 Ga0500651_0327018_71_598 145
564 3300053094 Ga0500566_0219242 Ga0500566_0219242_85_612 145
565 3300053123 Ga0500614_022970 Ga0500614_022970_739_1266 145
566 3300053134 Ga0500658_0003487 Ga0500658_0003487_1317_1844 145
567 3300053139 Ga0500568_0000524 Ga0500568_0000524_3641_4168 145
568 3300053151 Ga0500604_0015008 Ga0500604_0015008_552_1079 145
569 3300053160 Ga0500633_0112295 Ga0500633_0112295_109_636 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

33

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8701 32 122
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8324 45 121
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.79 32 122
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.7705 32 131
6t8h-assembly1.cif.gz_A cryo-em structure of the dna-bound pold-pcna processive complex from p. abyssi 0.77 33 118
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8701 32 122 2.40.50.140
af_A0A0R4IAS3_25_130_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8394 33 123 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8324 45 121 2.40.50.140
af_Q9P6I0_5_106_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8116 40 123 2.40.50.140
af_Q7JZR5_15_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8087 42 123 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A3S2CCB9-F1-model_v4 Cytochrome c maturation protein CcmE 0.9055 1 129 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A7C5XFQ7-F1-model_v4 Cytochrome c maturation protein CcmE 0.9028 6 128 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A328VFI4-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.8996 9 129 GO:0005886
GO:0017004
GO:0020037
AF-A0A4Q2Z8R4-F1-model_v4 Cytochrome c maturation protein CcmE 0.8984 1 129 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A3D3SMU7-F1-model_v4 deleted 0.8947 1 128

Feature Viewer

pLDDT pTM Quality
82.12 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map