F464762
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 330 | 558 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0842789|Ga0496102_0842789_79_645 |
| Length | 188 |
| Sequence | MHDPEKWTPVFRRDHAPAKIQSPDIGTTSAMTRKRRRLVLIGGALCVLAIAVALMLNALRDSIVFFNSPSDIAQKHIPAGTRIRIGGLVKPGSVARGENLKIRFDVTDGNRDIAIAYQGVLPDLFREGQGVVAEGALDAAGQFNADTILAKHDETYMPKEVADALKKSGHWKDSYGQRAAMPAGGSGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 2 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 3 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 4 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 5 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 6 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 7 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 8 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 9 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 10 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 107 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 108 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 287 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 288 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 304 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 321 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 322 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 325 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 327 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 328 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 330 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.54 |
| Metatranscriptomes | 0.53 |
| Isolates | 1.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.68 |
| Nodule | 0 |
| Rhizoplane | 8.79 |
| Rhizosphere | 81.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1009726 | 3300002773 | Bacteria | 2259 |
| 2 | JGI25153J46596_10006018 | 3300003215 | Bacteria | 6238 |
| 3 | JGI25160J50197_1040432 | 3300003354 | Bacteria | 1081 |
| 4 | Ga0055528_1024069 | 3300003790 | Bacteria | 1838 |
| 5 | Ga0055540_1009668 | 3300003792 | Bacteria | 3300 |
| 6 | Ga0065165_1045017 | 3300005262 | Bacteria | 1287 |
| 7 | Ga0070683_101138592 | 3300005329 | Bacteria | 750 |
| 8 | Ga0070690_100158342 | 3300005330 | Bacteria | 1550 |
| 9 | Ga0070670_100023779 | 3300005331 | Bacteria | 5272 |
| 10 | Ga0068869_100750716 | 3300005334 | Bacteria | 835 |
| 11 | Ga0070680_100053808 | 3300005336 | Bacteria | 3285 |
| 12 | Ga0070680_100216673 | 3300005336 | Bacteria | 1615 |
| 13 | Ga0070682_100251766 | 3300005337 | Bacteria | 1274 |
| 14 | Ga0070682_100292355 | 3300005337 | Bacteria | 1192 |
| 15 | Ga0068868_100766764 | 3300005338 | Bacteria | 868 |
| 16 | Ga0070660_100029803 | 3300005339 | Bacteria | 4091 |
| 17 | Ga0070660_100165315 | 3300005339 | Bacteria | 1785 |
| 18 | Ga0070689_100055555 | 3300005340 | Bacteria | 3069 |
| 19 | Ga0070691_10104383 | 3300005341 | Bacteria | 1411 |
| 20 | Ga0070687_100385824 | 3300005343 | Bacteria | 914 |
| 21 | Ga0070668_100209823 | 3300005347 | Bacteria | 1602 |
| 22 | Ga0070669_100189546 | 3300005353 | Bacteria | 1612 |
| 23 | Ga0070675_100424373 | 3300005354 | Bacteria | 1189 |
| 24 | Ga0070671_100006765 | 3300005355 | Bacteria | 9170 |
| 25 | Ga0070671_100317749 | 3300005355 | Bacteria | 1327 |
| 26 | Ga0070673_100029818 | 3300005364 | Bacteria | 4073 |
| 27 | Ga0070673_100668934 | 3300005364 | Bacteria | 951 |
| 28 | Ga0070667_100082613 | 3300005367 | Bacteria | 2751 |
| 29 | Ga0070709_10282567 | 3300005434 | Bacteria | 1207 |
| 30 | Ga0070714_100057464 | 3300005435 | Bacteria | 3331 |
| 31 | Ga0070714_100464539 | 3300005435 | Bacteria | 1203 |
| 32 | Ga0070714_100710491 | 3300005435 | Bacteria | 970 |
| 33 | Ga0070713_100068124 | 3300005436 | Bacteria | 2999 |
| 34 | Ga0070713_100262494 | 3300005436 | Bacteria | 1579 |
| 35 | Ga0070713_100292024 | 3300005436 | Bacteria | 1498 |
| 36 | Ga0070694_100684073 | 3300005444 | Bacteria | 833 |
| 37 | Ga0070708_100689211 | 3300005445 | Bacteria | 962 |
| 38 | Ga0070678_100192549 | 3300005456 | Bacteria | 1677 |
| 39 | Ga0070662_100277958 | 3300005457 | Bacteria | 1354 |
| 40 | Ga0070681_10174760 | 3300005458 | Bacteria | 2069 |
| 41 | Ga0070706_100314135 | 3300005467 | Bacteria | 1462 |
| 42 | Ga0070707_100275951 | 3300005468 | Bacteria | 1634 |
| 43 | Ga0070698_100152274 | 3300005471 | Bacteria | 2260 |
| 44 | Ga0070679_100071962 | 3300005530 | Bacteria | 3449 |
| 45 | Ga0070679_100760662 | 3300005530 | Bacteria | 912 |
| 46 | Ga0070684_101014672 | 3300005535 | Bacteria | 779 |
| 47 | Ga0070697_100535974 | 3300005536 | Bacteria | 1026 |
| 48 | Ga0070665_100265308 | 3300005548 | Bacteria | 1719 |
| 49 | Ga0068855_100034955 | 3300005563 | Bacteria | 5988 |
| 50 | Ga0068855_100037994 | 3300005563 | Bacteria | 5723 |
| 51 | Ga0068855_100575671 | 3300005563 | Bacteria | 1217 |
| 52 | Ga0070664_100351053 | 3300005564 | Bacteria | 1342 |
| 53 | Ga0068857_100554424 | 3300005577 | Bacteria | 1083 |
| 54 | Ga0068854_100098244 | 3300005578 | Bacteria | 2191 |
| 55 | Ga0068856_100117971 | 3300005614 | Bacteria | 2655 |
| 56 | Ga0068856_100169747 | 3300005614 | Bacteria | 2193 |
| 57 | Ga0068856_100449337 | 3300005614 | Bacteria | 1310 |
| 58 | Ga0070702_100064272 | 3300005615 | Bacteria | 2146 |
| 59 | Ga0068852_100041603 | 3300005616 | Bacteria | 3885 |
| 60 | Ga0068852_100085969 | 3300005616 | Bacteria | 2802 |
| 61 | Ga0068859_100543362 | 3300005617 | Bacteria | 1257 |
| 62 | Ga0068864_100875529 | 3300005618 | Bacteria | 886 |
| 63 | Ga0068866_10232481 | 3300005718 | Bacteria | 1119 |
| 64 | Ga0068866_10494242 | 3300005718 | Bacteria | 808 |
| 65 | Ga0068851_10133737 | 3300005834 | Bacteria | 1343 |
| 66 | Ga0068863_101089439 | 3300005841 | Bacteria | 803 |
| 67 | Ga0068863_101209358 | 3300005841 | Bacteria | 762 |
| 68 | Ga0068858_100077800 | 3300005842 | Bacteria | 3082 |
| 69 | Ga0068858_100148583 | 3300005842 | Bacteria | 2202 |
| 70 | Ga0068860_100206069 | 3300005843 | Bacteria | 1907 |
| 71 | Ga0068860_100775170 | 3300005843 | Bacteria | 972 |
| 72 | Ga0081455_10000861 | 3300005937 | Bacteria | 39120 |
| 73 | Ga0081455_10000982 | 3300005937 | Bacteria | 36310 |
| 74 | Ga0081455_10025271 | 3300005937 | Bacteria | 5486 |
| 75 | Ga0081455_10053627 | 3300005937 | Bacteria | 3443 |
| 76 | Ga0081455_10076901 | 3300005937 | Bacteria | 2748 |
| 77 | Ga0081455_10295052 | 3300005937 | Bacteria | 1166 |
| 78 | Ga0081538_10049206 | 3300005981 | Bacteria | 2559 |
| 79 | Ga0081538_10104700 | 3300005981 | Bacteria | 1411 |
| 80 | Ga0081539_10039393 | 3300005985 | Bacteria | 2789 |
| 81 | Ga0070717_10121668 | 3300006028 | Bacteria | 2236 |
| 82 | Ga0070717_10890549 | 3300006028 | Bacteria | 810 |
| 83 | Ga0075365_10030867 | 3300006038 | Bacteria | 3436 |
| 84 | Ga0075365_10152071 | 3300006038 | Bacteria | 1610 |
| 85 | Ga0075365_10217371 | 3300006038 | Bacteria | 1340 |
| 86 | Ga0075364_10301277 | 3300006051 | Bacteria | 1091 |
| 87 | Ga0070715_10212732 | 3300006163 | Bacteria | 989 |
| 88 | Ga0070716_100099001 | 3300006173 | Bacteria | 1783 |
| 89 | Ga0070716_100229161 | 3300006173 | Bacteria | 1253 |
| 90 | Ga0070716_101210788 | 3300006173 | Bacteria | 607 |
| 91 | Ga0070712_100056237 | 3300006175 | Bacteria | 2759 |
| 92 | Ga0070712_100065241 | 3300006175 | Bacteria | 2584 |
| 93 | Ga0070712_100538384 | 3300006175 | Bacteria | 983 |
| 94 | Ga0070712_100759444 | 3300006175 | Bacteria | 830 |
| 95 | Ga0075362_10066728 | 3300006177 | Bacteria | 1636 |
| 96 | Ga0097621_100396374 | 3300006237 | Bacteria | 1235 |
| 97 | Ga0068871_100467640 | 3300006358 | Bacteria | 1132 |
| 98 | Ga0075428_100035056 | 3300006844 | Bacteria | 5532 |
| 99 | Ga0075428_100059893 | 3300006844 | Bacteria | 4168 |
| 100 | Ga0075428_100097648 | 3300006844 | Bacteria | 3202 |
| 101 | Ga0075430_100071927 | 3300006846 | Bacteria | 2901 |
| 102 | Ga0075431_100082932 | 3300006847 | Bacteria | 3310 |
| 103 | Ga0075431_100194228 | 3300006847 | Bacteria | 2079 |
| 104 | Ga0075431_100683764 | 3300006847 | Bacteria | 1004 |
| 105 | Ga0075433_10005286 | 3300006852 | Bacteria | 10127 |
| 106 | Ga0075433_10881826 | 3300006852 | Bacteria | 781 |
| 107 | Ga0075434_100013603 | 3300006871 | Bacteria | 7753 |
| 108 | Ga0075434_100287176 | 3300006871 | Bacteria | 1665 |
| 109 | Ga0075434_100461198 | 3300006871 | Bacteria | 1292 |
| 110 | Ga0075436_100190801 | 3300006914 | Bacteria | 1450 |
| 111 | Ga0097620_100543301 | 3300006931 | Bacteria | 1257 |
| 112 | Ga0099794_10013434 | 3300007265 | Bacteria | 3564 |
| 113 | Ga0105240_10226403 | 3300009093 | Bacteria | 2176 |
| 114 | Ga0105240_10482003 | 3300009093 | Bacteria | 1382 |
| 115 | Ga0105240_11632437 | 3300009093 | Bacteria | 674 |
| 116 | Ga0111539_10370333 | 3300009094 | Bacteria | 1667 |
| 117 | Ga0111539_11288564 | 3300009094 | Bacteria | 848 |
| 118 | Ga0105247_10314890 | 3300009101 | Bacteria | 1090 |
| 119 | Ga0114129_10004784 | 3300009147 | Bacteria | 19135 |
| 120 | Ga0114129_10267201 | 3300009147 | Bacteria | 2290 |
| 121 | Ga0114129_10667549 | 3300009147 | Bacteria | 1340 |
| 122 | Ga0114129_10689981 | 3300009147 | Bacteria | 1313 |
| 123 | Ga0114129_11208680 | 3300009147 | Bacteria | 941 |
| 124 | Ga0114129_11264965 | 3300009147 | Bacteria | 916 |
| 125 | Ga0105243_10057011 | 3300009148 | Bacteria | 3109 |
| 126 | Ga0105241_10248416 | 3300009174 | Bacteria | 1507 |
| 127 | Ga0105242_10063411 | 3300009176 | Bacteria | 3043 |
| 128 | Ga0105248_10013942 | 3300009177 | Bacteria | 8845 |
| 129 | Ga0105237_10321849 | 3300009545 | Bacteria | 1550 |
| 130 | Ga0105238_10015570 | 3300009551 | Bacteria | 7700 |
| 131 | Ga0105238_10361014 | 3300009551 | Bacteria | 1442 |
| 132 | Ga0105238_11198834 | 3300009551 | Bacteria | 784 |
| 133 | Ga0105239_10010413 | 3300010375 | Bacteria | 10403 |
| 134 | Ga0105239_10161723 | 3300010375 | Bacteria | 2501 |
| 135 | Ga0157373_10627880 | 3300013100 | Bacteria | 783 |
| 136 | Ga0157371_10335130 | 3300013102 | Bacteria | 1099 |
| 137 | Ga0157370_10220349 | 3300013104 | Bacteria | 1757 |
| 138 | Ga0157370_10714311 | 3300013104 | Bacteria | 914 |
| 139 | Ga0157378_10521811 | 3300013297 | Bacteria | 1189 |
| 140 | Ga0163162_10520930 | 3300013306 | Bacteria | 1318 |
| 141 | Ga0157372_10295209 | 3300013307 | Bacteria | 1885 |
| 142 | Ga0157372_10936010 | 3300013307 | Bacteria | 1005 |
| 143 | Ga0157372_11138234 | 3300013307 | Bacteria | 902 |
| 144 | Ga0157372_11226486 | 3300013307 | Bacteria | 866 |
| 145 | Ga0163163_10456539 | 3300014325 | Bacteria | 1338 |
| 146 | Ga0157380_10316912 | 3300014326 | Bacteria | 1444 |
| 147 | Ga0157379_10459941 | 3300014968 | Bacteria | 1176 |
| 148 | Ga0157376_10360188 | 3300014969 | Bacteria | 1395 |
| 149 | Ga0182005_1070083 | 3300015265 | Bacteria | 962 |
| 150 | Ga0206353_11476676 | 3300020082 | Bacteria | 986 |
| 151 | Ga0213872_10090619 | 3300021361 | Bacteria | 1368 |
| 152 | Ga0228598_1034914 | 3300024227 | Bacteria | 991 |
| 153 | Ga0207425_1059785 | 3300025245 | Bacteria | 675 |
| 154 | Ga0209129_1000849 | 3300025258 | Bacteria | 19150 |
| 155 | Ga0207666_1029210 | 3300025271 | Bacteria | 839 |
| 156 | Ga0209673_1044550 | 3300025273 | Bacteria | 1227 |
| 157 | Ga0209025_1052026 | 3300025294 | Bacteria | 1621 |
| 158 | Ga0209564_1037622 | 3300025295 | Bacteria | 1360 |
| 159 | Ga0209758_1007473 | 3300025297 | Bacteria | 7420 |
| 160 | Ga0209758_1068494 | 3300025297 | Bacteria | 1129 |
| 161 | Ga0209051_1008962 | 3300025303 | Bacteria | 5218 |
| 162 | Ga0207682_10002428 | 3300025893 | Bacteria | 8362 |
| 163 | Ga0207692_10242389 | 3300025898 | Bacteria | 1077 |
| 164 | Ga0207642_10321412 | 3300025899 | Bacteria | 904 |
| 165 | Ga0207710_10124807 | 3300025900 | Bacteria | 1232 |
| 166 | Ga0207688_10035407 | 3300025901 | Bacteria | 2766 |
| 167 | Ga0207680_10720211 | 3300025903 | Bacteria | 715 |
| 168 | Ga0207685_10299447 | 3300025905 | Bacteria | 795 |
| 169 | Ga0207699_10569457 | 3300025906 | Bacteria | 823 |
| 170 | Ga0207705_10097803 | 3300025909 | Bacteria | 2156 |
| 171 | Ga0207684_10102596 | 3300025910 | Bacteria | 2446 |
| 172 | Ga0207654_10287909 | 3300025911 | Bacteria | 1113 |
| 173 | Ga0207707_10138718 | 3300025912 | Bacteria | 2126 |
| 174 | Ga0207707_10624471 | 3300025912 | Bacteria | 910 |
| 175 | Ga0207695_10074947 | 3300025913 | Bacteria | 3444 |
| 176 | Ga0207671_10146421 | 3300025914 | Bacteria | 1822 |
| 177 | Ga0207693_10021787 | 3300025915 | Bacteria | 5095 |
| 178 | Ga0207693_10043071 | 3300025915 | Bacteria | 3553 |
| 179 | Ga0207693_10072965 | 3300025915 | Bacteria | 2687 |
| 180 | Ga0207663_10213713 | 3300025916 | Bacteria | 1399 |
| 181 | Ga0207663_11512945 | 3300025916 | Bacteria | 540 |
| 182 | Ga0207660_10096673 | 3300025917 | Bacteria | 2199 |
| 183 | Ga0207660_10343555 | 3300025917 | Bacteria | 1195 |
| 184 | Ga0207662_10069937 | 3300025918 | Bacteria | 2122 |
| 185 | Ga0207657_10010839 | 3300025919 | Bacteria | 9070 |
| 186 | Ga0207649_10647977 | 3300025920 | Bacteria | 816 |
| 187 | Ga0207652_10009175 | 3300025921 | Bacteria | 7962 |
| 188 | Ga0207652_10251051 | 3300025921 | Bacteria | 1595 |
| 189 | Ga0207652_10961387 | 3300025921 | Bacteria | 752 |
| 190 | Ga0207646_10217228 | 3300025922 | Bacteria | 1727 |
| 191 | Ga0207681_10030187 | 3300025923 | Bacteria | 3531 |
| 192 | Ga0207694_10010334 | 3300025924 | Bacteria | 7037 |
| 193 | Ga0207694_10254659 | 3300025924 | Bacteria | 1437 |
| 194 | Ga0207694_10843197 | 3300025924 | Bacteria | 775 |
| 195 | Ga0207650_10090398 | 3300025925 | Bacteria | 2338 |
| 196 | Ga0207650_10298370 | 3300025925 | Bacteria | 1315 |
| 197 | Ga0207650_10812566 | 3300025925 | Bacteria | 793 |
| 198 | Ga0207687_10203182 | 3300025927 | Bacteria | 1550 |
| 199 | Ga0207700_10181645 | 3300025928 | Bacteria | 1762 |
| 200 | Ga0207700_10186121 | 3300025928 | Bacteria | 1742 |
| 201 | Ga0207700_10862506 | 3300025928 | Bacteria | 810 |
| 202 | Ga0207664_10069897 | 3300025929 | Bacteria | 2824 |
| 203 | Ga0207664_10117245 | 3300025929 | Bacteria | 2223 |
| 204 | Ga0207664_10128247 | 3300025929 | Bacteria | 2132 |
| 205 | Ga0207664_10187936 | 3300025929 | Bacteria | 1777 |
| 206 | Ga0207690_10190884 | 3300025932 | Bacteria | 1549 |
| 207 | Ga0207690_10667540 | 3300025932 | Bacteria | 853 |
| 208 | Ga0207706_10420626 | 3300025933 | Bacteria | 1158 |
| 209 | Ga0207686_10072583 | 3300025934 | Bacteria | 2218 |
| 210 | Ga0207709_10091209 | 3300025935 | Bacteria | 1992 |
| 211 | Ga0207709_11110605 | 3300025935 | Bacteria | 649 |
| 212 | Ga0207670_10047221 | 3300025936 | Bacteria | 2866 |
| 213 | Ga0207665_10035317 | 3300025939 | Bacteria | 3318 |
| 214 | Ga0207665_10182025 | 3300025939 | Bacteria | 1522 |
| 215 | Ga0207691_10114200 | 3300025940 | Bacteria | 2399 |
| 216 | Ga0207711_10019572 | 3300025941 | Bacteria | 5635 |
| 217 | Ga0207661_10049456 | 3300025944 | Bacteria | 3347 |
| 218 | Ga0207667_10008645 | 3300025949 | Bacteria | 12074 |
| 219 | Ga0207667_10029807 | 3300025949 | Bacteria | 5912 |
| 220 | Ga0207667_10133945 | 3300025949 | Bacteria | 2552 |
| 221 | Ga0207667_11049378 | 3300025949 | Bacteria | 800 |
| 222 | Ga0207651_10015265 | 3300025960 | Bacteria | 4459 |
| 223 | Ga0207640_10064331 | 3300025981 | Bacteria | 2441 |
| 224 | Ga0207658_10167363 | 3300025986 | Bacteria | 1807 |
| 225 | Ga0207677_10991060 | 3300026023 | Bacteria | 761 |
| 226 | Ga0207703_10044593 | 3300026035 | Bacteria | 3565 |
| 227 | Ga0207703_10366675 | 3300026035 | Bacteria | 1329 |
| 228 | Ga0207639_10148539 | 3300026041 | Bacteria | 1961 |
| 229 | Ga0207639_10940505 | 3300026041 | Bacteria | 808 |
| 230 | Ga0207702_10089361 | 3300026078 | Bacteria | 2694 |
| 231 | Ga0207702_10360459 | 3300026078 | Bacteria | 1393 |
| 232 | Ga0207702_10380926 | 3300026078 | Bacteria | 1357 |
| 233 | Ga0207641_10264366 | 3300026088 | Bacteria | 1612 |
| 234 | Ga0207676_10716272 | 3300026095 | Bacteria | 971 |
| 235 | Ga0207674_10897232 | 3300026116 | Bacteria | 854 |
| 236 | Ga0207683_10006111 | 3300026121 | Bacteria | 10314 |
| 237 | Ga0207698_10200456 | 3300026142 | Bacteria | 1786 |
| 238 | Ga0207698_10341482 | 3300026142 | Bacteria | 1411 |
| 239 | Ga0207698_10967731 | 3300026142 | Bacteria | 861 |
| 240 | Ga0209588_1151931 | 3300027671 | Bacteria | 733 |
| 241 | Ga0268266_10127455 | 3300028379 | Bacteria | 2273 |
| 242 | Ga0268264_10251582 | 3300028381 | Bacteria | 1642 |
| 243 | Ga0268264_10355249 | 3300028381 | Bacteria | 1396 |
| 244 | Ga0265762_1004149 | 3300030760 | Bacteria | 2597 |
| 245 | Ga0265765_1012453 | 3300030879 | Bacteria | 964 |
| 246 | Ga0265330_10424187 | 3300031235 | Bacteria | 563 |
| 247 | Ga0265325_10033119 | 3300031241 | Bacteria | 2755 |
| 248 | Ga0265325_10188726 | 3300031241 | Bacteria | 956 |
| 249 | Ga0265339_10268464 | 3300031249 | Bacteria | 821 |
| 250 | Ga0265316_10802380 | 3300031344 | Bacteria | 660 |
| 251 | Ga0265313_10021186 | 3300031595 | Bacteria | 3561 |
| 252 | Ga0316579_10015215 | 3300031691 | Bacteria | 3336 |
| 253 | Ga0265314_10059407 | 3300031711 | Bacteria | 2615 |
| 254 | Ga0265342_10001704 | 3300031712 | Bacteria | 20117 |
| 255 | Ga0307406_10321516 | 3300031901 | Bacteria | 1197 |
| 256 | Ga0307510_10104614 | 3300033180 | Bacteria | 2602 |
| 257 | Ga0373930_0022115 | 3300034816 | Bacteria | 1255 |
| 258 | Ga0373929_0022230 | 3300035085 | Bacteria | 1293 |
| 259 | Ga0373944_0041580 | 3300035089 | Bacteria | 1423 |
| 260 | Ga0373944_0089767 | 3300035089 | Bacteria | 1026 |
| 261 | Ga0373923_0024617 | 3300035111 | Bacteria | 2377 |
| 262 | Ga0373936_0006771 | 3300035113 | Bacteria | 4313 |
| 263 | Ga0373936_0043174 | 3300035113 | Bacteria | 1812 |
| 264 | Ga0373936_0226461 | 3300035113 | Bacteria | 831 |
| 265 | Ga0373939_0072697 | 3300035114 | Bacteria | 1124 |
| 266 | Ga0373945_0000336 | 3300035116 | Bacteria | 13381 |
| 267 | Ga0373945_0017614 | 3300035116 | Bacteria | 2420 |
| 268 | Ga0373945_0210179 | 3300035116 | Bacteria | 811 |
| 269 | Ga0373953_0083526 | 3300035117 | Bacteria | 1330 |
| 270 | Ga0373954_0080175 | 3300035118 | Bacteria | 1559 |
| 271 | Ga0373956_0014584 | 3300035119 | Bacteria | 3286 |
| 272 | Ga0373956_0152818 | 3300035119 | Bacteria | 1086 |
| 273 | Ga0373943_0000219 | 3300035170 | Bacteria | 23269 |
| 274 | Ga0373943_0013729 | 3300035170 | Bacteria | 3661 |
| 275 | Ga0373946_0003868 | 3300035171 | Bacteria | 5318 |
| 276 | Ga0373946_0012342 | 3300035171 | Bacteria | 3196 |
| 277 | Ga0373946_0151875 | 3300035171 | Bacteria | 1081 |
| 278 | Ga0373955_0010609 | 3300035172 | Bacteria | 4358 |
| 279 | Ga0373955_0067102 | 3300035172 | Bacteria | 1996 |
| 280 | Ga0373962_0013496 | 3300035242 | Bacteria | 2071 |
| 281 | Ga0373962_0025009 | 3300035242 | Bacteria | 1601 |
| 282 | Ga0373962_0114559 | 3300035242 | Bacteria | 854 |
| 283 | Ga0373924_0060707 | 3300035410 | Bacteria | 1581 |
| 284 | Ga0373924_0530529 | 3300035410 | Bacteria | 530 |
| 285 | Ga0373931_0005057 | 3300035691 | Bacteria | 6065 |
| 286 | Ga0373935_0027695 | 3300035692 | Bacteria | 3503 |
| 287 | Ga0373935_0034637 | 3300035692 | Bacteria | 3148 |
| 288 | Ga0373935_0061538 | 3300035692 | Bacteria | 2403 |
| 289 | Ga0373935_0100274 | 3300035692 | Bacteria | 1908 |
| 290 | Ga0373935_0454430 | 3300035692 | Bacteria | 926 |
| 291 | Ga0373927_0001854 | 3300035695 | Bacteria | 15665 |
| 292 | Ga0373927_0014387 | 3300035695 | Bacteria | 5238 |
| 293 | Ga0373927_0016084 | 3300035695 | Bacteria | 4936 |
| 294 | Ga0373927_0080086 | 3300035695 | Bacteria | 2116 |
| 295 | Ga0373927_0508446 | 3300035695 | Bacteria | 796 |
| 296 | Ga0373927_0967623 | 3300035695 | Bacteria | 562 |
| 297 | Ga0373933_0067825 | 3300035724 | Bacteria | 2165 |
| 298 | Ga0373933_0113459 | 3300035724 | Bacteria | 1692 |
| 299 | Ga0373947_0002000 | 3300035725 | Bacteria | 12444 |
| 300 | Ga0373947_0202068 | 3300035725 | Bacteria | 1300 |
| 301 | Ga0373947_0475941 | 3300035725 | Bacteria | 847 |
| 302 | Ga0373947_1010679 | 3300035725 | Bacteria | 567 |
| 303 | Ga0373937_0046242 | 3300036401 | Bacteria | 3979 |
| 304 | Ga0373937_0051286 | 3300036401 | Bacteria | 3781 |
| 305 | Ga0373925_0000990 | 3300037068 | Bacteria | 25795 |
| 306 | Ga0373925_0058038 | 3300037068 | Bacteria | 2901 |
| 307 | Ga0373925_0152103 | 3300037068 | Bacteria | 1818 |
| 308 | Ga0373925_0272183 | 3300037068 | Bacteria | 1362 |
| 309 | Ga0373925_0317183 | 3300037068 | Bacteria | 1261 |
| 310 | Ga0373925_0538733 | 3300037068 | Bacteria | 960 |
| 311 | Ga0395899_0035868 | 3300037312 | Bacteria | 3721 |
| 312 | Ga0395899_0344734 | 3300037312 | Bacteria | 998 |
| 313 | Ga0395900_0001625 | 3300037418 | Bacteria | 26414 |
| 314 | Ga0395900_0335459 | 3300037418 | Bacteria | 1489 |
| 315 | Ga0395898_0001570 | 3300037466 | Bacteria | 31287 |
| 316 | Ga0395898_0100938 | 3300037466 | Bacteria | 2771 |
| 317 | Ga0395898_0101148 | 3300037466 | Bacteria | 2768 |
| 318 | Ga0436364_0879689 | 3300037853 | Unclassified | 1356 |
| 319 | Ga0395901_0027632 | 3300038443 | Bacteria | 5831 |
| 320 | Ga0395901_0204088 | 3300038443 | Bacteria | 2071 |
| 321 | Ga0395901_2013977 | 3300038443 | Bacteria | 523 |
| 322 | Ga0436365_0874071 | 3300039437 | Bacteria | 903 |
| 323 | Ga0436365_1546527 | 3300039437 | Bacteria | 1012 |
| 324 | Ga0466966_0477461 | 3300044684 | Bacteria | 750 |
| 325 | Ga0466970_0667000 | 3300044765 | Bacteria | 605 |
| 326 | Ga0466960_0263064 | 3300044901 | Bacteria | 962 |
| 327 | Ga0495592_0033417 | 3300046454 | Bacteria | 3879 |
| 328 | Ga0495592_0430752 | 3300046454 | Bacteria | 830 |
| 329 | Ga0495603_0014642 | 3300046455 | Bacteria | 4741 |
| 330 | Ga0495603_0118905 | 3300046455 | Bacteria | 1540 |
| 331 | Ga0495590_0038785 | 3300046457 | Bacteria | 1662 |
| 332 | Ga0495629_0012028 | 3300046459 | Bacteria | 6273 |
| 333 | Ga0495629_0029993 | 3300046459 | Bacteria | 3856 |
| 334 | Ga0495629_0589952 | 3300046459 | Bacteria | 744 |
| 335 | Ga0495651_0002345 | 3300046462 | Bacteria | 14618 |
| 336 | Ga0495651_0100339 | 3300046462 | Bacteria | 2156 |
| 337 | Ga0495653_0010170 | 3300046463 | Bacteria | 7699 |
| 338 | Ga0495653_0038115 | 3300046463 | Bacteria | 3773 |
| 339 | Ga0495653_0038608 | 3300046463 | Bacteria | 3748 |
| 340 | Ga0495580_0312304 | 3300046472 | Bacteria | 1069 |
| 341 | Ga0495582_0198917 | 3300046473 | Bacteria | 1144 |
| 342 | Ga0495605_0097853 | 3300046474 | Bacteria | 1352 |
| 343 | Ga0495639_0083727 | 3300046475 | Bacteria | 1488 |
| 344 | Ga0495639_0201400 | 3300046475 | Bacteria | 974 |
| 345 | Ga0495662_0014560 | 3300046476 | Bacteria | 3824 |
| 346 | Ga0495662_0031569 | 3300046476 | Bacteria | 2559 |
| 347 | Ga0495662_0071079 | 3300046476 | Bacteria | 1686 |
| 348 | Ga0495664_0001112 | 3300046477 | Bacteria | 13918 |
| 349 | Ga0495664_0010311 | 3300046477 | Bacteria | 5244 |
| 350 | Ga0495664_0340465 | 3300046477 | Bacteria | 904 |
| 351 | Ga0495584_0165865 | 3300046491 | Bacteria | 1123 |
| 352 | Ga0495585_0070715 | 3300046492 | Bacteria | 1903 |
| 353 | Ga0495594_0123080 | 3300046499 | Bacteria | 1467 |
| 354 | Ga0495606_0107881 | 3300046507 | Bacteria | 1684 |
| 355 | Ga0495608_0005842 | 3300046511 | Bacteria | 8762 |
| 356 | Ga0495608_0119674 | 3300046511 | Bacteria | 1689 |
| 357 | Ga0495610_0048522 | 3300046512 | Bacteria | 2084 |
| 358 | Ga0495618_0003895 | 3300046514 | Bacteria | 9216 |
| 359 | Ga0495618_0081408 | 3300046514 | Bacteria | 2067 |
| 360 | Ga0495618_0154394 | 3300046514 | Bacteria | 1465 |
| 361 | Ga0495628_0061400 | 3300046516 | Bacteria | 2947 |
| 362 | Ga0495628_0073224 | 3300046516 | Bacteria | 2669 |
| 363 | Ga0495630_0012538 | 3300046517 | Bacteria | 6157 |
| 364 | Ga0495630_0013325 | 3300046517 | Bacteria | 5984 |
| 365 | Ga0495630_0022791 | 3300046517 | Bacteria | 4626 |
| 366 | Ga0495630_0187947 | 3300046517 | Bacteria | 1576 |
| 367 | Ga0495666_0061277 | 3300046526 | Bacteria | 1798 |
| 368 | Ga0495666_0086203 | 3300046526 | Bacteria | 1483 |
| 369 | Ga0495666_0169603 | 3300046526 | Bacteria | 1010 |
| 370 | Ga0495652_0019079 | 3300046529 | Bacteria | 6108 |
| 371 | Ga0495652_0042006 | 3300046529 | Bacteria | 3943 |
| 372 | Ga0495652_0117286 | 3300046529 | Bacteria | 2130 |
| 373 | Ga0495665_0015155 | 3300046531 | Bacteria | 4155 |
| 374 | Ga0495665_0036628 | 3300046531 | Bacteria | 2619 |
| 375 | Ga0495665_0170411 | 3300046531 | Bacteria | 1133 |
| 376 | Ga0495640_0002634 | 3300046533 | Bacteria | 14405 |
| 377 | Ga0495640_0005026 | 3300046533 | Bacteria | 10505 |
| 378 | Ga0495640_0095442 | 3300046533 | Bacteria | 1957 |
| 379 | Ga0495587_0000997 | 3300046536 | Bacteria | 18600 |
| 380 | Ga0495598_0152439 | 3300046537 | Bacteria | 808 |
| 381 | Ga0495645_0006748 | 3300046543 | Bacteria | 7977 |
| 382 | Ga0495645_0277523 | 3300046543 | Bacteria | 1103 |
| 383 | Ga0495667_0001459 | 3300046559 | Bacteria | 15554 |
| 384 | Ga0495656_0096879 | 3300046615 | Bacteria | 1358 |
| 385 | Ga0495634_0007242 | 3300046642 | Bacteria | 8362 |
| 386 | Ga0495634_0045830 | 3300046642 | Bacteria | 2953 |
| 387 | Ga0495611_0038625 | 3300046648 | Bacteria | 2124 |
| 388 | Ga0495635_0001639 | 3300046663 | Bacteria | 15096 |
| 389 | Ga0495635_0032088 | 3300046663 | Bacteria | 3645 |
| 390 | Ga0495635_0047392 | 3300046663 | Bacteria | 2964 |
| 391 | Ga0495635_0551480 | 3300046663 | Bacteria | 756 |
| 392 | Ga0495659_0014126 | 3300046664 | Bacteria | 2610 |
| 393 | Ga0495661_0118825 | 3300046665 | Bacteria | 1463 |
| 394 | Ga0495657_0035539 | 3300046675 | Bacteria | 3452 |
| 395 | Ga0495599_0027084 | 3300046678 | Bacteria | 3592 |
| 396 | Ga0495599_0066821 | 3300046678 | Bacteria | 2246 |
| 397 | Ga0495599_0239673 | 3300046678 | Bacteria | 1106 |
| 398 | Ga0495623_0005325 | 3300046679 | Bacteria | 8427 |
| 399 | Ga0495623_0106696 | 3300046679 | Bacteria | 1701 |
| 400 | Ga0495646_0010238 | 3300046680 | Bacteria | 5965 |
| 401 | Ga0495646_0024450 | 3300046680 | Bacteria | 3804 |
| 402 | Ga0495647_0061778 | 3300046681 | Bacteria | 1480 |
| 403 | Ga0495658_0082498 | 3300046683 | Bacteria | 1889 |
| 404 | Ga0495658_0408938 | 3300046683 | Bacteria | 865 |
| 405 | Ga0495613_0019367 | 3300046689 | Bacteria | 5073 |
| 406 | Ga0495613_0549046 | 3300046689 | Bacteria | 773 |
| 407 | Ga0495624_0000757 | 3300046690 | Bacteria | 25443 |
| 408 | Ga0495624_0012335 | 3300046690 | Bacteria | 5847 |
| 409 | Ga0495624_0024299 | 3300046690 | Bacteria | 3988 |
| 410 | Ga0495600_0026683 | 3300046809 | Bacteria | 3729 |
| 411 | Ga0495581_0077258 | 3300047315 | Bacteria | 1926 |
| 412 | Ga0495581_0519952 | 3300047315 | Bacteria | 691 |
| 413 | Ga0495604_0020448 | 3300047317 | Bacteria | 5286 |
| 414 | Ga0495604_0043148 | 3300047317 | Bacteria | 3532 |
| 415 | Ga0495604_0202574 | 3300047317 | Bacteria | 1376 |
| 416 | Ga0495604_0335825 | 3300047317 | Bacteria | 1007 |
| 417 | Ga0495674_0006497 | 3300047319 | Bacteria | 11214 |
| 418 | Ga0495674_0061430 | 3300047319 | Bacteria | 3274 |
| 419 | Ga0495674_0143195 | 3300047319 | Bacteria | 2008 |
| 420 | Ga0495674_0474294 | 3300047319 | Bacteria | 1003 |
| 421 | Ga0495672_0118938 | 3300047320 | Bacteria | 1407 |
| 422 | Ga0495676_0120507 | 3300047321 | Bacteria | 1909 |
| 423 | Ga0495676_0123863 | 3300047321 | Bacteria | 1876 |
| 424 | Ga0495680_0005408 | 3300047322 | Bacteria | 12027 |
| 425 | Ga0495680_0162227 | 3300047322 | Bacteria | 1622 |
| 426 | Ga0495675_0007624 | 3300047444 | Bacteria | 6673 |
| 427 | Ga0495675_0037632 | 3300047444 | Bacteria | 3082 |
| 428 | Ga0495684_0006008 | 3300047471 | Bacteria | 9436 |
| 429 | Ga0495684_0015273 | 3300047471 | Bacteria | 5914 |
| 430 | Ga0495684_0054152 | 3300047471 | Bacteria | 3060 |
| 431 | Ga0495684_0567147 | 3300047471 | Bacteria | 771 |
| 432 | Ga0495593_0012454 | 3300047673 | Bacteria | 4862 |
| 433 | Ga0495593_0020314 | 3300047673 | Bacteria | 3720 |
| 434 | Ga0495593_0179641 | 3300047673 | Bacteria | 1066 |
| 435 | Ga0495602_0001563 | 3300048088 | Bacteria | 22788 |
| 436 | Ga0495602_0057217 | 3300048088 | Bacteria | 3422 |
| 437 | Ga0495626_0209209 | 3300048091 | Bacteria | 797 |
| 438 | Ga0496100_0003110 | 3300048903 | Bacteria | 8590 |
| 439 | Ga0496100_0023650 | 3300048903 | Bacteria | 3736 |
| 440 | Ga0496100_0858765 | 3300048903 | Bacteria | 712 |
| 441 | Ga0496101_0007200 | 3300048904 | Bacteria | 7200 |
| 442 | Ga0496101_0063858 | 3300048904 | Bacteria | 2681 |
| 443 | Ga0496101_0129772 | 3300048904 | Bacteria | 1913 |
| 444 | Ga0496102_0030056 | 3300048905 | Bacteria | 4862 |
| 445 | Ga0496102_0037005 | 3300048905 | Bacteria | 4400 |
| 446 | Ga0496102_0147474 | 3300048905 | Bacteria | 2209 |
| 447 | Ga0496102_0306793 | 3300048905 | Bacteria | 1496 |
| 448 | Ga0496102_0510302 | 3300048905 | Bacteria | 1125 |
| 449 | Ga0496102_0842789 | 3300048905 | Bacteria | 839 |
| 450 | Ga0496103_0028983 | 3300048906 | Bacteria | 3362 |
| 451 | Ga0496103_0291759 | 3300048906 | Unclassified | 1049 |
| 452 | Ga0496104_0008844 | 3300048907 | Bacteria | 8952 |
| 453 | Ga0496104_0037382 | 3300048907 | Bacteria | 4540 |
| 454 | Ga0496104_0943208 | 3300048907 | Bacteria | 767 |
| 455 | Ga0496105_0064003 | 3300048908 | Bacteria | 3034 |
| 456 | Ga0496105_0233842 | 3300048908 | Bacteria | 1493 |
| 457 | Ga0496105_0389319 | 3300048908 | Bacteria | 1108 |
| 458 | Ga0496106_0001779 | 3300048909 | Bacteria | 16086 |
| 459 | Ga0496106_0018179 | 3300048909 | Bacteria | 5199 |
| 460 | Ga0496106_0083928 | 3300048909 | Bacteria | 2450 |
| 461 | Ga0496107_0001325 | 3300048910 | Bacteria | 15191 |
| 462 | Ga0496107_0034085 | 3300048910 | Bacteria | 3644 |
| 463 | Ga0496108_0005750 | 3300048911 | Bacteria | 10043 |
| 464 | Ga0496108_0046871 | 3300048911 | Bacteria | 3612 |
| 465 | Ga0496108_1317082 | 3300048911 | Bacteria | 607 |
| 466 | Ga0496109_0037234 | 3300048912 | Bacteria | 4395 |
| 467 | Ga0496109_0121943 | 3300048912 | Bacteria | 2429 |
| 468 | Ga0496109_0312140 | 3300048912 | Bacteria | 1483 |
| 469 | Ga0496109_1258777 | 3300048912 | Bacteria | 676 |
| 470 | Ga0496110_0009654 | 3300048913 | Bacteria | 7813 |
| 471 | Ga0496110_0016853 | 3300048913 | Bacteria | 6105 |
| 472 | Ga0496110_0209916 | 3300048913 | Bacteria | 1770 |
| 473 | Ga0496110_1263756 | 3300048913 | Bacteria | 647 |
| 474 | Ga0496111_0059748 | 3300048914 | Bacteria | 2762 |
| 475 | Ga0496111_0162106 | 3300048914 | Bacteria | 1660 |
| 476 | Ga0496112_0016282 | 3300048915 | Bacteria | 6960 |
| 477 | Ga0496112_0034679 | 3300048915 | Bacteria | 4911 |
| 478 | Ga0496112_0071772 | 3300048915 | Bacteria | 3422 |
| 479 | Ga0496113_0003760 | 3300048916 | Bacteria | 9157 |
| 480 | Ga0496113_0018764 | 3300048916 | Bacteria | 4824 |
| 481 | Ga0496114_0042786 | 3300048917 | Bacteria | 3754 |
| 482 | Ga0496114_0190164 | 3300048917 | Bacteria | 1796 |
| 483 | Ga0496114_0236038 | 3300048917 | Bacteria | 1607 |
| 484 | Ga0496115_0059438 | 3300048918 | Bacteria | 3078 |
| 485 | Ga0496115_0184447 | 3300048918 | Bacteria | 1724 |
| 486 | Ga0496115_0326947 | 3300048918 | Bacteria | 1253 |
| 487 | Ga0496115_0452534 | 3300048918 | Bacteria | 1037 |
| 488 | Ga0496116_0030430 | 3300048919 | Bacteria | 3878 |
| 489 | Ga0496117_0016221 | 3300048920 | Bacteria | 6295 |
| 490 | Ga0496118_0019511 | 3300048921 | Bacteria | 6056 |
| 491 | Ga0496122_0030993 | 3300048925 | Bacteria | 4463 |
| 492 | Ga0496123_0037417 | 3300048926 | Bacteria | 3426 |
| 493 | Ga0496125_0114344 | 3300048928 | Bacteria | 1944 |
| 494 | Ga0501047_0346876 | 3300049581 | Bacteria | 1322 |
| 495 | Ga0501047_0707376 | 3300049581 | Bacteria | 825 |
| 496 | Ga0501067_0613896 | 3300049583 | Unclassified | 610 |
| 497 | Ga0501068_0433014 | 3300049584 | Bacteria | 850 |
| 498 | Ga0501070_0085520 | 3300049586 | Bacteria | 2611 |
| 499 | Ga0501071_0329306 | 3300049587 | Bacteria | 1161 |
| 500 | Ga0501073_0532089 | 3300049589 | Bacteria | 812 |
| 501 | Ga0501074_0275709 | 3300049590 | Bacteria | 1196 |
| 502 | Ga0501076_0352788 | 3300049592 | Bacteria | 1208 |
| 503 | Ga0501079_0324533 | 3300049741 | Bacteria | 1205 |
| 504 | Ga0501080_0940011 | 3300049742 | Bacteria | 752 |
| 505 | Ga0501080_1470411 | 3300049742 | Bacteria | 580 |
| 506 | Ga0501083_0098047 | 3300049744 | Bacteria | 1934 |
| 507 | Ga0501044_0301465 | 3300049823 | Bacteria | 1531 |
| 508 | Ga0501045_0398777 | 3300049824 | Bacteria | 1024 |
| 509 | nmdc:mga03683_138447_c1 | 3300050489 | Bacteria | 1093 |
| 510 | nmdc:mga00v17_69379_c2 | 3300050491 | Bacteria | 707 |
| 511 | nmdc:mga0yw44_132466_c1 | 3300050492 | Bacteria | 1615 |
| 512 | nmdc:mga0yw44_336641_c1 | 3300050492 | Bacteria | 1015 |
| 513 | nmdc:mga0yw44_345263_c1 | 3300050492 | Bacteria | 1001 |
| 514 | nmdc:mga0yw44_424759_c1 | 3300050492 | Bacteria | 900 |
| 515 | nmdc:mga05p37_1646631_c1 | 3300050507 | Bacteria | 629 |
| 516 | nmdc:mga05p37_254501_c1 | 3300050507 | Bacteria | 2105 |
| 517 | nmdc:mga05p37_342992_c1 | 3300050507 | Bacteria | 1761 |
| 518 | nmdc:mga05p37_445966_c1 | 3300050507 | Bacteria | 1499 |
| 519 | nmdc:mga0qj67_218416_c1 | 3300050509 | Bacteria | 1547 |
| 520 | nmdc:mga0qj67_762301_c1 | 3300050509 | Bacteria | 767 |
| 521 | nmdc:mga06r32_670301_c1 | 3300050510 | Bacteria | 1004 |
| 522 | nmdc:mga08y16_1120992_c1 | 3300050511 | Bacteria | 761 |
| 523 | nmdc:mga0n895_32058_c1 | 3300050512 | Bacteria | 5040 |
| 524 | nmdc:mga0n895_441567_c1 | 3300050512 | Bacteria | 1314 |
| 525 | nmdc:mga0rr50_784491_c1 | 3300050513 | Bacteria | 813 |
| 526 | nmdc:mga08x19_117457_c1 | 3300050514 | Bacteria | 1779 |
| 527 | nmdc:mga08x19_409850_c1 | 3300050514 | Bacteria | 951 |
| 528 | nmdc:mga08x19_527614_c1 | 3300050514 | Bacteria | 835 |
| 529 | nmdc:mga08x19_697561_c1 | 3300050514 | Unclassified | 720 |
| 530 | nmdc:mga0a205_612851_c1 | 3300050515 | Bacteria | 941 |
| 531 | nmdc:mga0a205_7350_c1 | 3300050515 | Bacteria | 9975 |
| 532 | Ga0495601_0005264 | 3300053077 | Bacteria | 7527 |
| 533 | Ga0495601_0020109 | 3300053077 | Bacteria | 4075 |
| 534 | Ga0495601_0027672 | 3300053077 | Bacteria | 3506 |
| 535 | Ga0495601_0135771 | 3300053077 | Bacteria | 1603 |
| 536 | Ga0495601_0674176 | 3300053077 | Bacteria | 661 |
| 537 | Ga0495612_0000550 | 3300053078 | Bacteria | 15056 |
| 538 | Ga0495612_0004137 | 3300053078 | Bacteria | 6010 |
| 539 | Ga0495612_0074094 | 3300053078 | Bacteria | 1423 |
| 540 | Ga0495612_0133331 | 3300053078 | Bacteria | 1074 |
| 541 | Ga0500635_0005717 | 3300053080 | Bacteria | 3283 |
| 542 | Ga0495595_0000348 | 3300053084 | Bacteria | 17637 |
| 543 | Ga0495595_0015463 | 3300053084 | Bacteria | 3255 |
| 544 | Ga0495595_0137615 | 3300053084 | Bacteria | 1197 |
| 545 | Ga0495619_0000950 | 3300053085 | Bacteria | 18988 |
| 546 | Ga0495619_0002230 | 3300053085 | Bacteria | 12815 |
| 547 | Ga0500651_0327018 | 3300053093 | Bacteria | 874 |
| 548 | Ga0500566_0219242 | 3300053094 | Bacteria | 947 |
| 549 | Ga0500554_032778 | 3300053102 | Bacteria | 1544 |
| 550 | Ga0500614_022970 | 3300053123 | Bacteria | 1462 |
| 551 | Ga0500658_0003487 | 3300053134 | Bacteria | 5934 |
| 552 | Ga0500559_0092141 | 3300053136 | Bacteria | 1388 |
| 553 | Ga0500568_0000524 | 3300053139 | Bacteria | 28340 |
| 554 | Ga0500604_0015008 | 3300053151 | Bacteria | 2115 |
| 555 | Ga0500622_0003585 | 3300053156 | Bacteria | 10241 |
| 556 | Ga0500633_0112295 | 3300053160 | Bacteria | 1010 |
| 557 | Ga0500638_116105 | 3300053162 | Bacteria | 1230 |
| 558 | Ga0500637_0000165 | 3300053178 | Bacteria | 24401 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006051 | Ga0075364_10301277 | Ga0075364_103012771 | 130 |
| 2 | 3300050512 | nmdc:mga0n895_441567_c1 | nmdc:mga0n895_441567_c1_456_911 | 133 |
| 3 | iso_pu_bacteria | 2595698237 | 2596375840 | 136 |
| 4 | iso_pu_bacteria | 2738543032 | 2739355057 | 136 |
| 5 | iso_pu_bacteria | 2889306138 | 2889308570 | 136 |
| 6 | iso_pu_bacteria | 2902330777 | 2902331164 | 136 |
| 7 | iso_pu_bacteria | 2902405164 | 2902408455 | 136 |
| 8 | iso_pu_bacteria | 2928125067 | 2928125402 | 136 |
| 9 | iso_pu_bacteria | 2939669807 | 2939670099 | 136 |
| 10 | iso_pu_bacteria | 3003665799 | 3003670940 | 136 |
| 11 | 3300005347 | Ga0070668_100209823 | Ga0070668_1002098232 | 137 |
| 12 | 3300005548 | Ga0070665_100265308 | Ga0070665_1002653082 | 137 |
| 13 | 3300025297 | Ga0209758_1068494 | Ga0209758_10684942 | 137 |
| 14 | 3300025923 | Ga0207681_10030187 | Ga0207681_100301872 | 137 |
| 15 | 3300048920 | Ga0496117_0016221 | Ga0496117_0016221_2160_2714 | 137 |
| 16 | 3300048921 | Ga0496118_0019511 | Ga0496118_0019511_2267_2821 | 137 |
| 17 | 3300048925 | Ga0496122_0030993 | Ga0496122_0030993_1946_2500 | 137 |
| 18 | 3300048926 | Ga0496123_0037417 | Ga0496123_0037417_2608_3162 | 137 |
| 19 | 3300048928 | Ga0496125_0114344 | Ga0496125_0114344_481_1050 | 137 |
| 20 | 3300050509 | nmdc:mga0qj67_762301_c1 | nmdc:mga0qj67_762301_c1_63_632 | 137 |
| 21 | 3300025925 | Ga0207650_10812566 | Ga0207650_108125662 | 138 |
| 22 | 3300005937 | Ga0081455_10000861 | Ga0081455_100008615 | 139 |
| 23 | 3300031235 | Ga0265330_10424187 | Ga0265330_104241871 | 139 |
| 24 | 3300031241 | Ga0265325_10033119 | Ga0265325_100331192 | 139 |
| 25 | 3300031249 | Ga0265339_10268464 | Ga0265339_102684642 | 139 |
| 26 | 3300031344 | Ga0265316_10802380 | Ga0265316_108023802 | 139 |
| 27 | 3300031711 | Ga0265314_10059407 | Ga0265314_100594072 | 139 |
| 28 | iso_pu_bacteria | 8054563764 | 8054567209 | 139 |
| 29 | 3300005329 | Ga0070683_101138592 | Ga0070683_1011385921 | 140 |
| 30 | 3300005330 | Ga0070690_100158342 | Ga0070690_1001583422 | 140 |
| 31 | 3300005331 | Ga0070670_100023779 | Ga0070670_1000237793 | 140 |
| 32 | 3300005334 | Ga0068869_100750716 | Ga0068869_1007507162 | 140 |
| 33 | 3300005336 | Ga0070680_100053808 | Ga0070680_1000538083 | 140 |
| 34 | 3300005336 | Ga0070680_100216673 | Ga0070680_1002166731 | 140 |
| 35 | 3300005337 | Ga0070682_100292355 | Ga0070682_1002923552 | 140 |
| 36 | 3300005338 | Ga0068868_100766764 | Ga0068868_1007667642 | 140 |
| 37 | 3300005339 | Ga0070660_100029803 | Ga0070660_1000298033 | 140 |
| 38 | 3300005339 | Ga0070660_100165315 | Ga0070660_1001653152 | 140 |
| 39 | 3300005340 | Ga0070689_100055555 | Ga0070689_1000555553 | 140 |
| 40 | 3300005341 | Ga0070691_10104383 | Ga0070691_101043831 | 140 |
| 41 | 3300005343 | Ga0070687_100385824 | Ga0070687_1003858242 | 140 |
| 42 | 3300005353 | Ga0070669_100189546 | Ga0070669_1001895462 | 140 |
| 43 | 3300005354 | Ga0070675_100424373 | Ga0070675_1004243732 | 140 |
| 44 | 3300005355 | Ga0070671_100006765 | Ga0070671_1000067652 | 140 |
| 45 | 3300005355 | Ga0070671_100317749 | Ga0070671_1003177492 | 140 |
| 46 | 3300005364 | Ga0070673_100029818 | Ga0070673_1000298181 | 140 |
| 47 | 3300005364 | Ga0070673_100668934 | Ga0070673_1006689342 | 140 |
| 48 | 3300005367 | Ga0070667_100082613 | Ga0070667_1000826132 | 140 |
| 49 | 3300005434 | Ga0070709_10282567 | Ga0070709_102825672 | 140 |
| 50 | 3300005435 | Ga0070714_100057464 | Ga0070714_1000574643 | 140 |
| 51 | 3300005435 | Ga0070714_100464539 | Ga0070714_1004645392 | 140 |
| 52 | 3300005435 | Ga0070714_100710491 | Ga0070714_1007104912 | 140 |
| 53 | 3300005436 | Ga0070713_100068124 | Ga0070713_1000681242 | 140 |
| 54 | 3300005436 | Ga0070713_100262494 | Ga0070713_1002624942 | 140 |
| 55 | 3300005436 | Ga0070713_100292024 | Ga0070713_1002920242 | 140 |
| 56 | 3300005444 | Ga0070694_100684073 | Ga0070694_1006840731 | 140 |
| 57 | 3300005445 | Ga0070708_100689211 | Ga0070708_1006892111 | 140 |
| 58 | 3300005456 | Ga0070678_100192549 | Ga0070678_1001925492 | 140 |
| 59 | 3300005457 | Ga0070662_100277958 | Ga0070662_1002779582 | 140 |
| 60 | 3300005458 | Ga0070681_10174760 | Ga0070681_101747602 | 140 |
| 61 | 3300005467 | Ga0070706_100314135 | Ga0070706_1003141352 | 140 |
| 62 | 3300005468 | Ga0070707_100275951 | Ga0070707_1002759512 | 140 |
| 63 | 3300005471 | Ga0070698_100152274 | Ga0070698_1001522742 | 140 |
| 64 | 3300005530 | Ga0070679_100071962 | Ga0070679_1000719622 | 140 |
| 65 | 3300005530 | Ga0070679_100760662 | Ga0070679_1007606621 | 140 |
| 66 | 3300005535 | Ga0070684_101014672 | Ga0070684_1010146721 | 140 |
| 67 | 3300005536 | Ga0070697_100535974 | Ga0070697_1005359742 | 140 |
| 68 | 3300005563 | Ga0068855_100034955 | Ga0068855_1000349552 | 140 |
| 69 | 3300005563 | Ga0068855_100037994 | Ga0068855_1000379942 | 140 |
| 70 | 3300005563 | Ga0068855_100575671 | Ga0068855_1005756712 | 140 |
| 71 | 3300005564 | Ga0070664_100351053 | Ga0070664_1003510532 | 140 |
| 72 | 3300005577 | Ga0068857_100554424 | Ga0068857_1005544242 | 140 |
| 73 | 3300005578 | Ga0068854_100098244 | Ga0068854_1000982442 | 140 |
| 74 | 3300005614 | Ga0068856_100117971 | Ga0068856_1001179712 | 140 |
| 75 | 3300005614 | Ga0068856_100169747 | Ga0068856_1001697472 | 140 |
| 76 | 3300005614 | Ga0068856_100449337 | Ga0068856_1004493372 | 140 |
| 77 | 3300005615 | Ga0070702_100064272 | Ga0070702_1000642722 | 140 |
| 78 | 3300005616 | Ga0068852_100041603 | Ga0068852_1000416032 | 140 |
| 79 | 3300005616 | Ga0068852_100085969 | Ga0068852_1000859692 | 140 |
| 80 | 3300005617 | Ga0068859_100543362 | Ga0068859_1005433622 | 140 |
| 81 | 3300005618 | Ga0068864_100875529 | Ga0068864_1008755292 | 140 |
| 82 | 3300005718 | Ga0068866_10232481 | Ga0068866_102324812 | 140 |
| 83 | 3300005718 | Ga0068866_10494242 | Ga0068866_104942421 | 140 |
| 84 | 3300005834 | Ga0068851_10133737 | Ga0068851_101337372 | 140 |
| 85 | 3300005841 | Ga0068863_101089439 | Ga0068863_1010894392 | 140 |
| 86 | 3300005841 | Ga0068863_101209358 | Ga0068863_1012093581 | 140 |
| 87 | 3300005842 | Ga0068858_100077800 | Ga0068858_1000778002 | 140 |
| 88 | 3300005842 | Ga0068858_100148583 | Ga0068858_1001485832 | 140 |
| 89 | 3300005843 | Ga0068860_100206069 | Ga0068860_1002060692 | 140 |
| 90 | 3300005843 | Ga0068860_100775170 | Ga0068860_1007751702 | 140 |
| 91 | 3300005937 | Ga0081455_10000982 | Ga0081455_1000098228 | 140 |
| 92 | 3300005937 | Ga0081455_10025271 | Ga0081455_100252712 | 140 |
| 93 | 3300005937 | Ga0081455_10053627 | Ga0081455_100536273 | 140 |
| 94 | 3300005937 | Ga0081455_10076901 | Ga0081455_100769012 | 140 |
| 95 | 3300005937 | Ga0081455_10295052 | Ga0081455_102950522 | 140 |
| 96 | 3300005981 | Ga0081538_10049206 | Ga0081538_100492062 | 140 |
| 97 | 3300005981 | Ga0081538_10104700 | Ga0081538_101047001 | 140 |
| 98 | 3300005985 | Ga0081539_10039393 | Ga0081539_100393932 | 140 |
| 99 | 3300006028 | Ga0070717_10121668 | Ga0070717_101216682 | 140 |
| 100 | 3300006028 | Ga0070717_10890549 | Ga0070717_108905491 | 140 |
| 101 | 3300006038 | Ga0075365_10030867 | Ga0075365_100308673 | 140 |
| 102 | 3300006038 | Ga0075365_10152071 | Ga0075365_101520712 | 140 |
| 103 | 3300006038 | Ga0075365_10217371 | Ga0075365_102173712 | 140 |
| 104 | 3300006163 | Ga0070715_10212732 | Ga0070715_102127322 | 140 |
| 105 | 3300006173 | Ga0070716_100099001 | Ga0070716_1000990012 | 140 |
| 106 | 3300006173 | Ga0070716_100229161 | Ga0070716_1002291612 | 140 |
| 107 | 3300006173 | Ga0070716_101210788 | Ga0070716_1012107881 | 140 |
| 108 | 3300006175 | Ga0070712_100056237 | Ga0070712_1000562373 | 140 |
| 109 | 3300006175 | Ga0070712_100065241 | Ga0070712_1000652412 | 140 |
| 110 | 3300006175 | Ga0070712_100538384 | Ga0070712_1005383842 | 140 |
| 111 | 3300006175 | Ga0070712_100759444 | Ga0070712_1007594442 | 140 |
| 112 | 3300006177 | Ga0075362_10066728 | Ga0075362_100667282 | 140 |
| 113 | 3300006237 | Ga0097621_100396374 | Ga0097621_1003963742 | 140 |
| 114 | 3300006358 | Ga0068871_100467640 | Ga0068871_1004676402 | 140 |
| 115 | 3300006844 | Ga0075428_100035056 | Ga0075428_1000350564 | 140 |
| 116 | 3300006844 | Ga0075428_100059893 | Ga0075428_1000598932 | 140 |
| 117 | 3300006844 | Ga0075428_100097648 | Ga0075428_1000976482 | 140 |
| 118 | 3300006846 | Ga0075430_100071927 | Ga0075430_1000719272 | 140 |
| 119 | 3300006847 | Ga0075431_100082932 | Ga0075431_1000829322 | 140 |
| 120 | 3300006847 | Ga0075431_100194228 | Ga0075431_1001942282 | 140 |
| 121 | 3300006847 | Ga0075431_100683764 | Ga0075431_1006837642 | 140 |
| 122 | 3300006852 | Ga0075433_10005286 | Ga0075433_1000528610 | 140 |
| 123 | 3300006852 | Ga0075433_10881826 | Ga0075433_108818262 | 140 |
| 124 | 3300006871 | Ga0075434_100013603 | Ga0075434_1000136036 | 140 |
| 125 | 3300006871 | Ga0075434_100287176 | Ga0075434_1002871762 | 140 |
| 126 | 3300006871 | Ga0075434_100461198 | Ga0075434_1004611982 | 140 |
| 127 | 3300006914 | Ga0075436_100190801 | Ga0075436_1001908012 | 140 |
| 128 | 3300006931 | Ga0097620_100543301 | Ga0097620_1005433012 | 140 |
| 129 | 3300007265 | Ga0099794_10013434 | Ga0099794_100134342 | 140 |
| 130 | 3300009093 | Ga0105240_10226403 | Ga0105240_102264032 | 140 |
| 131 | 3300009093 | Ga0105240_10482003 | Ga0105240_104820032 | 140 |
| 132 | 3300009093 | Ga0105240_11632437 | Ga0105240_116324372 | 140 |
| 133 | 3300009094 | Ga0111539_10370333 | Ga0111539_103703332 | 140 |
| 134 | 3300009094 | Ga0111539_11288564 | Ga0111539_112885641 | 140 |
| 135 | 3300009101 | Ga0105247_10314890 | Ga0105247_103148902 | 140 |
| 136 | 3300009147 | Ga0114129_10004784 | Ga0114129_1000478411 | 140 |
| 137 | 3300009147 | Ga0114129_10267201 | Ga0114129_102672013 | 140 |
| 138 | 3300009147 | Ga0114129_10667549 | Ga0114129_106675492 | 140 |
| 139 | 3300009147 | Ga0114129_10689981 | Ga0114129_106899812 | 140 |
| 140 | 3300009147 | Ga0114129_11208680 | Ga0114129_112086802 | 140 |
| 141 | 3300009147 | Ga0114129_11264965 | Ga0114129_112649652 | 140 |
| 142 | 3300009148 | Ga0105243_10057011 | Ga0105243_100570112 | 140 |
| 143 | 3300009174 | Ga0105241_10248416 | Ga0105241_102484162 | 140 |
| 144 | 3300009176 | Ga0105242_10063411 | Ga0105242_100634112 | 140 |
| 145 | 3300009177 | Ga0105248_10013942 | Ga0105248_100139424 | 140 |
| 146 | 3300009545 | Ga0105237_10321849 | Ga0105237_103218492 | 140 |
| 147 | 3300009551 | Ga0105238_10015570 | Ga0105238_100155704 | 140 |
| 148 | 3300009551 | Ga0105238_10361014 | Ga0105238_103610142 | 140 |
| 149 | 3300009551 | Ga0105238_11198834 | Ga0105238_111988342 | 140 |
| 150 | 3300010375 | Ga0105239_10010413 | Ga0105239_100104135 | 140 |
| 151 | 3300010375 | Ga0105239_10161723 | Ga0105239_101617232 | 140 |
| 152 | 3300013100 | Ga0157373_10627880 | Ga0157373_106278802 | 140 |
| 153 | 3300013102 | Ga0157371_10335130 | Ga0157371_103351302 | 140 |
| 154 | 3300013104 | Ga0157370_10220349 | Ga0157370_102203492 | 140 |
| 155 | 3300013104 | Ga0157370_10714311 | Ga0157370_107143112 | 140 |
| 156 | 3300013297 | Ga0157378_10521811 | Ga0157378_105218112 | 140 |
| 157 | 3300013306 | Ga0163162_10520930 | Ga0163162_105209302 | 140 |
| 158 | 3300013307 | Ga0157372_10295209 | Ga0157372_102952092 | 140 |
| 159 | 3300013307 | Ga0157372_10936010 | Ga0157372_109360102 | 140 |
| 160 | 3300013307 | Ga0157372_11138234 | Ga0157372_111382342 | 140 |
| 161 | 3300013307 | Ga0157372_11226486 | Ga0157372_112264861 | 140 |
| 162 | 3300014325 | Ga0163163_10456539 | Ga0163163_104565392 | 140 |
| 163 | 3300014326 | Ga0157380_10316912 | Ga0157380_103169122 | 140 |
| 164 | 3300014968 | Ga0157379_10459941 | Ga0157379_104599412 | 140 |
| 165 | 3300014969 | Ga0157376_10360188 | Ga0157376_103601882 | 140 |
| 166 | 3300015265 | Ga0182005_1070083 | Ga0182005_10700832 | 140 |
| 167 | 3300020082 | Ga0206353_11476676 | Ga0206353_114766762 | 140 |
| 168 | 3300021361 | Ga0213872_10090619 | Ga0213872_100906192 | 140 |
| 169 | 3300024227 | Ga0228598_1034914 | Ga0228598_10349142 | 140 |
| 170 | 3300025271 | Ga0207666_1029210 | Ga0207666_10292102 | 140 |
| 171 | 3300025294 | Ga0209025_1052026 | Ga0209025_10520262 | 140 |
| 172 | 3300025893 | Ga0207682_10002428 | Ga0207682_100024287 | 140 |
| 173 | 3300025898 | Ga0207692_10242389 | Ga0207692_102423891 | 140 |
| 174 | 3300025899 | Ga0207642_10321412 | Ga0207642_103214122 | 140 |
| 175 | 3300025900 | Ga0207710_10124807 | Ga0207710_101248072 | 140 |
| 176 | 3300025901 | Ga0207688_10035407 | Ga0207688_100354072 | 140 |
| 177 | 3300025903 | Ga0207680_10720211 | Ga0207680_107202111 | 140 |
| 178 | 3300025905 | Ga0207685_10299447 | Ga0207685_102994472 | 140 |
| 179 | 3300025906 | Ga0207699_10569457 | Ga0207699_105694572 | 140 |
| 180 | 3300025909 | Ga0207705_10097803 | Ga0207705_100978031 | 140 |
| 181 | 3300025910 | Ga0207684_10102596 | Ga0207684_101025962 | 140 |
| 182 | 3300025911 | Ga0207654_10287909 | Ga0207654_102879092 | 140 |
| 183 | 3300025912 | Ga0207707_10138718 | Ga0207707_101387182 | 140 |
| 184 | 3300025912 | Ga0207707_10624471 | Ga0207707_106244712 | 140 |
| 185 | 3300025913 | Ga0207695_10074947 | Ga0207695_100749472 | 140 |
| 186 | 3300025914 | Ga0207671_10146421 | Ga0207671_101464212 | 140 |
| 187 | 3300025915 | Ga0207693_10021787 | Ga0207693_100217874 | 140 |
| 188 | 3300025915 | Ga0207693_10043071 | Ga0207693_100430712 | 140 |
| 189 | 3300025915 | Ga0207693_10072965 | Ga0207693_100729652 | 140 |
| 190 | 3300025916 | Ga0207663_10213713 | Ga0207663_102137131 | 140 |
| 191 | 3300025916 | Ga0207663_11512945 | Ga0207663_115129451 | 140 |
| 192 | 3300025917 | Ga0207660_10096673 | Ga0207660_100966732 | 140 |
| 193 | 3300025917 | Ga0207660_10343555 | Ga0207660_103435552 | 140 |
| 194 | 3300025918 | Ga0207662_10069937 | Ga0207662_100699372 | 140 |
| 195 | 3300025919 | Ga0207657_10010839 | Ga0207657_100108394 | 140 |
| 196 | 3300025920 | Ga0207649_10647977 | Ga0207649_106479772 | 140 |
| 197 | 3300025921 | Ga0207652_10009175 | Ga0207652_1000917510 | 140 |
| 198 | 3300025921 | Ga0207652_10251051 | Ga0207652_102510512 | 140 |
| 199 | 3300025921 | Ga0207652_10961387 | Ga0207652_109613872 | 140 |
| 200 | 3300025922 | Ga0207646_10217228 | Ga0207646_102172282 | 140 |
| 201 | 3300025924 | Ga0207694_10010334 | Ga0207694_100103346 | 140 |
| 202 | 3300025924 | Ga0207694_10254659 | Ga0207694_102546592 | 140 |
| 203 | 3300025924 | Ga0207694_10843197 | Ga0207694_108431971 | 140 |
| 204 | 3300025925 | Ga0207650_10090398 | Ga0207650_100903981 | 140 |
| 205 | 3300025925 | Ga0207650_10298370 | Ga0207650_102983702 | 140 |
| 206 | 3300025927 | Ga0207687_10203182 | Ga0207687_102031822 | 140 |
| 207 | 3300025928 | Ga0207700_10181645 | Ga0207700_101816452 | 140 |
| 208 | 3300025928 | Ga0207700_10186121 | Ga0207700_101861212 | 140 |
| 209 | 3300025928 | Ga0207700_10862506 | Ga0207700_108625062 | 140 |
| 210 | 3300025929 | Ga0207664_10069897 | Ga0207664_100698972 | 140 |
| 211 | 3300025929 | Ga0207664_10117245 | Ga0207664_101172453 | 140 |
| 212 | 3300025929 | Ga0207664_10128247 | Ga0207664_101282472 | 140 |
| 213 | 3300025929 | Ga0207664_10187936 | Ga0207664_101879362 | 140 |
| 214 | 3300025932 | Ga0207690_10190884 | Ga0207690_101908842 | 140 |
| 215 | 3300025932 | Ga0207690_10667540 | Ga0207690_106675402 | 140 |
| 216 | 3300025933 | Ga0207706_10420626 | Ga0207706_104206262 | 140 |
| 217 | 3300025934 | Ga0207686_10072583 | Ga0207686_100725832 | 140 |
| 218 | 3300025935 | Ga0207709_10091209 | Ga0207709_100912092 | 140 |
| 219 | 3300025935 | Ga0207709_11110605 | Ga0207709_111106052 | 140 |
| 220 | 3300025936 | Ga0207670_10047221 | Ga0207670_100472212 | 140 |
| 221 | 3300025939 | Ga0207665_10035317 | Ga0207665_100353174 | 140 |
| 222 | 3300025939 | Ga0207665_10182025 | Ga0207665_101820252 | 140 |
| 223 | 3300025940 | Ga0207691_10114200 | Ga0207691_101142002 | 140 |
| 224 | 3300025941 | Ga0207711_10019572 | Ga0207711_100195722 | 140 |
| 225 | 3300025944 | Ga0207661_10049456 | Ga0207661_100494562 | 140 |
| 226 | 3300025949 | Ga0207667_10008645 | Ga0207667_100086456 | 140 |
| 227 | 3300025949 | Ga0207667_10029807 | Ga0207667_100298074 | 140 |
| 228 | 3300025949 | Ga0207667_10133945 | Ga0207667_101339452 | 140 |
| 229 | 3300025949 | Ga0207667_11049378 | Ga0207667_110493782 | 140 |
| 230 | 3300025960 | Ga0207651_10015265 | Ga0207651_100152652 | 140 |
| 231 | 3300025981 | Ga0207640_10064331 | Ga0207640_100643312 | 140 |
| 232 | 3300025986 | Ga0207658_10167363 | Ga0207658_101673632 | 140 |
| 233 | 3300026023 | Ga0207677_10991060 | Ga0207677_109910602 | 140 |
| 234 | 3300026035 | Ga0207703_10044593 | Ga0207703_100445932 | 140 |
| 235 | 3300026035 | Ga0207703_10366675 | Ga0207703_103666752 | 140 |
| 236 | 3300026041 | Ga0207639_10148539 | Ga0207639_101485392 | 140 |
| 237 | 3300026041 | Ga0207639_10940505 | Ga0207639_109405052 | 140 |
| 238 | 3300026078 | Ga0207702_10089361 | Ga0207702_100893612 | 140 |
| 239 | 3300026078 | Ga0207702_10360459 | Ga0207702_103604592 | 140 |
| 240 | 3300026078 | Ga0207702_10380926 | Ga0207702_103809262 | 140 |
| 241 | 3300026088 | Ga0207641_10264366 | Ga0207641_102643662 | 140 |
| 242 | 3300026095 | Ga0207676_10716272 | Ga0207676_107162722 | 140 |
| 243 | 3300026116 | Ga0207674_10897232 | Ga0207674_108972322 | 140 |
| 244 | 3300026121 | Ga0207683_10006111 | Ga0207683_100061113 | 140 |
| 245 | 3300026142 | Ga0207698_10200456 | Ga0207698_102004562 | 140 |
| 246 | 3300026142 | Ga0207698_10341482 | Ga0207698_103414822 | 140 |
| 247 | 3300026142 | Ga0207698_10967731 | Ga0207698_109677311 | 140 |
| 248 | 3300027671 | Ga0209588_1151931 | Ga0209588_11519312 | 140 |
| 249 | 3300028379 | Ga0268266_10127455 | Ga0268266_101274553 | 140 |
| 250 | 3300028381 | Ga0268264_10251582 | Ga0268264_102515822 | 140 |
| 251 | 3300028381 | Ga0268264_10355249 | Ga0268264_103552492 | 140 |
| 252 | 3300030760 | Ga0265762_1004149 | Ga0265762_10041492 | 140 |
| 253 | 3300030879 | Ga0265765_1012453 | Ga0265765_10124532 | 140 |
| 254 | 3300031241 | Ga0265325_10188726 | Ga0265325_101887262 | 140 |
| 255 | 3300031595 | Ga0265313_10021186 | Ga0265313_100211862 | 140 |
| 256 | 3300031691 | Ga0316579_10015215 | Ga0316579_100152152 | 140 |
| 257 | 3300031712 | Ga0265342_10001704 | Ga0265342_1000170420 | 140 |
| 258 | 3300031901 | Ga0307406_10321516 | Ga0307406_103215162 | 140 |
| 259 | 3300033180 | Ga0307510_10104614 | Ga0307510_101046142 | 140 |
| 260 | 3300034816 | Ga0373930_0022115 | Ga0373930_0022115_412_894 | 140 |
| 261 | 3300035085 | Ga0373929_0022230 | Ga0373929_0022230_243_725 | 140 |
| 262 | 3300035089 | Ga0373944_0041580 | Ga0373944_0041580_219_704 | 140 |
| 263 | 3300035089 | Ga0373944_0089767 | Ga0373944_0089767_406_879 | 140 |
| 264 | 3300035111 | Ga0373923_0024617 | Ga0373923_0024617_1349_1825 | 140 |
| 265 | 3300035113 | Ga0373936_0006771 | Ga0373936_0006771_2962_3438 | 140 |
| 266 | 3300035113 | Ga0373936_0043174 | Ga0373936_0043174_383_847 | 140 |
| 267 | 3300035113 | Ga0373936_0226461 | Ga0373936_0226461_267_740 | 140 |
| 268 | 3300035114 | Ga0373939_0072697 | Ga0373939_0072697_462_971 | 140 |
| 269 | 3300035116 | Ga0373945_0000336 | Ga0373945_0000336_10776_11252 | 140 |
| 270 | 3300035116 | Ga0373945_0017614 | Ga0373945_0017614_514_999 | 140 |
| 271 | 3300035116 | Ga0373945_0210179 | Ga0373945_0210179_98_571 | 140 |
| 272 | 3300035117 | Ga0373953_0083526 | Ga0373953_0083526_21_497 | 140 |
| 273 | 3300035118 | Ga0373954_0080175 | Ga0373954_0080175_1055_1528 | 140 |
| 274 | 3300035119 | Ga0373956_0014584 | Ga0373956_0014584_2590_3066 | 140 |
| 275 | 3300035119 | Ga0373956_0152818 | Ga0373956_0152818_20_493 | 140 |
| 276 | 3300035170 | Ga0373943_0000219 | Ga0373943_0000219_13900_14376 | 140 |
| 277 | 3300035170 | Ga0373943_0013729 | Ga0373943_0013729_2295_2771 | 140 |
| 278 | 3300035171 | Ga0373946_0003868 | Ga0373946_0003868_1991_2467 | 140 |
| 279 | 3300035171 | Ga0373946_0012342 | Ga0373946_0012342_1096_1581 | 140 |
| 280 | 3300035171 | Ga0373946_0151875 | Ga0373946_0151875_104_580 | 140 |
| 281 | 3300035172 | Ga0373955_0010609 | Ga0373955_0010609_2130_2603 | 140 |
| 282 | 3300035172 | Ga0373955_0067102 | Ga0373955_0067102_1421_1897 | 140 |
| 283 | 3300035242 | Ga0373962_0013496 | Ga0373962_0013496_734_1216 | 140 |
| 284 | 3300035242 | Ga0373962_0025009 | Ga0373962_0025009_1095_1580 | 140 |
| 285 | 3300035242 | Ga0373962_0114559 | Ga0373962_0114559_96_569 | 140 |
| 286 | 3300035410 | Ga0373924_0060707 | Ga0373924_0060707_997_1473 | 140 |
| 287 | 3300035410 | Ga0373924_0530529 | Ga0373924_0530529_34_507 | 140 |
| 288 | 3300035691 | Ga0373931_0005057 | Ga0373931_0005057_2776_3258 | 140 |
| 289 | 3300035692 | Ga0373935_0027695 | Ga0373935_0027695_1641_2117 | 140 |
| 290 | 3300035692 | Ga0373935_0034637 | Ga0373935_0034637_1266_1742 | 140 |
| 291 | 3300035692 | Ga0373935_0061538 | Ga0373935_0061538_184_669 | 140 |
| 292 | 3300035692 | Ga0373935_0100274 | Ga0373935_0100274_642_1124 | 140 |
| 293 | 3300035692 | Ga0373935_0454430 | Ga0373935_0454430_359_832 | 140 |
| 294 | 3300035695 | Ga0373927_0001854 | Ga0373927_0001854_8981_9457 | 140 |
| 295 | 3300035695 | Ga0373927_0014387 | Ga0373927_0014387_1548_2024 | 140 |
| 296 | 3300035695 | Ga0373927_0016084 | Ga0373927_0016084_1741_2223 | 140 |
| 297 | 3300035695 | Ga0373927_0080086 | Ga0373927_0080086_1455_1940 | 140 |
| 298 | 3300035695 | Ga0373927_0508446 | Ga0373927_0508446_191_664 | 140 |
| 299 | 3300035695 | Ga0373927_0967623 | Ga0373927_0967623_80_544 | 140 |
| 300 | 3300035724 | Ga0373933_0067825 | Ga0373933_0067825_1452_1928 | 140 |
| 301 | 3300035724 | Ga0373933_0113459 | Ga0373933_0113459_149_622 | 140 |
| 302 | 3300035725 | Ga0373947_0002000 | Ga0373947_0002000_1265_1741 | 140 |
| 303 | 3300035725 | Ga0373947_0202068 | Ga0373947_0202068_632_1117 | 140 |
| 304 | 3300035725 | Ga0373947_0475941 | Ga0373947_0475941_161_634 | 140 |
| 305 | 3300035725 | Ga0373947_1010679 | Ga0373947_1010679_32_496 | 140 |
| 306 | 3300036401 | Ga0373937_0046242 | Ga0373937_0046242_1032_1508 | 140 |
| 307 | 3300036401 | Ga0373937_0051286 | Ga0373937_0051286_1522_1995 | 140 |
| 308 | 3300037068 | Ga0373925_0000990 | Ga0373925_0000990_11001_11477 | 140 |
| 309 | 3300037068 | Ga0373925_0058038 | Ga0373925_0058038_1471_1947 | 140 |
| 310 | 3300037068 | Ga0373925_0152103 | Ga0373925_0152103_1230_1703 | 140 |
| 311 | 3300037068 | Ga0373925_0272183 | Ga0373925_0272183_199_684 | 140 |
| 312 | 3300037068 | Ga0373925_0317183 | Ga0373925_0317183_87_569 | 140 |
| 313 | 3300037068 | Ga0373925_0538733 | Ga0373925_0538733_207_689 | 140 |
| 314 | 3300037312 | Ga0395899_0035868 | Ga0395899_0035868_244_705 | 140 |
| 315 | 3300037312 | Ga0395899_0344734 | Ga0395899_0344734_84_596 | 140 |
| 316 | 3300037418 | Ga0395900_0001625 | Ga0395900_0001625_24403_24864 | 140 |
| 317 | 3300037418 | Ga0395900_0335459 | Ga0395900_0335459_91_603 | 140 |
| 318 | 3300037466 | Ga0395898_0001570 | Ga0395898_0001570_2243_2704 | 140 |
| 319 | 3300037466 | Ga0395898_0100938 | Ga0395898_0100938_1088_1564 | 140 |
| 320 | 3300037466 | Ga0395898_0101148 | Ga0395898_0101148_1344_1805 | 140 |
| 321 | 3300037853 | Ga0436364_0879689 | Ga0436364_0879689_867_1346 | 140 |
| 322 | 3300038443 | Ga0395901_0027632 | Ga0395901_0027632_4310_4786 | 140 |
| 323 | 3300038443 | Ga0395901_0204088 | Ga0395901_0204088_177_638 | 140 |
| 324 | 3300038443 | Ga0395901_2013977 | Ga0395901_2013977_18_479 | 140 |
| 325 | 3300039437 | Ga0436365_0874071 | Ga0436365_0874071_73_552 | 140 |
| 326 | 3300039437 | Ga0436365_1546527 | Ga0436365_1546527_392_868 | 140 |
| 327 | 3300044684 | Ga0466966_0477461 | Ga0466966_0477461_25_537 | 140 |
| 328 | 3300044765 | Ga0466970_0667000 | Ga0466970_0667000_83_586 | 140 |
| 329 | 3300044901 | Ga0466960_0263064 | Ga0466960_0263064_132_644 | 140 |
| 330 | 3300046454 | Ga0495592_0033417 | Ga0495592_0033417_1349_1825 | 140 |
| 331 | 3300046454 | Ga0495592_0430752 | Ga0495592_0430752_159_644 | 140 |
| 332 | 3300046455 | Ga0495603_0014642 | Ga0495603_0014642_1950_2444 | 140 |
| 333 | 3300046455 | Ga0495603_0118905 | Ga0495603_0118905_469_942 | 140 |
| 334 | 3300046459 | Ga0495629_0012028 | Ga0495629_0012028_1460_1936 | 140 |
| 335 | 3300046459 | Ga0495629_0029993 | Ga0495629_0029993_1029_1514 | 140 |
| 336 | 3300046459 | Ga0495629_0589952 | Ga0495629_0589952_264_728 | 140 |
| 337 | 3300046462 | Ga0495651_0002345 | Ga0495651_0002345_11035_11511 | 140 |
| 338 | 3300046462 | Ga0495651_0100339 | Ga0495651_0100339_480_953 | 140 |
| 339 | 3300046463 | Ga0495653_0010170 | Ga0495653_0010170_1269_1745 | 140 |
| 340 | 3300046463 | Ga0495653_0038115 | Ga0495653_0038115_1946_2419 | 140 |
| 341 | 3300046463 | Ga0495653_0038608 | Ga0495653_0038608_3001_3486 | 140 |
| 342 | 3300046472 | Ga0495580_0312304 | Ga0495580_0312304_262_738 | 140 |
| 343 | 3300046473 | Ga0495582_0198917 | Ga0495582_0198917_278_751 | 140 |
| 344 | 3300046474 | Ga0495605_0097853 | Ga0495605_0097853_417_914 | 140 |
| 345 | 3300046475 | Ga0495639_0083727 | Ga0495639_0083727_696_1181 | 140 |
| 346 | 3300046475 | Ga0495639_0201400 | Ga0495639_0201400_326_802 | 140 |
| 347 | 3300046476 | Ga0495662_0014560 | Ga0495662_0014560_1432_1917 | 140 |
| 348 | 3300046476 | Ga0495662_0031569 | Ga0495662_0031569_956_1432 | 140 |
| 349 | 3300046476 | Ga0495662_0071079 | Ga0495662_0071079_387_863 | 140 |
| 350 | 3300046477 | Ga0495664_0001112 | Ga0495664_0001112_98_583 | 140 |
| 351 | 3300046477 | Ga0495664_0010311 | Ga0495664_0010311_880_1356 | 140 |
| 352 | 3300046477 | Ga0495664_0340465 | Ga0495664_0340465_262_735 | 140 |
| 353 | 3300046491 | Ga0495584_0165865 | Ga0495584_0165865_447_923 | 140 |
| 354 | 3300046492 | Ga0495585_0070715 | Ga0495585_0070715_1131_1607 | 140 |
| 355 | 3300046499 | Ga0495594_0123080 | Ga0495594_0123080_42_518 | 140 |
| 356 | 3300046511 | Ga0495608_0005842 | Ga0495608_0005842_2865_3341 | 140 |
| 357 | 3300046511 | Ga0495608_0119674 | Ga0495608_0119674_114_587 | 140 |
| 358 | 3300046514 | Ga0495618_0003895 | Ga0495618_0003895_4336_4812 | 140 |
| 359 | 3300046514 | Ga0495618_0081408 | Ga0495618_0081408_1119_1595 | 140 |
| 360 | 3300046514 | Ga0495618_0154394 | Ga0495618_0154394_784_1269 | 140 |
| 361 | 3300046516 | Ga0495628_0061400 | Ga0495628_0061400_1567_2043 | 140 |
| 362 | 3300046516 | Ga0495628_0073224 | Ga0495628_0073224_170_643 | 140 |
| 363 | 3300046517 | Ga0495630_0012538 | Ga0495630_0012538_487_963 | 140 |
| 364 | 3300046517 | Ga0495630_0013325 | Ga0495630_0013325_2042_2527 | 140 |
| 365 | 3300046517 | Ga0495630_0022791 | Ga0495630_0022791_1911_2387 | 140 |
| 366 | 3300046517 | Ga0495630_0187947 | Ga0495630_0187947_552_1064 | 140 |
| 367 | 3300046526 | Ga0495666_0061277 | Ga0495666_0061277_558_1034 | 140 |
| 368 | 3300046526 | Ga0495666_0086203 | Ga0495666_0086203_387_863 | 140 |
| 369 | 3300046526 | Ga0495666_0169603 | Ga0495666_0169603_221_706 | 140 |
| 370 | 3300046529 | Ga0495652_0019079 | Ga0495652_0019079_3307_3792 | 140 |
| 371 | 3300046529 | Ga0495652_0042006 | Ga0495652_0042006_2959_3435 | 140 |
| 372 | 3300046529 | Ga0495652_0117286 | Ga0495652_0117286_234_698 | 140 |
| 373 | 3300046531 | Ga0495665_0015155 | Ga0495665_0015155_2766_3242 | 140 |
| 374 | 3300046531 | Ga0495665_0036628 | Ga0495665_0036628_1372_1848 | 140 |
| 375 | 3300046531 | Ga0495665_0170411 | Ga0495665_0170411_156_641 | 140 |
| 376 | 3300046533 | Ga0495640_0002634 | Ga0495640_0002634_8712_9188 | 140 |
| 377 | 3300046533 | Ga0495640_0005026 | Ga0495640_0005026_9105_9590 | 140 |
| 378 | 3300046533 | Ga0495640_0095442 | Ga0495640_0095442_1137_1613 | 140 |
| 379 | 3300046536 | Ga0495587_0000997 | Ga0495587_0000997_15252_15728 | 140 |
| 380 | 3300046537 | Ga0495598_0152439 | Ga0495598_0152439_215_715 | 140 |
| 381 | 3300046543 | Ga0495645_0006748 | Ga0495645_0006748_2067_2552 | 140 |
| 382 | 3300046543 | Ga0495645_0277523 | Ga0495645_0277523_272_745 | 140 |
| 383 | 3300046559 | Ga0495667_0001459 | Ga0495667_0001459_7437_7913 | 140 |
| 384 | 3300046615 | Ga0495656_0096879 | Ga0495656_0096879_185_661 | 140 |
| 385 | 3300046642 | Ga0495634_0007242 | Ga0495634_0007242_3549_4025 | 140 |
| 386 | 3300046642 | Ga0495634_0045830 | Ga0495634_0045830_695_1180 | 140 |
| 387 | 3300046648 | Ga0495611_0038625 | Ga0495611_0038625_1379_1855 | 140 |
| 388 | 3300046663 | Ga0495635_0001639 | Ga0495635_0001639_7426_7911 | 140 |
| 389 | 3300046663 | Ga0495635_0032088 | Ga0495635_0032088_1638_2114 | 140 |
| 390 | 3300046663 | Ga0495635_0047392 | Ga0495635_0047392_1364_1837 | 140 |
| 391 | 3300046663 | Ga0495635_0551480 | Ga0495635_0551480_38_550 | 140 |
| 392 | 3300046664 | Ga0495659_0014126 | Ga0495659_0014126_1580_2056 | 140 |
| 393 | 3300046675 | Ga0495657_0035539 | Ga0495657_0035539_1280_1756 | 140 |
| 394 | 3300046678 | Ga0495599_0027084 | Ga0495599_0027084_2244_2720 | 140 |
| 395 | 3300046678 | Ga0495599_0066821 | Ga0495599_0066821_423_896 | 140 |
| 396 | 3300046678 | Ga0495599_0239673 | Ga0495599_0239673_171_683 | 140 |
| 397 | 3300046679 | Ga0495623_0005325 | Ga0495623_0005325_5594_6070 | 140 |
| 398 | 3300046679 | Ga0495623_0106696 | Ga0495623_0106696_544_1017 | 140 |
| 399 | 3300046680 | Ga0495646_0010238 | Ga0495646_0010238_4424_4900 | 140 |
| 400 | 3300046680 | Ga0495646_0024450 | Ga0495646_0024450_1732_2217 | 140 |
| 401 | 3300046681 | Ga0495647_0061778 | Ga0495647_0061778_272_748 | 140 |
| 402 | 3300046683 | Ga0495658_0082498 | Ga0495658_0082498_1167_1643 | 140 |
| 403 | 3300046683 | Ga0495658_0408938 | Ga0495658_0408938_60_533 | 140 |
| 404 | 3300046689 | Ga0495613_0019367 | Ga0495613_0019367_1711_2187 | 140 |
| 405 | 3300046689 | Ga0495613_0549046 | Ga0495613_0549046_232_705 | 140 |
| 406 | 3300046690 | Ga0495624_0000757 | Ga0495624_0000757_12273_12749 | 140 |
| 407 | 3300046690 | Ga0495624_0012335 | Ga0495624_0012335_3728_4204 | 140 |
| 408 | 3300046690 | Ga0495624_0024299 | Ga0495624_0024299_1312_1797 | 140 |
| 409 | 3300046809 | Ga0495600_0026683 | Ga0495600_0026683_2086_2562 | 140 |
| 410 | 3300047315 | Ga0495581_0077258 | Ga0495581_0077258_338_814 | 140 |
| 411 | 3300047315 | Ga0495581_0519952 | Ga0495581_0519952_84_560 | 140 |
| 412 | 3300047317 | Ga0495604_0020448 | Ga0495604_0020448_1934_2410 | 140 |
| 413 | 3300047317 | Ga0495604_0043148 | Ga0495604_0043148_1753_2226 | 140 |
| 414 | 3300047317 | Ga0495604_0202574 | Ga0495604_0202574_596_1081 | 140 |
| 415 | 3300047317 | Ga0495604_0335825 | Ga0495604_0335825_288_800 | 140 |
| 416 | 3300047319 | Ga0495674_0006497 | Ga0495674_0006497_6030_6515 | 140 |
| 417 | 3300047319 | Ga0495674_0061430 | Ga0495674_0061430_1592_2068 | 140 |
| 418 | 3300047319 | Ga0495674_0143195 | Ga0495674_0143195_57_533 | 140 |
| 419 | 3300047319 | Ga0495674_0474294 | Ga0495674_0474294_35_547 | 140 |
| 420 | 3300047320 | Ga0495672_0118938 | Ga0495672_0118938_757_1233 | 140 |
| 421 | 3300047321 | Ga0495676_0120507 | Ga0495676_0120507_1146_1622 | 140 |
| 422 | 3300047321 | Ga0495676_0123863 | Ga0495676_0123863_564_1040 | 140 |
| 423 | 3300047322 | Ga0495680_0005408 | Ga0495680_0005408_1169_1645 | 140 |
| 424 | 3300047322 | Ga0495680_0162227 | Ga0495680_0162227_122_595 | 140 |
| 425 | 3300047444 | Ga0495675_0007624 | Ga0495675_0007624_3360_3836 | 140 |
| 426 | 3300047444 | Ga0495675_0037632 | Ga0495675_0037632_1222_1695 | 140 |
| 427 | 3300047471 | Ga0495684_0006008 | Ga0495684_0006008_8168_8653 | 140 |
| 428 | 3300047471 | Ga0495684_0015273 | Ga0495684_0015273_3517_3993 | 140 |
| 429 | 3300047471 | Ga0495684_0054152 | Ga0495684_0054152_360_836 | 140 |
| 430 | 3300047471 | Ga0495684_0567147 | Ga0495684_0567147_246_719 | 140 |
| 431 | 3300047673 | Ga0495593_0012454 | Ga0495593_0012454_3839_4315 | 140 |
| 432 | 3300047673 | Ga0495593_0020314 | Ga0495593_0020314_1365_1841 | 140 |
| 433 | 3300047673 | Ga0495593_0179641 | Ga0495593_0179641_369_833 | 140 |
| 434 | 3300048088 | Ga0495602_0001563 | Ga0495602_0001563_19182_19658 | 140 |
| 435 | 3300048088 | Ga0495602_0057217 | Ga0495602_0057217_988_1461 | 140 |
| 436 | 3300048903 | Ga0496100_0003110 | Ga0496100_0003110_1962_2426 | 140 |
| 437 | 3300048903 | Ga0496100_0023650 | Ga0496100_0023650_835_1317 | 140 |
| 438 | 3300048903 | Ga0496100_0858765 | Ga0496100_0858765_154_639 | 140 |
| 439 | 3300048904 | Ga0496101_0007200 | Ga0496101_0007200_5672_6136 | 140 |
| 440 | 3300048904 | Ga0496101_0063858 | Ga0496101_0063858_1778_2260 | 140 |
| 441 | 3300048904 | Ga0496101_0129772 | Ga0496101_0129772_617_1159 | 140 |
| 442 | 3300048905 | Ga0496102_0030056 | Ga0496102_0030056_1335_1799 | 140 |
| 443 | 3300048905 | Ga0496102_0037005 | Ga0496102_0037005_1161_1643 | 140 |
| 444 | 3300048905 | Ga0496102_0147474 | Ga0496102_0147474_1548_2036 | 140 |
| 445 | 3300048905 | Ga0496102_0306793 | Ga0496102_0306793_518_1060 | 140 |
| 446 | 3300048905 | Ga0496102_0510302 | Ga0496102_0510302_356_832 | 140 |
| 447 | 3300048905 | Ga0496102_0842789 | Ga0496102_0842789_79_645 | 140 |
| 448 | 3300048906 | Ga0496103_0028983 | Ga0496103_0028983_2729_3211 | 140 |
| 449 | 3300048906 | Ga0496103_0291759 | Ga0496103_0291759_248_712 | 140 |
| 450 | 3300048907 | Ga0496104_0008844 | Ga0496104_0008844_7142_7606 | 140 |
| 451 | 3300048907 | Ga0496104_0037382 | Ga0496104_0037382_463_945 | 140 |
| 452 | 3300048907 | Ga0496104_0943208 | Ga0496104_0943208_91_576 | 140 |
| 453 | 3300048908 | Ga0496105_0064003 | Ga0496105_0064003_2215_2679 | 140 |
| 454 | 3300048908 | Ga0496105_0233842 | Ga0496105_0233842_245_787 | 140 |
| 455 | 3300048908 | Ga0496105_0389319 | Ga0496105_0389319_179_664 | 140 |
| 456 | 3300048909 | Ga0496106_0001779 | Ga0496106_0001779_4540_5004 | 140 |
| 457 | 3300048909 | Ga0496106_0083928 | Ga0496106_0083928_1727_2209 | 140 |
| 458 | 3300048910 | Ga0496107_0001325 | Ga0496107_0001325_14083_14547 | 140 |
| 459 | 3300048910 | Ga0496107_0034085 | Ga0496107_0034085_463_945 | 140 |
| 460 | 3300048911 | Ga0496108_0005750 | Ga0496108_0005750_3932_4396 | 140 |
| 461 | 3300048911 | Ga0496108_0046871 | Ga0496108_0046871_2907_3389 | 140 |
| 462 | 3300048911 | Ga0496108_1317082 | Ga0496108_1317082_97_573 | 140 |
| 463 | 3300048912 | Ga0496109_0037234 | Ga0496109_0037234_2693_3157 | 140 |
| 464 | 3300048912 | Ga0496109_0121943 | Ga0496109_0121943_1739_2215 | 140 |
| 465 | 3300048912 | Ga0496109_0312140 | Ga0496109_0312140_27_509 | 140 |
| 466 | 3300048912 | Ga0496109_1258777 | Ga0496109_1258777_136_609 | 140 |
| 467 | 3300048913 | Ga0496110_0009654 | Ga0496110_0009654_4656_5138 | 140 |
| 468 | 3300048913 | Ga0496110_0016853 | Ga0496110_0016853_1411_1875 | 140 |
| 469 | 3300048913 | Ga0496110_0209916 | Ga0496110_0209916_282_824 | 140 |
| 470 | 3300048913 | Ga0496110_1263756 | Ga0496110_1263756_85_570 | 140 |
| 471 | 3300048914 | Ga0496111_0059748 | Ga0496111_0059748_1870_2334 | 140 |
| 472 | 3300048914 | Ga0496111_0162106 | Ga0496111_0162106_137_619 | 140 |
| 473 | 3300048915 | Ga0496112_0016282 | Ga0496112_0016282_1896_2378 | 140 |
| 474 | 3300048915 | Ga0496112_0034679 | Ga0496112_0034679_4109_4573 | 140 |
| 475 | 3300048915 | Ga0496112_0071772 | Ga0496112_0071772_2870_3412 | 140 |
| 476 | 3300048916 | Ga0496113_0003760 | Ga0496113_0003760_6111_6593 | 140 |
| 477 | 3300048916 | Ga0496113_0018764 | Ga0496113_0018764_4076_4540 | 140 |
| 478 | 3300048917 | Ga0496114_0042786 | Ga0496114_0042786_1768_2250 | 140 |
| 479 | 3300048917 | Ga0496114_0190164 | Ga0496114_0190164_621_1163 | 140 |
| 480 | 3300048917 | Ga0496114_0236038 | Ga0496114_0236038_804_1268 | 140 |
| 481 | 3300048918 | Ga0496115_0059438 | Ga0496115_0059438_2204_2686 | 140 |
| 482 | 3300048918 | Ga0496115_0184447 | Ga0496115_0184447_285_749 | 140 |
| 483 | 3300048918 | Ga0496115_0326947 | Ga0496115_0326947_237_779 | 140 |
| 484 | 3300048918 | Ga0496115_0452534 | Ga0496115_0452534_513_989 | 140 |
| 485 | 3300049581 | Ga0501047_0346876 | Ga0501047_0346876_808_1278 | 140 |
| 486 | 3300049581 | Ga0501047_0707376 | Ga0501047_0707376_335_799 | 140 |
| 487 | 3300049583 | Ga0501067_0613896 | Ga0501067_0613896_57_521 | 140 |
| 488 | 3300049584 | Ga0501068_0433014 | Ga0501068_0433014_212_682 | 140 |
| 489 | 3300049586 | Ga0501070_0085520 | Ga0501070_0085520_1970_2434 | 140 |
| 490 | 3300049587 | Ga0501071_0329306 | Ga0501071_0329306_558_1028 | 140 |
| 491 | 3300049589 | Ga0501073_0532089 | Ga0501073_0532089_155_625 | 140 |
| 492 | 3300049590 | Ga0501074_0275709 | Ga0501074_0275709_119_589 | 140 |
| 493 | 3300049592 | Ga0501076_0352788 | Ga0501076_0352788_617_1087 | 140 |
| 494 | 3300049741 | Ga0501079_0324533 | Ga0501079_0324533_142_612 | 140 |
| 495 | 3300049742 | Ga0501080_0940011 | Ga0501080_0940011_144_614 | 140 |
| 496 | 3300049742 | Ga0501080_1470411 | Ga0501080_1470411_70_534 | 140 |
| 497 | 3300049744 | Ga0501083_0098047 | Ga0501083_0098047_805_1278 | 140 |
| 498 | 3300049823 | Ga0501044_0301465 | Ga0501044_0301465_832_1302 | 140 |
| 499 | 3300049824 | Ga0501045_0398777 | Ga0501045_0398777_78_554 | 140 |
| 500 | 3300050489 | nmdc:mga03683_138447_c1 | nmdc:mga03683_138447_c1_432_908 | 140 |
| 501 | 3300050491 | nmdc:mga00v17_69379_c2 | nmdc:mga00v17_69379_c2_14_490 | 140 |
| 502 | 3300050492 | nmdc:mga0yw44_132466_c1 | nmdc:mga0yw44_132466_c1_239_703 | 140 |
| 503 | 3300050492 | nmdc:mga0yw44_336641_c1 | nmdc:mga0yw44_336641_c1_181_657 | 140 |
| 504 | 3300050492 | nmdc:mga0yw44_345263_c1 | nmdc:mga0yw44_345263_c1_198_662 | 140 |
| 505 | 3300050492 | nmdc:mga0yw44_424759_c1 | nmdc:mga0yw44_424759_c1_228_704 | 140 |
| 506 | 3300050507 | nmdc:mga05p37_1646631_c1 | nmdc:mga05p37_1646631_c1_55_513 | 140 |
| 507 | 3300050507 | nmdc:mga05p37_254501_c1 | nmdc:mga05p37_254501_c1_77_553 | 140 |
| 508 | 3300050507 | nmdc:mga05p37_342992_c1 | nmdc:mga05p37_342992_c1_311_787 | 140 |
| 509 | 3300050507 | nmdc:mga05p37_445966_c1 | nmdc:mga05p37_445966_c1_699_1175 | 140 |
| 510 | 3300050509 | nmdc:mga0qj67_218416_c1 | nmdc:mga0qj67_218416_c1_281_757 | 140 |
| 511 | 3300050510 | nmdc:mga06r32_670301_c1 | nmdc:mga06r32_670301_c1_175_651 | 140 |
| 512 | 3300050511 | nmdc:mga08y16_1120992_c1 | nmdc:mga08y16_1120992_c1_248_718 | 140 |
| 513 | 3300050512 | nmdc:mga0n895_32058_c1 | nmdc:mga0n895_32058_c1_3236_3724 | 140 |
| 514 | 3300050513 | nmdc:mga0rr50_784491_c1 | nmdc:mga0rr50_784491_c1_205_681 | 140 |
| 515 | 3300050514 | nmdc:mga08x19_117457_c1 | nmdc:mga08x19_117457_c1_123_599 | 140 |
| 516 | 3300050514 | nmdc:mga08x19_409850_c1 | nmdc:mga08x19_409850_c1_372_860 | 140 |
| 517 | 3300050514 | nmdc:mga08x19_527614_c1 | nmdc:mga08x19_527614_c1_218_694 | 140 |
| 518 | 3300050514 | nmdc:mga08x19_697561_c1 | nmdc:mga08x19_697561_c1_142_606 | 140 |
| 519 | 3300050515 | nmdc:mga0a205_612851_c1 | nmdc:mga0a205_612851_c1_325_801 | 140 |
| 520 | 3300050515 | nmdc:mga0a205_7350_c1 | nmdc:mga0a205_7350_c1_6940_7428 | 140 |
| 521 | 3300053077 | Ga0495601_0005264 | Ga0495601_0005264_4065_4550 | 140 |
| 522 | 3300053077 | Ga0495601_0020109 | Ga0495601_0020109_394_870 | 140 |
| 523 | 3300053077 | Ga0495601_0027672 | Ga0495601_0027672_1086_1598 | 140 |
| 524 | 3300053077 | Ga0495601_0135771 | Ga0495601_0135771_813_1286 | 140 |
| 525 | 3300053077 | Ga0495601_0674176 | Ga0495601_0674176_44_520 | 140 |
| 526 | 3300053078 | Ga0495612_0000550 | Ga0495612_0000550_5675_6160 | 140 |
| 527 | 3300053078 | Ga0495612_0004137 | Ga0495612_0004137_2960_3436 | 140 |
| 528 | 3300053078 | Ga0495612_0074094 | Ga0495612_0074094_812_1285 | 140 |
| 529 | 3300053078 | Ga0495612_0133331 | Ga0495612_0133331_353_865 | 140 |
| 530 | 3300053080 | Ga0500635_0005717 | Ga0500635_0005717_2168_2662 | 140 |
| 531 | 3300053084 | Ga0495595_0000348 | Ga0495595_0000348_12338_12814 | 140 |
| 532 | 3300053084 | Ga0495595_0015463 | Ga0495595_0015463_1144_1617 | 140 |
| 533 | 3300053084 | Ga0495595_0137615 | Ga0495595_0137615_197_673 | 140 |
| 534 | 3300053085 | Ga0495619_0000950 | Ga0495619_0000950_11836_12321 | 140 |
| 535 | 3300053085 | Ga0495619_0002230 | Ga0495619_0002230_4460_4936 | 140 |
| 536 | 3300053102 | Ga0500554_032778 | Ga0500554_032778_328_822 | 140 |
| 537 | 3300053136 | Ga0500559_0092141 | Ga0500559_0092141_172_645 | 140 |
| 538 | 3300053162 | Ga0500638_116105 | Ga0500638_116105_492_986 | 140 |
| 539 | 3300053178 | Ga0500637_0000165 | Ga0500637_0000165_3798_4292 | 140 |
| 540 | iso_pu_bacteria | 2510917030 | 2511196435 | 141 |
| 541 | iso_pu_bacteria | 3005445848 | 3005446630 | 141 |
| 542 | 3300046457 | Ga0495590_0038785 | Ga0495590_0038785_749_1276 | 144 |
| 543 | 3300046512 | Ga0495610_0048522 | Ga0495610_0048522_938_1492 | 144 |
| 544 | 3300048091 | Ga0495626_0209209 | Ga0495626_0209209_13_540 | 144 |
| 545 | 3300048919 | Ga0496116_0030430 | Ga0496116_0030430_3080_3607 | 144 |
| 546 | 3300053156 | Ga0500622_0003585 | Ga0500622_0003585_3192_3719 | 144 |
| 547 | 3300002773 | JGI25152J39213_1009726 | JGI25152J39213_10097263 | 145 |
| 548 | 3300003215 | JGI25153J46596_10006018 | JGI25153J46596_100060182 | 145 |
| 549 | 3300003354 | JGI25160J50197_1040432 | JGI25160J50197_10404321 | 145 |
| 550 | 3300003790 | Ga0055528_1024069 | Ga0055528_10240692 | 145 |
| 551 | 3300003792 | Ga0055540_1009668 | Ga0055540_10096684 | 145 |
| 552 | 3300005262 | Ga0065165_1045017 | Ga0065165_10450172 | 145 |
| 553 | 3300005337 | Ga0070682_100251766 | Ga0070682_1002517662 | 145 |
| 554 | 3300025245 | Ga0207425_1059785 | Ga0207425_10597851 | 145 |
| 555 | 3300025258 | Ga0209129_1000849 | Ga0209129_10008492 | 145 |
| 556 | 3300025273 | Ga0209673_1044550 | Ga0209673_10445502 | 145 |
| 557 | 3300025295 | Ga0209564_1037622 | Ga0209564_10376222 | 145 |
| 558 | 3300025297 | Ga0209758_1007473 | Ga0209758_10074738 | 145 |
| 559 | 3300025303 | Ga0209051_1008962 | Ga0209051_10089622 | 145 |
| 560 | 3300046507 | Ga0495606_0107881 | Ga0495606_0107881_645_1172 | 145 |
| 561 | 3300046665 | Ga0495661_0118825 | Ga0495661_0118825_806_1333 | 145 |
| 562 | 3300048909 | Ga0496106_0018179 | Ga0496106_0018179_3336_3863 | 145 |
| 563 | 3300053093 | Ga0500651_0327018 | Ga0500651_0327018_71_598 | 145 |
| 564 | 3300053094 | Ga0500566_0219242 | Ga0500566_0219242_85_612 | 145 |
| 565 | 3300053123 | Ga0500614_022970 | Ga0500614_022970_739_1266 | 145 |
| 566 | 3300053134 | Ga0500658_0003487 | Ga0500658_0003487_1317_1844 | 145 |
| 567 | 3300053139 | Ga0500568_0000524 | Ga0500568_0000524_3641_4168 | 145 |
| 568 | 3300053151 | Ga0500604_0015008 | Ga0500604_0015008_552_1079 | 145 |
| 569 | 3300053160 | Ga0500633_0112295 | Ga0500633_0112295_109_636 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.8701 | 32 | 122 |
| 2kct-assembly1.cif.gz_A | solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. | 0.8324 | 45 | 121 |
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.79 | 32 | 122 |
| 1sr3-assembly1.cif.gz_A | solution structure of the heme chaperone ccme of escherichia coli | 0.7705 | 32 | 131 |
| 6t8h-assembly1.cif.gz_A | cryo-em structure of the dna-bound pold-pcna processive complex from p. abyssi | 0.77 | 33 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8701 | 32 | 122 | 2.40.50.140 |
| af_A0A0R4IAS3_25_130_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8394 | 33 | 123 | 2.40.50.140 |
| 2kctA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8324 | 45 | 121 | 2.40.50.140 |
| af_Q9P6I0_5_106_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8116 | 40 | 123 | 2.40.50.140 |
| af_Q7JZR5_15_103_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8087 | 42 | 123 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S2CCB9-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.9055 | 1 | 129 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A7C5XFQ7-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.9028 | 6 | 128 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A328VFI4-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.8996 | 9 | 129 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A4Q2Z8R4-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.8984 | 1 | 129 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A3D3SMU7-F1-model_v4 | deleted | 0.8947 | 1 | 128 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar