F464667

General Info

Members Datasets Scaffolds Average Seq Length
568 191 540 399

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0002090|Ga0495583_0002090_7402_8715
Length 437
Sequence VYFLLSNFPAQVASKFELPRGFLQHTFTSFLGGLPMSFEPLKGLRVLDLTSVVVGPVCTWRLAQYGAEVIKVESPEGDLMRGLGGQSPTGQHSGTYLHFNRGKRNICLDLKKAGAKQAIDRLVASSDVIVANMRPQALERLGLDAASIRKRYPDKVYCLITGYGTDGPYAGQPTYDSVVQGATGMAGLTLARDGTPTYVPMLICDHVSGEIAAGAILAALAERKASGKGCSIEVPMFETMAAFVLQEHLAQQSFDPPVGPAGDSRLLSPHNKPVATADGWISFTVNTDAQVRAFLKTTDRHSLLDDPRFSSVAARARNVKQWFEIRGAPLTSRTTAEWLAVLREADIAVQPCNTLESLQHDPHLEAVGLIRFEEHPTEGKTAAIRSTIRFDEAYPPLRAPSQPQGWDTRTVLQELGYADDEVADLLKDGDAIATPAI

Samples

Sample ID Description Type Environment
1 2511231016 Pseudomonas sp. GM50 Isolate Nodule
2 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
3 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
4 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
5 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
6 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
7 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
8 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
9 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
10 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
11 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
12 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
13 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
14 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
15 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
16 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
17 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738543019 Variovorax sp. GV040 Isolate Unclassified
20 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
21 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
22 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
23 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
35 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
36 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
44 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
45 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
46 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
47 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
48 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
49 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
50 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
51 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
52 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
53 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
54 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
55 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
56 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
57 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
58 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
59 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
63 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
64 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
65 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
66 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
67 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
68 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
69 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
70 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
74 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
75 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
76 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
77 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
78 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
79 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
88 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
145 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
146 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
147 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
150 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
151 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
152 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
155 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
156 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
157 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
158 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
159 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
160 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
161 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
162 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
163 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
171 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
174 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
175 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
181 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
182 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
183 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
186 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
187 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
188 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
189 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
190 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
191 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 0
Isolates 4.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.88
Nodule 0.18
Rhizoplane 0
Rhizosphere 69.01
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10000094 3300006038 Bacteria 25917
2 Ga0075368_10000101 3300006042 Bacteria 21910
3 Ga0075368_10001195 3300006042 Bacteria 8200
4 Ga0075363_100000004 3300006048 Bacteria 61740
5 Ga0075363_100047302 3300006048 Bacteria 2284
6 Ga0075364_10000004 3300006051 Bacteria 110554
7 Ga0075364_10000140 3300006051 Bacteria 31249
8 Ga0075362_10000009 3300006177 Bacteria 111748
9 Ga0075362_10000194 3300006177 Bacteria 16984
10 Ga0075367_10000018 3300006178 Bacteria 34198
11 Ga0075367_10006718 3300006178 Bacteria 5837
12 Ga0075369_10000011 3300006186 Bacteria 76681
13 Ga0075369_10000061 3300006186 Bacteria 28090
14 Ga0075366_10000085 3300006195 Bacteria 36576
15 Ga0075370_10000050 3300006353 Bacteria 36486
16 Ga0075370_10000071 3300006353 Bacteria 31090
17 Ga0075370_10001571 3300006353 Bacteria 10034
18 Ga0075428_100461403 3300006844 Bacteria 1360
19 Ga0209813_10004031 3300027866 Bacteria 3480
20 Ga0307517_10000160 3300028786 Bacteria 108370
21 Ga0307517_10109027 3300028786 Bacteria 2121
22 Ga0307515_10002570 3300028794 Bacteria 39179
23 Ga0307515_10010552 3300028794 Bacteria 17690
24 Ga0307515_10015010 3300028794 Bacteria 14308
25 Ga0307515_10079468 3300028794 Bacteria 4296
26 Ga0307515_10191109 3300028794 Bacteria 1957
27 Ga0307512_10037182 3300030522 Bacteria 4116
28 Ga0307512_10080008 3300030522 Bacteria 2356
29 Ga0307513_10117954 3300031456 Bacteria 2630
30 Ga0307509_10000317 3300031507 Bacteria 79032
31 Ga0307509_10004066 3300031507 Bacteria 21456
32 Ga0307509_10133156 3300031507 Bacteria 2437
33 Ga0307508_10000332 3300031616 Bacteria 57039
34 Ga0307508_10001814 3300031616 Bacteria 23664
35 Ga0307508_10013354 3300031616 Bacteria 7510
36 Ga0307514_10001524 3300031649 Bacteria 27729
37 Ga0307514_10010094 3300031649 Bacteria 7906
38 Ga0307516_10126841 3300031730 Bacteria 2336
39 Ga0307507_10094876 3300033179 Bacteria 2533
40 Ga0307510_10013175 3300033180 Bacteria 9808
41 Ga0307510_10038423 3300033180 Bacteria 5292
42 Ga0307510_10056062 3300033180 Bacteria 4108
43 Ga0307510_10057800 3300033180 Bacteria 4022
44 Ga0373923_0064244 3300035111 Bacteria 1565
45 Ga0373927_0007910 3300035695 Bacteria 7183
46 Ga0373927_0056037 3300035695 Bacteria 2548
47 Ga0373947_0038636 3300035725 Bacteria 2837
48 Ga0439465_0063181 3300041413 Bacteria 1230
49 Ga0495617_000129 3300046452 Bacteria 50053
50 Ga0495617_003129 3300046452 Bacteria 6302
51 Ga0495617_011158 3300046452 Bacteria 3071
52 Ga0495627_000329 3300046453 Bacteria 45500
53 Ga0495627_002452 3300046453 Bacteria 8925
54 Ga0495592_0000175 3300046454 Bacteria 56416
55 Ga0495592_0000273 3300046454 Bacteria 44143
56 Ga0495603_0068267 3300046455 Unclassified 2092
57 Ga0495590_0001918 3300046457 Bacteria 8803
58 Ga0495590_0008084 3300046457 Bacteria 4029
59 Ga0495590_0010076 3300046457 Bacteria 3567
60 Ga0495590_0022154 3300046457 Bacteria 2248
61 Ga0495590_0037180 3300046457 Bacteria 1698
62 Ga0495591_000008 3300046458 Bacteria 353558
63 Ga0495591_000053 3300046458 Bacteria 135500
64 Ga0495591_001488 3300046458 Bacteria 14490
65 Ga0495591_013613 3300046458 Bacteria 2963
66 Ga0495629_0000085 3300046459 Bacteria 83152
67 Ga0495638_0000022 3300046460 Bacteria 364765
68 Ga0495638_0000141 3300046460 Bacteria 114543
69 Ga0495638_0000183 3300046460 Bacteria 95741
70 Ga0495638_0003759 3300046460 Bacteria 11801
71 Ga0495638_0024662 3300046460 Bacteria 3917
72 Ga0495638_0069918 3300046460 Bacteria 2150
73 Ga0495653_0000176 3300046463 Bacteria 52724
74 Ga0495653_0001499 3300046463 Bacteria 18244
75 Ga0495653_0082224 3300046463 Bacteria 2378
76 Ga0495650_0000073 3300046471 Bacteria 253286
77 Ga0495650_0000164 3300046471 Bacteria 147142
78 Ga0495650_0000180 3300046471 Bacteria 137884
79 Ga0495650_0001323 3300046471 Bacteria 24912
80 Ga0495650_0002312 3300046471 Bacteria 15805
81 Ga0495650_0093377 3300046471 Unclassified 1141
82 Ga0495580_0004929 3300046472 Bacteria 11156
83 Ga0495605_0000040 3300046474 Bacteria 193955
84 Ga0495605_0000272 3300046474 Bacteria 58560
85 Ga0495605_0003592 3300046474 Bacteria 9190
86 Ga0495605_0009911 3300046474 Bacteria 5342
87 Ga0495605_0017968 3300046474 Bacteria 3798
88 Ga0495605_0034615 3300046474 Bacteria 2557
89 Ga0495664_0009069 3300046477 Bacteria 5561
90 Ga0495664_0119025 3300046477 Bacteria 1597
91 Ga0495584_0000020 3300046491 Bacteria 132682
92 Ga0495584_0000179 3300046491 Bacteria 44738
93 Ga0495584_0000262 3300046491 Bacteria 37590
94 Ga0495584_0003161 3300046491 Bacteria 9151
95 Ga0495584_0010646 3300046491 Bacteria 4723
96 Ga0495584_0012645 3300046491 Bacteria 4308
97 Ga0495585_0009223 3300046492 Bacteria 5933
98 Ga0495585_0010400 3300046492 Bacteria 5540
99 Ga0495585_0033171 3300046492 Bacteria 2924
100 Ga0495596_0000016 3300046500 Bacteria 117489
101 Ga0495596_0000025 3300046500 Bacteria 106069
102 Ga0495596_0000177 3300046500 Bacteria 44496
103 Ga0495596_0002627 3300046500 Bacteria 9518
104 Ga0495596_0003361 3300046500 Bacteria 8130
105 Ga0495607_0000047 3300046501 Bacteria 121696
106 Ga0495607_0000152 3300046501 Bacteria 72216
107 Ga0495607_0000624 3300046501 Bacteria 34369
108 Ga0495607_0001729 3300046501 Bacteria 18707
109 Ga0495607_0005688 3300046501 Bacteria 8882
110 Ga0495607_0005955 3300046501 Bacteria 8647
111 Ga0495607_0056032 3300046501 Bacteria 2264
112 Ga0495583_0000014 3300046506 Bacteria 320136
113 Ga0495583_0000032 3300046506 Bacteria 247728
114 Ga0495583_0000114 3300046506 Bacteria 136026
115 Ga0495583_0000127 3300046506 Bacteria 127780
116 Ga0495583_0000471 3300046506 Bacteria 59495
117 Ga0495583_0002090 3300046506 Bacteria 18019
118 Ga0495583_0005946 3300046506 Bacteria 8101
119 Ga0495583_0014416 3300046506 Bacteria 4363
120 Ga0495583_0043799 3300046506 Bacteria 2081
121 Ga0495583_0045013 3300046506 Bacteria 2043
122 Ga0495606_0001415 3300046507 Bacteria 32260
123 Ga0495606_0005810 3300046507 Bacteria 11643
124 Ga0495606_0006083 3300046507 Bacteria 11267
125 Ga0495606_0040305 3300046507 Bacteria 3140
126 Ga0495606_0045402 3300046507 Bacteria 2912
127 Ga0495606_0059172 3300046507 Unclassified 2459
128 Ga0495610_0000797 3300046512 Bacteria 29566
129 Ga0495610_0001540 3300046512 Bacteria 20312
130 Ga0495610_0008505 3300046512 Bacteria 6630
131 Ga0495610_0023671 3300046512 Unclassified 3331
132 Ga0495616_0000950 3300046513 Bacteria 20830
133 Ga0495616_0002008 3300046513 Bacteria 13692
134 Ga0495616_0002976 3300046513 Bacteria 11001
135 Ga0495616_0008314 3300046513 Bacteria 6155
136 Ga0495616_0013438 3300046513 Bacteria 4618
137 Ga0495616_0015863 3300046513 Bacteria 4178
138 Ga0495616_0027556 3300046513 Bacteria 3014
139 Ga0495620_0000045 3300046515 Bacteria 109595
140 Ga0495620_0006235 3300046515 Bacteria 6568
141 Ga0495620_0053938 3300046515 Bacteria 1701
142 Ga0495628_0032648 3300046516 Bacteria 4201
143 Ga0495628_0042581 3300046516 Bacteria 3621
144 Ga0495630_0009662 3300046517 Bacteria 6936
145 Ga0495630_0055776 3300046517 Unclassified 2961
146 Ga0495630_0108127 3300046517 Bacteria 2107
147 Ga0495631_0003800 3300046518 Bacteria 8210
148 Ga0495631_0009794 3300046518 Bacteria 4772
149 Ga0495631_0027943 3300046518 Bacteria 2577
150 Ga0495631_0029441 3300046518 Unclassified 2497
151 Ga0495632_0000053 3300046519 Bacteria 131977
152 Ga0495632_0000086 3300046519 Bacteria 95327
153 Ga0495632_0000284 3300046519 Bacteria 49472
154 Ga0495632_0000448 3300046519 Bacteria 39223
155 Ga0495632_0000743 3300046519 Bacteria 29431
156 Ga0495632_0000921 3300046519 Bacteria 25800
157 Ga0495632_0002866 3300046519 Bacteria 12724
158 Ga0495632_0003155 3300046519 Bacteria 11917
159 Ga0495632_0015316 3300046519 Bacteria 4305
160 Ga0495632_0034534 3300046519 Bacteria 2587
161 Ga0495632_0075011 3300046519 Bacteria 1619
162 Ga0495637_0000197 3300046520 Bacteria 47128
163 Ga0495637_0000340 3300046520 Bacteria 36022
164 Ga0495637_0000686 3300046520 Bacteria 23330
165 Ga0495637_0002056 3300046520 Bacteria 11319
166 Ga0495637_0002710 3300046520 Bacteria 9648
167 Ga0495637_0003460 3300046520 Bacteria 8392
168 Ga0495637_0005751 3300046520 Bacteria 6286
169 Ga0495637_0017226 3300046520 Bacteria 3372
170 Ga0495643_0000061 3300046522 Bacteria 185933
171 Ga0495643_0000298 3300046522 Bacteria 69615
172 Ga0495643_0000666 3300046522 Bacteria 40418
173 Ga0495643_0006763 3300046522 Bacteria 7498
174 Ga0495643_0011875 3300046522 Bacteria 5279
175 Ga0495643_0015832 3300046522 Bacteria 4444
176 Ga0495643_0026918 3300046522 Bacteria 3238
177 Ga0495643_0028241 3300046522 Bacteria 3147
178 Ga0495643_0062735 3300046522 Bacteria 1967
179 Ga0495643_0062779 3300046522 Bacteria 1966
180 Ga0495644_0000087 3300046523 Bacteria 46212
181 Ga0495644_0000164 3300046523 Bacteria 31315
182 Ga0495644_0007667 3300046523 Bacteria 4163
183 Ga0495644_0021574 3300046523 Unclassified 2457
184 Ga0495648_0000051 3300046524 Bacteria 162502
185 Ga0495648_0000476 3300046524 Bacteria 43122
186 Ga0495648_0001810 3300046524 Bacteria 20595
187 Ga0495648_0003221 3300046524 Bacteria 14474
188 Ga0495648_0004393 3300046524 Bacteria 12058
189 Ga0495648_0011425 3300046524 Bacteria 6689
190 Ga0495648_0017922 3300046524 Bacteria 5040
191 Ga0495648_0029371 3300046524 Bacteria 3650
192 Ga0495648_0030881 3300046524 Bacteria 3535
193 Ga0495648_0064778 3300046524 Bacteria 2152
194 Ga0495663_0000012 3300046525 Bacteria 157546
195 Ga0495663_0000263 3300046525 Bacteria 20187
196 Ga0495663_0001724 3300046525 Bacteria 6785
197 Ga0495666_0001202 3300046526 Bacteria 12499
198 Ga0495666_0001954 3300046526 Bacteria 10157
199 Ga0495666_0012951 3300046526 Bacteria 4156
200 Ga0495666_0069768 3300046526 Bacteria 1672
201 Ga0495666_0071867 3300046526 Unclassified 1644
202 Ga0495642_0000484 3300046528 Bacteria 20442
203 Ga0495642_0005467 3300046528 Bacteria 4880
204 Ga0495642_0014352 3300046528 Bacteria 3068
205 Ga0495642_0030150 3300046528 Bacteria 2169
206 Ga0495652_0198173 3300046529 Bacteria 1526
207 Ga0495654_0000084 3300046530 Bacteria 107326
208 Ga0495654_0000565 3300046530 Bacteria 29730
209 Ga0495654_0002151 3300046530 Bacteria 12850
210 Ga0495654_0002802 3300046530 Bacteria 10986
211 Ga0495654_0003342 3300046530 Bacteria 9888
212 Ga0495654_0039593 3300046530 Bacteria 2352
213 Ga0495654_0051594 3300046530 Bacteria 2006
214 Ga0495665_0007602 3300046531 Bacteria 5869
215 Ga0495587_0000054 3300046536 Bacteria 97507
216 Ga0495587_0013401 3300046536 Bacteria 5154
217 Ga0495609_0000044 3300046538 Bacteria 161642
218 Ga0495609_0001626 3300046538 Bacteria 14655
219 Ga0495609_0001976 3300046538 Bacteria 12983
220 Ga0495609_0004460 3300046538 Bacteria 7653
221 Ga0495609_0005108 3300046538 Bacteria 6994
222 Ga0495621_0002424 3300046539 Bacteria 5028
223 Ga0495597_0000865 3300046542 Bacteria 23729
224 Ga0495597_0003700 3300046542 Bacteria 8765
225 Ga0495597_0021765 3300046542 Bacteria 2980
226 Ga0495597_0085863 3300046542 Bacteria 1340
227 Ga0495645_0000420 3300046543 Bacteria 29291
228 Ga0495645_0002987 3300046543 Bacteria 11446
229 Ga0495645_0042953 3300046543 Bacteria 3297
230 Ga0495622_0000024 3300046557 Bacteria 154056
231 Ga0495622_0000557 3300046557 Bacteria 22389
232 Ga0495622_0000889 3300046557 Bacteria 16295
233 Ga0495622_0007306 3300046557 Bacteria 5128
234 Ga0495633_0004018 3300046558 Bacteria 9521
235 Ga0495633_0004875 3300046558 Bacteria 8393
236 Ga0495633_0029448 3300046558 Bacteria 2672
237 Ga0495656_0001795 3300046615 Bacteria 7051
238 Ga0495656_0002471 3300046615 Bacteria 6150
239 Ga0495656_0011414 3300046615 Bacteria 3261
240 Ga0495656_0027614 3300046615 Bacteria 2268
241 Ga0495656_0075946 3300046615 Bacteria 1504
242 Ga0495668_0000287 3300046616 Bacteria 69408
243 Ga0495668_0023648 3300046616 Bacteria 3502
244 Ga0495668_0108370 3300046616 Bacteria 1519
245 Ga0495634_0000169 3300046642 Bacteria 60237
246 Ga0495611_0000134 3300046648 Bacteria 51892
247 Ga0495611_0000448 3300046648 Bacteria 25003
248 Ga0495611_0000769 3300046648 Bacteria 17966
249 Ga0495611_0007111 3300046648 Bacteria 4753
250 Ga0495611_0008093 3300046648 Bacteria 4462
251 Ga0495625_0000016 3300046660 Bacteria 311353
252 Ga0495625_0001351 3300046660 Bacteria 30318
253 Ga0495625_0002776 3300046660 Bacteria 18479
254 Ga0495625_0009988 3300046660 Bacteria 7894
255 Ga0495625_0023278 3300046660 Bacteria 4733
256 Ga0495625_0025370 3300046660 Bacteria 4497
257 Ga0495625_0051607 3300046660 Bacteria 2948
258 Ga0495625_0054266 3300046660 Bacteria 2863
259 Ga0495625_0057305 3300046660 Bacteria 2771
260 Ga0495625_0057950 3300046660 Bacteria 2753
261 Ga0495625_0136447 3300046660 Bacteria 1658
262 Ga0495635_0000033 3300046663 Bacteria 104638
263 Ga0495635_0000035 3300046663 Bacteria 96395
264 Ga0495659_0000325 3300046664 Bacteria 18827
265 Ga0495659_0004762 3300046664 Bacteria 4273
266 Ga0495659_0005557 3300046664 Bacteria 3967
267 Ga0495661_0000001 3300046665 Bacteria 898372
268 Ga0495661_0000554 3300046665 Bacteria 38651
269 Ga0495661_0000722 3300046665 Bacteria 32461
270 Ga0495661_0003376 3300046665 Bacteria 11825
271 Ga0495661_0006832 3300046665 Bacteria 7989
272 Ga0495661_0012066 3300046665 Bacteria 5845
273 Ga0495661_0015468 3300046665 Bacteria 5094
274 Ga0495661_0067543 3300046665 Unclassified 2100
275 Ga0495588_0000664 3300046674 Bacteria 15931
276 Ga0495588_0001867 3300046674 Bacteria 8980
277 Ga0495588_0003788 3300046674 Bacteria 6626
278 Ga0495588_0005450 3300046674 Bacteria 5663
279 Ga0495588_0008269 3300046674 Bacteria 4767
280 Ga0495588_0016076 3300046674 Bacteria 3612
281 Ga0495588_0031632 3300046674 Bacteria 2664
282 Ga0495588_0032744 3300046674 Bacteria 2621
283 Ga0495623_0000189 3300046679 Bacteria 39192
284 Ga0495623_0076289 3300046679 Bacteria 2080
285 Ga0495646_0000059 3300046680 Bacteria 52693
286 Ga0495646_0000704 3300046680 Bacteria 18491
287 Ga0495646_0013280 3300046680 Bacteria 5234
288 Ga0495646_0041332 3300046680 Bacteria 2834
289 Ga0495646_0051717 3300046680 Bacteria 2485
290 Ga0495647_0000282 3300046681 Bacteria 14145
291 Ga0495658_0001272 3300046683 Bacteria 13253
292 Ga0495658_0006837 3300046683 Bacteria 5617
293 Ga0495669_0000091 3300046684 Bacteria 59795
294 Ga0495669_0014973 3300046684 Bacteria 3318
295 Ga0495669_0039461 3300046684 Bacteria 2091
296 Ga0495624_0000014 3300046690 Bacteria 111102
297 Ga0495624_0001032 3300046690 Bacteria 21928
298 Ga0495624_0002583 3300046690 Bacteria 13692
299 Ga0495624_0011052 3300046690 Bacteria 6215
300 Ga0495624_0190177 3300046690 Unclassified 1249
301 Ga0495670_0000018 3300046691 Bacteria 115019
302 Ga0495670_0000026 3300046691 Bacteria 90929
303 Ga0495670_0000064 3300046691 Bacteria 47436
304 Ga0495670_0005461 3300046691 Bacteria 6240
305 Ga0495671_0000004 3300046692 Bacteria 545630
306 Ga0495671_0000036 3300046692 Bacteria 181192
307 Ga0495671_0000079 3300046692 Bacteria 93288
308 Ga0495671_0001366 3300046692 Bacteria 16554
309 Ga0495671_0002376 3300046692 Bacteria 11940
310 Ga0495671_0018414 3300046692 Bacteria 3707
311 Ga0495671_0067438 3300046692 Bacteria 1760
312 Ga0495649_0000480 3300046694 Bacteria 34342
313 Ga0495649_0000978 3300046694 Bacteria 22513
314 Ga0495649_0004222 3300046694 Bacteria 9424
315 Ga0495649_0009739 3300046694 Bacteria 5692
316 Ga0495649_0022361 3300046694 Bacteria 3538
317 Ga0495649_0027487 3300046694 Bacteria 3157
318 Ga0495649_0033583 3300046694 Bacteria 2823
319 Ga0495589_0000035 3300046794 Bacteria 161642
320 Ga0495589_0000115 3300046794 Bacteria 75796
321 Ga0495600_0016188 3300046809 Bacteria 4729
322 Ga0495660_0000077 3300046810 Bacteria 105543
323 Ga0495660_0000414 3300046810 Bacteria 36352
324 Ga0495660_0017299 3300046810 Bacteria 4152
325 Ga0495660_0043534 3300046810 Bacteria 2475
326 Ga0495604_0000094 3300047317 Bacteria 76004
327 Ga0495636_0000067 3300047318 Bacteria 44261
328 Ga0495636_0000559 3300047318 Bacteria 13656
329 Ga0495636_0004021 3300047318 Bacteria 5747
330 Ga0495674_0006687 3300047319 Bacteria 11046
331 Ga0495674_0024227 3300047319 Bacteria 5581
332 Ga0495672_0001199 3300047320 Bacteria 26191
333 Ga0495672_0001677 3300047320 Bacteria 21483
334 Ga0495672_0001691 3300047320 Bacteria 21368
335 Ga0495672_0003238 3300047320 Bacteria 14133
336 Ga0495672_0013299 3300047320 Bacteria 5685
337 Ga0495672_0028639 3300047320 Bacteria 3520
338 Ga0495672_0043041 3300047320 Bacteria 2718
339 Ga0495676_0000001 3300047321 Bacteria 624167
340 Ga0495676_0000041 3300047321 Bacteria 104634
341 Ga0495676_0000398 3300047321 Bacteria 35184
342 Ga0495676_0098863 3300047321 Bacteria 2164
343 Ga0495680_0000133 3300047322 Bacteria 74109
344 Ga0495680_0000997 3300047322 Bacteria 31518
345 Ga0495680_0070231 3300047322 Bacteria 2671
346 Ga0495683_0002883 3300047323 Bacteria 10174
347 Ga0495683_0004213 3300047323 Bacteria 8217
348 Ga0495687_000066 3300047443 Bacteria 161642
349 Ga0495687_000086 3300047443 Bacteria 143855
350 Ga0495687_000093 3300047443 Bacteria 138076
351 Ga0495687_000566 3300047443 Bacteria 43606
352 Ga0495687_000603 3300047443 Bacteria 42021
353 Ga0495687_003669 3300047443 Bacteria 10931
354 Ga0495687_017794 3300047443 Bacteria 3530
355 Ga0495675_0032563 3300047444 Bacteria 3326
356 Ga0495675_0092919 3300047444 Bacteria 1893
357 Ga0495677_0000321 3300047445 Bacteria 20721
358 Ga0495677_0000604 3300047445 Bacteria 14689
359 Ga0495677_0001554 3300047445 Bacteria 9260
360 Ga0495677_0001627 3300047445 Bacteria 9026
361 Ga0495677_0004008 3300047445 Bacteria 5686
362 Ga0495679_000437 3300047446 Bacteria 30836
363 Ga0495685_000020 3300047447 Bacteria 73280
364 Ga0495685_000155 3300047447 Bacteria 23330
365 Ga0495685_031809 3300047447 Bacteria 1813
366 Ga0495685_043861 3300047447 Bacteria 1526
367 Ga0495673_0000021 3300047469 Bacteria 545523
368 Ga0495673_0000061 3300047469 Bacteria 230647
369 Ga0495673_0000541 3300047469 Bacteria 38812
370 Ga0495673_0000873 3300047469 Bacteria 27837
371 Ga0495673_0001784 3300047469 Bacteria 16340
372 Ga0495673_0001859 3300047469 Bacteria 15837
373 Ga0495673_0006559 3300047469 Bacteria 6823
374 Ga0495673_0029200 3300047469 Bacteria 2605
375 Ga0495673_0041745 3300047469 Bacteria 2063
376 Ga0495673_0041953 3300047469 Unclassified 2057
377 Ga0495681_0000003 3300047470 Bacteria 245567
378 Ga0495681_0000068 3300047470 Bacteria 96387
379 Ga0495681_0000116 3300047470 Bacteria 69786
380 Ga0495681_0000394 3300047470 Bacteria 33879
381 Ga0495681_0004311 3300047470 Bacteria 9735
382 Ga0495681_0005435 3300047470 Bacteria 8532
383 Ga0495681_0011014 3300047470 Bacteria 5423
384 Ga0495681_0011302 3300047470 Bacteria 5326
385 Ga0495681_0051588 3300047470 Unclassified 1934
386 Ga0495684_0009350 3300047471 Bacteria 7566
387 Ga0495686_0001493 3300047472 Bacteria 25335
388 Ga0495686_0001741 3300047472 Bacteria 22337
389 Ga0495686_0002101 3300047472 Bacteria 19528
390 Ga0495686_0015076 3300047472 Bacteria 5293
391 Ga0495686_0033330 3300047472 Bacteria 3326
392 Ga0495593_0000083 3300047673 Bacteria 41204
393 Ga0495593_0001471 3300047673 Bacteria 13833
394 Ga0495593_0009877 3300047673 Bacteria 5538
395 Ga0495602_0000129 3300048088 Bacteria 71215
396 Ga0495602_0062060 3300048088 Bacteria 3244
397 Ga0495614_0000499 3300048089 Bacteria 16028
398 Ga0495615_0000014 3300048090 Bacteria 60447
399 Ga0495615_0000211 3300048090 Bacteria 13489
400 Ga0495615_0005145 3300048090 Unclassified 2333
401 Ga0495626_0000011 3300048091 Bacteria 260928
402 Ga0495626_0000049 3300048091 Bacteria 161052
403 Ga0495626_0000119 3300048091 Bacteria 102920
404 Ga0495626_0000185 3300048091 Bacteria 75817
405 Ga0495626_0000376 3300048091 Bacteria 46584
406 Ga0495626_0000994 3300048091 Bacteria 24359
407 Ga0495626_0001379 3300048091 Bacteria 19548
408 Ga0495626_0059211 3300048091 Bacteria 1748
409 Ga0495678_000008 3300049459 Bacteria 445926
410 Ga0495678_000171 3300049459 Bacteria 75725
411 Ga0495678_000721 3300049459 Bacteria 30019
412 Ga0495682_0000075 3300049460 Bacteria 91041
413 Ga0495682_0005429 3300049460 Bacteria 5298
414 Ga0495682_0019048 3300049460 Bacteria 2583
415 nmdc:mga03683_11_c1 3300050489 Bacteria 120565
416 nmdc:mga03683_1216_c1 3300050489 Bacteria 7609
417 nmdc:mga03683_4377_c1 3300050489 Bacteria 4681
418 nmdc:mga03n38_1_c1 3300050490 Bacteria 91975
419 nmdc:mga03n38_20369_c1 3300050490 Bacteria 2653
420 nmdc:mga03n38_60_c1 3300050490 Bacteria 22561
421 nmdc:mga00v17_1_c1 3300050491 Bacteria 292294
422 nmdc:mga00v17_63868_c2 3300050491 Bacteria 1636
423 nmdc:mga0yw44_103_c1 3300050492 Bacteria 29546
424 nmdc:mga0yw44_61_c1 3300050492 Bacteria 34409
425 nmdc:mga0k408_25318_c1 3300050493 Bacteria 3361
426 nmdc:mga0k408_34957_c1 3300050493 Bacteria 2879
427 nmdc:mga06z11_24159_c1 3300050494 Bacteria 2864
428 nmdc:mga06z11_3192_c1 3300050494 Bacteria 6331
429 nmdc:mga06z11_319_c1 3300050494 Bacteria 18234
430 nmdc:mga04h51_1247_c1 3300050495 Bacteria 5886
431 nmdc:mga04h51_24221_c1 3300050495 Bacteria 1857
432 nmdc:mga07m45_2698_c1 3300050496 Bacteria 8362
433 nmdc:mga07m45_447_c1 3300050496 Bacteria 17238
434 nmdc:mga0sz30_5_c1 3300050516 Bacteria 189060
435 Ga0500610_0006340 3300053079 Bacteria 4952
436 Ga0500610_0031187 3300053079 Bacteria 2706
437 Ga0500635_0000020 3300053080 Bacteria 110196
438 Ga0500578_0059933 3300053086 Bacteria 2432
439 Ga0500578_0075444 3300053086 Bacteria 2148
440 Ga0500643_000479 3300053087 Bacteria 29255
441 Ga0500643_000763 3300053087 Bacteria 20994
442 Ga0500643_001515 3300053087 Bacteria 13260
443 Ga0500643_003650 3300053087 Bacteria 7280
444 Ga0500643_013445 3300053087 Bacteria 2888
445 Ga0500643_038076 3300053087 Bacteria 1428
446 Ga0500583_0000357 3300053092 Bacteria 15023
447 Ga0500651_0000262 3300053093 Bacteria 31432
448 Ga0500651_0000814 3300053093 Bacteria 15257
449 Ga0500641_0000014 3300053096 Bacteria 150696
450 Ga0500641_0000099 3300053096 Bacteria 33503
451 Ga0500641_0009067 3300053096 Bacteria 3568
452 Ga0500555_014742 3300053103 Unclassified 2253
453 Ga0500556_0001922 3300053104 Bacteria 7420
454 Ga0500560_003913 3300053107 Bacteria 3088
455 Ga0500562_012630 3300053108 Unclassified 2150
456 Ga0500571_000074 3300053110 Bacteria 31440
457 Ga0500572_026765 3300053111 Bacteria 1575
458 Ga0500593_000085 3300053117 Bacteria 34051
459 Ga0500594_0001910 3300053118 Bacteria 4507
460 Ga0500594_0006064 3300053118 Bacteria 2703
461 Ga0500597_043269 3300053120 Bacteria 1900
462 Ga0500607_020195 3300053121 Bacteria 3764
463 Ga0500607_039044 3300053121 Bacteria 2580
464 Ga0500607_094550 3300053121 Unclassified 1497
465 Ga0500608_000051 3300053122 Bacteria 52600
466 Ga0500608_002758 3300053122 Bacteria 6471
467 Ga0500608_009923 3300053122 Bacteria 4065
468 Ga0500614_005361 3300053123 Bacteria 2692
469 Ga0500618_000315 3300053125 Bacteria 35779
470 Ga0500618_000372 3300053125 Bacteria 31040
471 Ga0500618_001107 3300053125 Bacteria 13222
472 Ga0500618_001379 3300053125 Bacteria 10994
473 Ga0500618_015391 3300053125 Bacteria 1934
474 Ga0500642_0000526 3300053130 Bacteria 11660
475 Ga0500655_000065 3300053133 Bacteria 28630
476 Ga0500655_000079 3300053133 Bacteria 25542
477 Ga0500658_0000335 3300053134 Bacteria 20976
478 Ga0500659_0000019 3300053135 Bacteria 65589
479 Ga0500559_0000065 3300053136 Bacteria 85032
480 Ga0500559_0001529 3300053136 Bacteria 12968
481 Ga0500559_0007781 3300053136 Bacteria 4734
482 Ga0500559_0009080 3300053136 Bacteria 4320
483 Ga0500559_0010064 3300053136 Bacteria 4071
484 Ga0500559_0037577 3300053136 Unclassified 2099
485 Ga0500559_0075865 3300053136 Bacteria 1521
486 Ga0500559_0081120 3300053136 Bacteria 1474
487 Ga0500561_0000100 3300053137 Bacteria 16567
488 Ga0500561_0001849 3300053137 Bacteria 3492
489 Ga0500561_0009794 3300053137 Unclassified 1958
490 Ga0500564_000044 3300053138 Bacteria 33710
491 Ga0500564_000480 3300053138 Bacteria 11663
492 Ga0500564_027646 3300053138 Bacteria 2611
493 Ga0500568_0000269 3300053139 Bacteria 44003
494 Ga0500568_0047661 3300053139 Bacteria 1697
495 Ga0500573_0000554 3300053140 Bacteria 16273
496 Ga0500573_0005518 3300053140 Bacteria 6785
497 Ga0500574_000006 3300053141 Bacteria 52655
498 Ga0500574_000051 3300053141 Bacteria 13789
499 Ga0500590_002892 3300053148 Bacteria 7783
500 Ga0500590_004333 3300053148 Bacteria 6683
501 Ga0500590_017571 3300053148 Bacteria 3696
502 Ga0500604_0000100 3300053151 Bacteria 27107
503 Ga0500604_0000480 3300053151 Bacteria 10996
504 Ga0500604_0007735 3300053151 Bacteria 2848
505 Ga0500616_0000187 3300053153 Bacteria 101361
506 Ga0500616_0000502 3300053153 Bacteria 49980
507 Ga0500616_0008937 3300053153 Bacteria 6140
508 Ga0500616_0025648 3300053153 Bacteria 3268
509 Ga0500616_0102806 3300053153 Bacteria 1393
510 Ga0500619_041935 3300053154 Bacteria 1449
511 Ga0500622_0000501 3300053156 Bacteria 36484
512 Ga0500622_0000656 3300053156 Bacteria 30810
513 Ga0500622_0001205 3300053156 Bacteria 21252
514 Ga0500622_0003016 3300053156 Bacteria 11634
515 Ga0500622_0003097 3300053156 Bacteria 11454
516 Ga0500622_0011815 3300053156 Bacteria 4745
517 Ga0500622_0048183 3300053156 Bacteria 2199
518 Ga0500624_000039 3300053157 Bacteria 93415
519 Ga0500624_000550 3300053157 Bacteria 10522
520 Ga0500624_000558 3300053157 Bacteria 10404
521 Ga0500624_005946 3300053157 Unclassified 1639
522 Ga0500627_0002447 3300053158 Bacteria 5507
523 Ga0500627_0022904 3300053158 Bacteria 2540
524 Ga0500627_0028157 3300053158 Bacteria 2332
525 Ga0500634_0009172 3300053161 Bacteria 4991
526 Ga0500634_0034049 3300053161 Unclassified 2776
527 Ga0500638_000284 3300053162 Bacteria 11309
528 Ga0500638_000992 3300053162 Bacteria 8182
529 Ga0500636_0000144 3300053177 Bacteria 37563
530 Ga0500636_0000163 3300053177 Bacteria 34947
531 Ga0500636_0000543 3300053177 Bacteria 20542
532 Ga0500636_0003975 3300053177 Bacteria 8331
533 Ga0500637_0000120 3300053178 Bacteria 28438
534 Ga0500637_0000868 3300053178 Bacteria 12121
535 Ga0500567_005394 3300053723 Bacteria 5898
536 Ga0500570_000142 3300053724 Bacteria 21748
537 Ga0500625_000007 3300053729 Bacteria 177638
538 Ga0500645_000773 3300053730 Bacteria 19414
539 Ga0500596_008798 3300053735 Unclassified 1601
540 Ga0500661_000238 3300055283 Bacteria 9855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035111 Ga0373923_0064244 Ga0373923_0064244_106_1179 356
2 3300046471 Ga0495650_0093377 Ga0495650_0093377_46_1116 356
3 3300046530 Ga0495654_0051594 Ga0495654_0051594_602_1678 356
4 3300046536 Ga0495587_0013401 Ga0495587_0013401_2138_3214 356
5 3300049460 Ga0495682_0000075 Ga0495682_0000075_49069_50145 356
6 3300046674 Ga0495588_0000664 Ga0495588_0000664_13339_14532 364
7 3300047470 Ga0495681_0005435 Ga0495681_0005435_2584_3777 364
8 3300041413 Ga0439465_0063181 Ga0439465_0063181_69_1217 365
9 3300006178 Ga0075367_10006718 Ga0075367_100067185 366
10 3300050494 nmdc:mga06z11_3192_c1 nmdc:mga06z11_3192_c1_1881_3389 366
11 3300053157 Ga0500624_000558 Ga0500624_000558_2836_4029 366
12 3300046491 Ga0495584_0012645 Ga0495584_0012645_1775_2953 377
13 3300046506 Ga0495583_0045013 Ga0495583_0045013_220_1398 377
14 3300046513 Ga0495616_0027556 Ga0495616_0027556_189_1367 377
15 3300046519 Ga0495632_0075011 Ga0495632_0075011_422_1603 377
16 3300046694 Ga0495649_0022361 Ga0495649_0022361_511_1689 377
17 3300047443 Ga0495687_017794 Ga0495687_017794_1229_2407 377
18 3300046507 Ga0495606_0040305 Ga0495606_0040305_39_1187 379
19 3300046501 Ga0495607_0001729 Ga0495607_0001729_1738_2940 383
20 3300046530 Ga0495654_0000565 Ga0495654_0000565_8410_9612 383
21 3300053125 Ga0500618_000372 Ga0500618_000372_9413_10693 383
22 3300053125 Ga0500618_001107 Ga0500618_001107_11331_12533 383
23 3300053158 Ga0500627_0022904 Ga0500627_0022904_142_1344 383
24 3300046507 Ga0495606_0045402 Ga0495606_0045402_1161_2360 384
25 3300046519 Ga0495632_0003155 Ga0495632_0003155_8728_9948 384
26 3300046524 Ga0495648_0030881 Ga0495648_0030881_1815_3014 384
27 3300046660 Ga0495625_0025370 Ga0495625_0025370_3050_4249 384
28 3300046694 Ga0495649_0027487 Ga0495649_0027487_230_1429 384
29 3300047469 Ga0495673_0041745 Ga0495673_0041745_384_1583 384
30 3300053086 Ga0500578_0075444 Ga0500578_0075444_260_1459 384
31 3300053121 Ga0500607_039044 Ga0500607_039044_245_1444 384
32 3300053122 Ga0500608_002758 Ga0500608_002758_2525_3724 384
33 3300053136 Ga0500559_0075865 Ga0500559_0075865_222_1421 384
34 3300053148 Ga0500590_017571 Ga0500590_017571_190_1389 384
35 3300028794 Ga0307515_10015010 Ga0307515_1001501013 385
36 3300046460 Ga0495638_0000141 Ga0495638_0000141_14628_15833 385
37 3300046506 Ga0495583_0014416 Ga0495583_0014416_214_1416 385
38 3300046512 Ga0495610_0001540 Ga0495610_0001540_6813_8015 385
39 3300046518 Ga0495631_0003800 Ga0495631_0003800_1381_2586 385
40 3300046528 Ga0495642_0005467 Ga0495642_0005467_2290_3519 385
41 3300046615 Ga0495656_0011414 Ga0495656_0011414_1951_3180 385
42 3300046648 Ga0495611_0008093 Ga0495611_0008093_1653_2855 385
43 3300046660 Ga0495625_0057305 Ga0495625_0057305_247_1449 385
44 3300046674 Ga0495588_0016076 Ga0495588_0016076_908_2110 385
45 3300046674 Ga0495588_0032744 Ga0495588_0032744_1133_2362 385
46 3300046692 Ga0495671_0067438 Ga0495671_0067438_20_1222 385
47 3300047320 Ga0495672_0013299 Ga0495672_0013299_640_1842 385
48 3300047447 Ga0495685_043861 Ga0495685_043861_134_1363 385
49 3300047469 Ga0495673_0029200 Ga0495673_0029200_1303_2505 385
50 3300053079 Ga0500610_0006340 Ga0500610_0006340_884_2089 385
51 3300053086 Ga0500578_0059933 Ga0500578_0059933_282_1487 385
52 3300053118 Ga0500594_0006064 Ga0500594_0006064_15_1220 385
53 3300053139 Ga0500568_0000269 Ga0500568_0000269_14656_15858 385
54 3300053153 Ga0500616_0000502 Ga0500616_0000502_44008_45210 385
55 3300053153 Ga0500616_0102806 Ga0500616_0102806_22_1227 385
56 3300053156 Ga0500622_0011815 Ga0500622_0011815_774_1976 385
57 iso_pu_bacteria 2840878972 2840880109 385
58 iso_pu_bacteria 2904765812 2904770396 385
59 3300046457 Ga0495590_0008084 Ga0495590_0008084_677_1885 386
60 3300046506 Ga0495583_0000127 Ga0495583_0000127_50855_52063 386
61 3300046810 Ga0495660_0017299 Ga0495660_0017299_2674_3882 386
62 3300053125 Ga0500618_000315 Ga0500618_000315_14784_15983 387
63 3300033180 Ga0307510_10038423 Ga0307510_100384236 388
64 3300046452 Ga0495617_011158 Ga0495617_011158_1147_2367 388
65 3300046460 Ga0495638_0000183 Ga0495638_0000183_18541_19761 388
66 3300046492 Ga0495585_0010400 Ga0495585_0010400_3155_4375 388
67 3300046501 Ga0495607_0056032 Ga0495607_0056032_737_1957 388
68 3300046512 Ga0495610_0023671 Ga0495610_0023671_303_1523 388
69 3300046513 Ga0495616_0013438 Ga0495616_0013438_1186_2406 388
70 3300046515 Ga0495620_0000045 Ga0495620_0000045_89832_91052 388
71 3300046520 Ga0495637_0000686 Ga0495637_0000686_3530_4750 388
72 3300046522 Ga0495643_0006763 Ga0495643_0006763_2479_3699 388
73 3300046524 Ga0495648_0011425 Ga0495648_0011425_2028_3248 388
74 3300046525 Ga0495663_0000263 Ga0495663_0000263_16017_17237 388
75 3300046530 Ga0495654_0002802 Ga0495654_0002802_9266_10486 388
76 3300046538 Ga0495609_0001976 Ga0495609_0001976_282_1502 388
77 3300046557 Ga0495622_0007306 Ga0495622_0007306_3351_4571 388
78 3300046648 Ga0495611_0000134 Ga0495611_0000134_7492_8712 388
79 3300046660 Ga0495625_0002776 Ga0495625_0002776_5342_6562 388
80 3300046665 Ga0495661_0067543 Ga0495661_0067543_564_1784 388
81 3300046674 Ga0495588_0031632 Ga0495588_0031632_989_2209 388
82 3300046691 Ga0495670_0000026 Ga0495670_0000026_18498_19718 388
83 3300046692 Ga0495671_0000079 Ga0495671_0000079_91134_92354 388
84 3300046694 Ga0495649_0000480 Ga0495649_0000480_21216_22436 388
85 3300046810 Ga0495660_0043534 Ga0495660_0043534_341_1561 388
86 3300047443 Ga0495687_000093 Ga0495687_000093_18976_20196 388
87 3300047444 Ga0495675_0092919 Ga0495675_0092919_537_1739 388
88 3300047469 Ga0495673_0041953 Ga0495673_0041953_669_1889 388
89 3300047470 Ga0495681_0004311 Ga0495681_0004311_3174_4394 388
90 3300047472 Ga0495686_0001493 Ga0495686_0001493_18539_19759 388
91 3300049459 Ga0495678_000171 Ga0495678_000171_7562_8782 388
92 3300049460 Ga0495682_0005429 Ga0495682_0005429_3779_4999 388
93 3300053092 Ga0500583_0000357 Ga0500583_0000357_1807_3027 388
94 3300053103 Ga0500555_014742 Ga0500555_014742_978_2198 388
95 3300053122 Ga0500608_000051 Ga0500608_000051_18512_19732 388
96 3300053137 Ga0500561_0009794 Ga0500561_0009794_363_1583 388
97 3300053138 Ga0500564_000480 Ga0500564_000480_3224_4444 388
98 3300053141 Ga0500574_000006 Ga0500574_000006_32940_34160 388
99 3300053153 Ga0500616_0000187 Ga0500616_0000187_70274_71476 388
100 3300053157 Ga0500624_000550 Ga0500624_000550_6551_7771 388
101 3300053161 Ga0500634_0034049 Ga0500634_0034049_597_1817 388
102 3300053162 Ga0500638_000992 Ga0500638_000992_6846_8066 388
103 3300047322 Ga0495680_0070231 Ga0495680_0070231_449_1690 389
104 3300046453 Ga0495627_000329 Ga0495627_000329_43971_45143 390
105 3300046460 Ga0495638_0000022 Ga0495638_0000022_48555_49727 390
106 3300046506 Ga0495583_0000032 Ga0495583_0000032_196927_198099 390
107 3300046519 Ga0495632_0000053 Ga0495632_0000053_64098_65270 390
108 3300046519 Ga0495632_0000743 Ga0495632_0000743_24534_25706 390
109 3300046520 Ga0495637_0000197 Ga0495637_0000197_43899_45071 390
110 3300046522 Ga0495643_0000061 Ga0495643_0000061_117155_118327 390
111 3300046524 Ga0495648_0000051 Ga0495648_0000051_112776_113948 390
112 3300046524 Ga0495648_0017922 Ga0495648_0017922_3101_4273 390
113 3300046525 Ga0495663_0000012 Ga0495663_0000012_66715_67887 390
114 3300046558 Ga0495633_0004875 Ga0495633_0004875_3136_4308 390
115 3300046660 Ga0495625_0023278 Ga0495625_0023278_686_1894 390
116 3300046660 Ga0495625_0054266 Ga0495625_0054266_56_1228 390
117 3300046692 Ga0495671_0000004 Ga0495671_0000004_48962_50134 390
118 3300046692 Ga0495671_0000036 Ga0495671_0000036_117145_118317 390
119 3300047469 Ga0495673_0000021 Ga0495673_0000021_48962_50134 390
120 3300047470 Ga0495681_0011302 Ga0495681_0011302_2011_3183 390
121 3300053087 Ga0500643_003650 Ga0500643_003650_2080_3252 390
122 3300053111 Ga0500572_026765 Ga0500572_026765_116_1288 390
123 3300055283 Ga0500661_000238 Ga0500661_000238_2827_3999 390
124 3300031649 Ga0307514_10010094 Ga0307514_100100946 391
125 3300046520 Ga0495637_0005751 Ga0495637_0005751_3015_4223 391
126 3300046530 Ga0495654_0039593 Ga0495654_0039593_1031_2239 391
127 3300046674 Ga0495588_0005450 Ga0495588_0005450_1789_2997 391
128 3300046692 Ga0495671_0018414 Ga0495671_0018414_1520_2728 391
129 3300053079 Ga0500610_0031187 Ga0500610_0031187_111_1319 391
130 3300053087 Ga0500643_013445 Ga0500643_013445_1252_2460 391
131 3300053093 Ga0500651_0000262 Ga0500651_0000262_16725_17933 391
132 3300053117 Ga0500593_000085 Ga0500593_000085_16780_17988 391
133 3300053134 Ga0500658_0000335 Ga0500658_0000335_6112_7320 391
134 3300053158 Ga0500627_0002447 Ga0500627_0002447_2035_3243 391
135 3300046519 Ga0495632_0002866 Ga0495632_0002866_4660_5838 392
136 iso_pu_bacteria 2582581306 2585268182 395
137 iso_pu_bacteria 2582581865 2585390266 395
138 iso_pu_bacteria 2511231016 2511328496 396
139 iso_pu_bacteria 2582581299 2585232892 396
140 iso_pu_bacteria 2582581306 2585268397 396
141 iso_pu_bacteria 2582581307 2585276052 396
142 iso_pu_bacteria 2582581308 2585281690 396
143 iso_pu_bacteria 2582581316 2585334767 396
144 iso_pu_bacteria 2582581865 2585390394 396
145 iso_pu_bacteria 2582581867 2585399510 396
146 iso_pu_bacteria 2585427527 2585534341 396
147 iso_pu_bacteria 2585427528 2585542898 396
148 iso_pu_bacteria 2585427530 2585556328 396
149 iso_pu_bacteria 2585427531 2585563629 396
150 iso_pu_bacteria 2585427593 2585841160 396
151 iso_pu_bacteria 2585427594 2585846982 396
152 iso_pu_bacteria 2585427608 2585900782 396
153 iso_pu_bacteria 2585427609 2585908780 396
154 iso_pu_bacteria 2585428125 2587984304 396
155 iso_pu_bacteria 2738541277 2738723682 396
156 iso_pu_bacteria 2738543019 2739284413 396
157 iso_pu_bacteria 2739367664 2739649567 396
158 iso_pu_bacteria 2739367865 2740028040 396
159 3300053125 Ga0500618_015391 Ga0500618_015391_566_1768 398
160 3300053136 Ga0500559_0081120 Ga0500559_0081120_232_1434 398
161 3300053140 Ga0500573_0005518 Ga0500573_0005518_1769_2971 398
162 3300006042 Ga0075368_10001195 Ga0075368_100011953 399
163 3300006048 Ga0075363_100000004 Ga0075363_10000000452 399
164 3300006051 Ga0075364_10000140 Ga0075364_1000014028 399
165 3300006177 Ga0075362_10000194 Ga0075362_1000019411 399
166 3300006186 Ga0075369_10000061 Ga0075369_1000006121 399
167 3300006353 Ga0075370_10000071 Ga0075370_100000713 399
168 3300031616 Ga0307508_10001814 Ga0307508_1000181414 399
169 3300046454 Ga0495592_0000273 Ga0495592_0000273_42051_43250 399
170 3300046457 Ga0495590_0010076 Ga0495590_0010076_314_1513 399
171 3300046463 Ga0495653_0000176 Ga0495653_0000176_2550_3749 399
172 3300046471 Ga0495650_0001323 Ga0495650_0001323_4951_6150 399
173 3300046501 Ga0495607_0000624 Ga0495607_0000624_30712_31911 399
174 3300046513 Ga0495616_0002976 Ga0495616_0002976_5281_6480 399
175 3300046516 Ga0495628_0032648 Ga0495628_0032648_2223_3422 399
176 3300046522 Ga0495643_0062735 Ga0495643_0062735_687_1886 399
177 3300046526 Ga0495666_0001954 Ga0495666_0001954_957_2156 399
178 3300046529 Ga0495652_0198173 Ga0495652_0198173_79_1278 399
179 3300046530 Ga0495654_0002151 Ga0495654_0002151_6755_7954 399
180 3300046536 Ga0495587_0000054 Ga0495587_0000054_54498_55697 399
181 3300046543 Ga0495645_0002987 Ga0495645_0002987_2080_3279 399
182 3300046642 Ga0495634_0000169 Ga0495634_0000169_4522_5721 399
183 3300046648 Ga0495611_0000448 Ga0495611_0000448_5313_6512 399
184 3300046663 Ga0495635_0000033 Ga0495635_0000033_54501_55700 399
185 3300046664 Ga0495659_0005557 Ga0495659_0005557_263_1462 399
186 3300046674 Ga0495588_0001867 Ga0495588_0001867_6547_7746 399
187 3300046674 Ga0495588_0008269 Ga0495588_0008269_590_1789 399
188 3300046679 Ga0495623_0000189 Ga0495623_0000189_18753_19952 399
189 3300046680 Ga0495646_0000059 Ga0495646_0000059_48974_50173 399
190 3300046690 Ga0495624_0000014 Ga0495624_0000014_37052_38251 399
191 3300046692 Ga0495671_0002376 Ga0495671_0002376_2724_3923 399
192 3300047317 Ga0495604_0000094 Ga0495604_0000094_43200_44399 399
193 3300047318 Ga0495636_0004021 Ga0495636_0004021_2055_3254 399
194 3300047320 Ga0495672_0001691 Ga0495672_0001691_15694_16893 399
195 3300047321 Ga0495676_0000041 Ga0495676_0000041_54484_55683 399
196 3300047322 Ga0495680_0000133 Ga0495680_0000133_55341_56540 399
197 3300047469 Ga0495673_0000541 Ga0495673_0000541_6903_8102 399
198 3300047470 Ga0495681_0000068 Ga0495681_0000068_48960_50159 399
199 3300047471 Ga0495684_0009350 Ga0495684_0009350_3106_4305 399
200 3300047472 Ga0495686_0001741 Ga0495686_0001741_4798_6021 399
201 3300047673 Ga0495593_0009877 Ga0495593_0009877_2521_3720 399
202 3300048088 Ga0495602_0000129 Ga0495602_0000129_54518_55717 399
203 3300049460 Ga0495682_0019048 Ga0495682_0019048_1216_2415 399
204 3300050489 nmdc:mga03683_1216_c1 nmdc:mga03683_1216_c1_5751_6950 399
205 3300050490 nmdc:mga03n38_60_c1 nmdc:mga03n38_60_c1_2775_3974 399
206 3300050491 nmdc:mga00v17_1_c1 nmdc:mga00v17_1_c1_87049_88248 399
207 3300050492 nmdc:mga0yw44_103_c1 nmdc:mga0yw44_103_c1_22728_23927 399
208 3300050493 nmdc:mga0k408_25318_c1 nmdc:mga0k408_25318_c1_1282_2481 399
209 3300050494 nmdc:mga06z11_24159_c1 nmdc:mga06z11_24159_c1_1187_2386 399
210 3300050495 nmdc:mga04h51_24221_c1 nmdc:mga04h51_24221_c1_488_1687 399
211 3300050516 nmdc:mga0sz30_5_c1 nmdc:mga0sz30_5_c1_30854_32053 399
212 3300053121 Ga0500607_020195 Ga0500607_020195_1443_2642 399
213 3300053121 Ga0500607_094550 Ga0500607_094550_56_1255 399
214 3300053136 Ga0500559_0010064 Ga0500559_0010064_2797_4020 399
215 3300053137 Ga0500561_0000100 Ga0500561_0000100_7806_9005 399
216 3300053157 Ga0500624_000039 Ga0500624_000039_48161_49393 399
217 3300053177 Ga0500636_0000144 Ga0500636_0000144_23322_24521 399
218 3300053178 Ga0500637_0000120 Ga0500637_0000120_17274_18506 399
219 3300006038 Ga0075365_10000094 Ga0075365_1000009420 400
220 3300006042 Ga0075368_10000101 Ga0075368_100001015 400
221 3300006048 Ga0075363_100000004 Ga0075363_1000000043 400
222 3300006048 Ga0075363_100047302 Ga0075363_1000473022 400
223 3300006051 Ga0075364_10000004 Ga0075364_1000000489 400
224 3300006177 Ga0075362_10000009 Ga0075362_1000000991 400
225 3300006178 Ga0075367_10000018 Ga0075367_1000001822 400
226 3300006186 Ga0075369_10000011 Ga0075369_1000001156 400
227 3300006195 Ga0075366_10000085 Ga0075366_1000008519 400
228 3300006353 Ga0075370_10000050 Ga0075370_1000005028 400
229 3300006353 Ga0075370_10001571 Ga0075370_100015713 400
230 3300006844 Ga0075428_100461403 Ga0075428_1004614031 400
231 3300027866 Ga0209813_10004031 Ga0209813_100040314 400
232 3300028786 Ga0307517_10000160 Ga0307517_100001605 400
233 3300028786 Ga0307517_10109027 Ga0307517_101090273 400
234 3300028794 Ga0307515_10002570 Ga0307515_1000257020 400
235 3300028794 Ga0307515_10010552 Ga0307515_1001055216 400
236 3300028794 Ga0307515_10079468 Ga0307515_100794685 400
237 3300028794 Ga0307515_10191109 Ga0307515_101911092 400
238 3300030522 Ga0307512_10037182 Ga0307512_100371822 400
239 3300030522 Ga0307512_10080008 Ga0307512_100800082 400
240 3300031456 Ga0307513_10117954 Ga0307513_101179542 400
241 3300031507 Ga0307509_10000317 Ga0307509_1000031762 400
242 3300031507 Ga0307509_10004066 Ga0307509_100040667 400
243 3300031507 Ga0307509_10133156 Ga0307509_101331561 400
244 3300031616 Ga0307508_10000332 Ga0307508_1000033253 400
245 3300031616 Ga0307508_10013354 Ga0307508_100133544 400
246 3300031649 Ga0307514_10001524 Ga0307514_1000152412 400
247 3300031730 Ga0307516_10126841 Ga0307516_101268412 400
248 3300033179 Ga0307507_10094876 Ga0307507_100948762 400
249 3300033180 Ga0307510_10013175 Ga0307510_100131757 400
250 3300033180 Ga0307510_10056062 Ga0307510_100560622 400
251 3300033180 Ga0307510_10057800 Ga0307510_100578004 400
252 3300035695 Ga0373927_0007910 Ga0373927_0007910_1699_2904 400
253 3300035695 Ga0373927_0056037 Ga0373927_0056037_783_1991 400
254 3300035725 Ga0373947_0038636 Ga0373947_0038636_442_1650 400
255 3300046452 Ga0495617_000129 Ga0495617_000129_22689_23897 400
256 3300046452 Ga0495617_003129 Ga0495617_003129_692_1900 400
257 3300046453 Ga0495627_002452 Ga0495627_002452_2952_4163 400
258 3300046454 Ga0495592_0000175 Ga0495592_0000175_53183_54385 400
259 3300046455 Ga0495603_0068267 Ga0495603_0068267_812_2044 400
260 3300046457 Ga0495590_0001918 Ga0495590_0001918_4889_6097 400
261 3300046457 Ga0495590_0022154 Ga0495590_0022154_956_2164 400
262 3300046457 Ga0495590_0037180 Ga0495590_0037180_94_1296 400
263 3300046458 Ga0495591_000008 Ga0495591_000008_14051_15259 400
264 3300046458 Ga0495591_000053 Ga0495591_000053_97992_99200 400
265 3300046458 Ga0495591_001488 Ga0495591_001488_8784_9992 400
266 3300046458 Ga0495591_013613 Ga0495591_013613_847_2055 400
267 3300046459 Ga0495629_0000085 Ga0495629_0000085_79214_80434 400
268 3300046460 Ga0495638_0003759 Ga0495638_0003759_10198_11403 400
269 3300046460 Ga0495638_0024662 Ga0495638_0024662_1161_2363 400
270 3300046460 Ga0495638_0069918 Ga0495638_0069918_42_1244 400
271 3300046463 Ga0495653_0001499 Ga0495653_0001499_14322_15542 400
272 3300046463 Ga0495653_0082224 Ga0495653_0082224_135_1358 400
273 3300046471 Ga0495650_0000073 Ga0495650_0000073_33259_34467 400
274 3300046471 Ga0495650_0000164 Ga0495650_0000164_45964_47169 400
275 3300046471 Ga0495650_0000180 Ga0495650_0000180_58253_59461 400
276 3300046471 Ga0495650_0002312 Ga0495650_0002312_10255_11460 400
277 3300046472 Ga0495580_0004929 Ga0495580_0004929_5499_6719 400
278 3300046474 Ga0495605_0000040 Ga0495605_0000040_59261_60472 400
279 3300046474 Ga0495605_0000272 Ga0495605_0000272_1412_2620 400
280 3300046474 Ga0495605_0003592 Ga0495605_0003592_309_1514 400
281 3300046474 Ga0495605_0009911 Ga0495605_0009911_647_1876 400
282 3300046474 Ga0495605_0017968 Ga0495605_0017968_57_1265 400
283 3300046474 Ga0495605_0034615 Ga0495605_0034615_227_1450 400
284 3300046477 Ga0495664_0009069 Ga0495664_0009069_1493_2698 400
285 3300046477 Ga0495664_0119025 Ga0495664_0119025_159_1400 400
286 3300046491 Ga0495584_0000020 Ga0495584_0000020_118851_120059 400
287 3300046491 Ga0495584_0000179 Ga0495584_0000179_10248_11453 400
288 3300046491 Ga0495584_0000262 Ga0495584_0000262_29883_31088 400
289 3300046491 Ga0495584_0003161 Ga0495584_0003161_195_1418 400
290 3300046491 Ga0495584_0010646 Ga0495584_0010646_2834_4042 400
291 3300046492 Ga0495585_0009223 Ga0495585_0009223_261_1466 400
292 3300046492 Ga0495585_0033171 Ga0495585_0033171_1153_2361 400
293 3300046500 Ga0495596_0000016 Ga0495596_0000016_31998_33200 400
294 3300046500 Ga0495596_0000025 Ga0495596_0000025_35027_36235 400
295 3300046500 Ga0495596_0000177 Ga0495596_0000177_24483_25712 400
296 3300046500 Ga0495596_0002627 Ga0495596_0002627_6050_7258 400
297 3300046500 Ga0495596_0003361 Ga0495596_0003361_734_1942 400
298 3300046501 Ga0495607_0000047 Ga0495607_0000047_16994_18202 400
299 3300046501 Ga0495607_0000152 Ga0495607_0000152_59426_60637 400
300 3300046501 Ga0495607_0005688 Ga0495607_0005688_1408_2631 400
301 3300046501 Ga0495607_0005955 Ga0495607_0005955_6442_7701 400
302 3300046506 Ga0495583_0000014 Ga0495583_0000014_80472_81677 400
303 3300046506 Ga0495583_0000114 Ga0495583_0000114_58615_59823 400
304 3300046506 Ga0495583_0000471 Ga0495583_0000471_47961_49166 400
305 3300046506 Ga0495583_0002090 Ga0495583_0002090_7402_8715 400
306 3300046506 Ga0495583_0005946 Ga0495583_0005946_1257_2462 400
307 3300046506 Ga0495583_0043799 Ga0495583_0043799_168_1376 400
308 3300046507 Ga0495606_0001415 Ga0495606_0001415_24460_25668 400
309 3300046507 Ga0495606_0005810 Ga0495606_0005810_3868_5070 400
310 3300046507 Ga0495606_0006083 Ga0495606_0006083_7576_8784 400
311 3300046507 Ga0495606_0059172 Ga0495606_0059172_337_1566 400
312 3300046512 Ga0495610_0000797 Ga0495610_0000797_26988_28196 400
313 3300046512 Ga0495610_0008505 Ga0495610_0008505_976_2184 400
314 3300046513 Ga0495616_0000950 Ga0495616_0000950_13933_15156 400
315 3300046513 Ga0495616_0002008 Ga0495616_0002008_5261_6466 400
316 3300046513 Ga0495616_0008314 Ga0495616_0008314_1198_2403 400
317 3300046513 Ga0495616_0015863 Ga0495616_0015863_26_1234 400
318 3300046515 Ga0495620_0006235 Ga0495620_0006235_2845_4053 400
319 3300046515 Ga0495620_0053938 Ga0495620_0053938_285_1487 400
320 3300046516 Ga0495628_0042581 Ga0495628_0042581_1430_2650 400
321 3300046517 Ga0495630_0009662 Ga0495630_0009662_5044_6267 400
322 3300046517 Ga0495630_0055776 Ga0495630_0055776_367_1575 400
323 3300046517 Ga0495630_0108127 Ga0495630_0108127_645_1850 400
324 3300046518 Ga0495631_0009794 Ga0495631_0009794_2500_3708 400
325 3300046518 Ga0495631_0027943 Ga0495631_0027943_1021_2256 400
326 3300046518 Ga0495631_0029441 Ga0495631_0029441_394_1602 400
327 3300046519 Ga0495632_0000086 Ga0495632_0000086_28862_30091 400
328 3300046519 Ga0495632_0000284 Ga0495632_0000284_80_1288 400
329 3300046519 Ga0495632_0000448 Ga0495632_0000448_37719_38927 400
330 3300046519 Ga0495632_0000921 Ga0495632_0000921_21108_22310 400
331 3300046519 Ga0495632_0015316 Ga0495632_0015316_2416_3624 400
332 3300046519 Ga0495632_0034534 Ga0495632_0034534_959_2161 400
333 3300046520 Ga0495637_0000340 Ga0495637_0000340_9960_11195 400
334 3300046520 Ga0495637_0002056 Ga0495637_0002056_811_2019 400
335 3300046520 Ga0495637_0002710 Ga0495637_0002710_5933_7141 400
336 3300046520 Ga0495637_0003460 Ga0495637_0003460_1145_2353 400
337 3300046520 Ga0495637_0017226 Ga0495637_0017226_70_1290 400
338 3300046522 Ga0495643_0000298 Ga0495643_0000298_41498_42700 400
339 3300046522 Ga0495643_0000666 Ga0495643_0000666_17485_18696 400
340 3300046522 Ga0495643_0011875 Ga0495643_0011875_3191_4399 400
341 3300046522 Ga0495643_0015832 Ga0495643_0015832_1357_2565 400
342 3300046522 Ga0495643_0026918 Ga0495643_0026918_1073_2278 400
343 3300046522 Ga0495643_0028241 Ga0495643_0028241_1815_3023 400
344 3300046522 Ga0495643_0062779 Ga0495643_0062779_102_1304 400
345 3300046523 Ga0495644_0000087 Ga0495644_0000087_4373_5578 400
346 3300046523 Ga0495644_0000164 Ga0495644_0000164_15194_16402 400
347 3300046523 Ga0495644_0007667 Ga0495644_0007667_1037_2245 400
348 3300046523 Ga0495644_0021574 Ga0495644_0021574_1076_2308 400
349 3300046524 Ga0495648_0000476 Ga0495648_0000476_35019_36224 400
350 3300046524 Ga0495648_0001810 Ga0495648_0001810_15113_16321 400
351 3300046524 Ga0495648_0003221 Ga0495648_0003221_12369_13577 400
352 3300046524 Ga0495648_0004393 Ga0495648_0004393_1463_2671 400
353 3300046524 Ga0495648_0029371 Ga0495648_0029371_445_1668 400
354 3300046524 Ga0495648_0064778 Ga0495648_0064778_408_1610 400
355 3300046525 Ga0495663_0001724 Ga0495663_0001724_4917_6122 400
356 3300046526 Ga0495666_0001202 Ga0495666_0001202_10544_11752 400
357 3300046526 Ga0495666_0012951 Ga0495666_0012951_2500_3723 400
358 3300046526 Ga0495666_0069768 Ga0495666_0069768_341_1543 400
359 3300046526 Ga0495666_0071867 Ga0495666_0071867_397_1605 400
360 3300046528 Ga0495642_0000484 Ga0495642_0000484_16238_17467 400
361 3300046528 Ga0495642_0014352 Ga0495642_0014352_636_1859 400
362 3300046528 Ga0495642_0030150 Ga0495642_0030150_167_1402 400
363 3300046530 Ga0495654_0000084 Ga0495654_0000084_80568_81776 400
364 3300046530 Ga0495654_0003342 Ga0495654_0003342_6926_8140 400
365 3300046531 Ga0495665_0007602 Ga0495665_0007602_4517_5737 400
366 3300046538 Ga0495609_0000044 Ga0495609_0000044_5685_6908 400
367 3300046538 Ga0495609_0001626 Ga0495609_0001626_10084_11307 400
368 3300046538 Ga0495609_0004460 Ga0495609_0004460_3277_4482 400
369 3300046538 Ga0495609_0005108 Ga0495609_0005108_4990_6192 400
370 3300046539 Ga0495621_0002424 Ga0495621_0002424_304_1536 400
371 3300046542 Ga0495597_0000865 Ga0495597_0000865_13396_14604 400
372 3300046542 Ga0495597_0003700 Ga0495597_0003700_3455_4663 400
373 3300046542 Ga0495597_0021765 Ga0495597_0021765_1089_2294 400
374 3300046542 Ga0495597_0085863 Ga0495597_0085863_56_1291 400
375 3300046543 Ga0495645_0000420 Ga0495645_0000420_7629_8870 400
376 3300046543 Ga0495645_0042953 Ga0495645_0042953_731_1936 400
377 3300046557 Ga0495622_0000024 Ga0495622_0000024_17538_18743 400
378 3300046557 Ga0495622_0000557 Ga0495622_0000557_13707_14915 400
379 3300046557 Ga0495622_0000889 Ga0495622_0000889_10000_11205 400
380 3300046558 Ga0495633_0004018 Ga0495633_0004018_4220_5425 400
381 3300046558 Ga0495633_0029448 Ga0495633_0029448_611_1822 400
382 3300046615 Ga0495656_0001795 Ga0495656_0001795_2679_3884 400
383 3300046615 Ga0495656_0002471 Ga0495656_0002471_1484_2689 400
384 3300046615 Ga0495656_0027614 Ga0495656_0027614_899_2122 400
385 3300046615 Ga0495656_0075946 Ga0495656_0075946_25_1236 400
386 3300046616 Ga0495668_0000287 Ga0495668_0000287_33600_34808 400
387 3300046616 Ga0495668_0023648 Ga0495668_0023648_2077_3285 400
388 3300046616 Ga0495668_0108370 Ga0495668_0108370_38_1243 400
389 3300046648 Ga0495611_0000769 Ga0495611_0000769_5287_6492 400
390 3300046648 Ga0495611_0007111 Ga0495611_0007111_1343_2551 400
391 3300046660 Ga0495625_0000016 Ga0495625_0000016_240926_242134 400
392 3300046660 Ga0495625_0001351 Ga0495625_0001351_6265_7473 400
393 3300046660 Ga0495625_0009988 Ga0495625_0009988_6595_7800 400
394 3300046660 Ga0495625_0051607 Ga0495625_0051607_553_1761 400
395 3300046660 Ga0495625_0057950 Ga0495625_0057950_113_1318 400
396 3300046660 Ga0495625_0136447 Ga0495625_0136447_24_1226 400
397 3300046663 Ga0495635_0000035 Ga0495635_0000035_63850_65058 400
398 3300046664 Ga0495659_0000325 Ga0495659_0000325_5818_7023 400
399 3300046664 Ga0495659_0004762 Ga0495659_0004762_2047_3252 400
400 3300046665 Ga0495661_0000001 Ga0495661_0000001_638349_639557 400
401 3300046665 Ga0495661_0000554 Ga0495661_0000554_13321_14532 400
402 3300046665 Ga0495661_0000722 Ga0495661_0000722_10573_11781 400
403 3300046665 Ga0495661_0003376 Ga0495661_0003376_3277_4500 400
404 3300046665 Ga0495661_0006832 Ga0495661_0006832_1681_2886 400
405 3300046665 Ga0495661_0012066 Ga0495661_0012066_490_1695 400
406 3300046665 Ga0495661_0015468 Ga0495661_0015468_1243_2481 400
407 3300046674 Ga0495588_0003788 Ga0495588_0003788_570_1778 400
408 3300046679 Ga0495623_0076289 Ga0495623_0076289_672_1895 400
409 3300046680 Ga0495646_0000704 Ga0495646_0000704_2968_4188 400
410 3300046680 Ga0495646_0013280 Ga0495646_0013280_3289_4512 400
411 3300046680 Ga0495646_0041332 Ga0495646_0041332_1253_2494 400
412 3300046680 Ga0495646_0051717 Ga0495646_0051717_1266_2468 400
413 3300046681 Ga0495647_0000282 Ga0495647_0000282_4273_5505 400
414 3300046683 Ga0495658_0001272 Ga0495658_0001272_5199_6431 400
415 3300046683 Ga0495658_0006837 Ga0495658_0006837_3383_4591 400
416 3300046684 Ga0495669_0000091 Ga0495669_0000091_29087_30316 400
417 3300046684 Ga0495669_0014973 Ga0495669_0014973_417_1646 400
418 3300046684 Ga0495669_0039461 Ga0495669_0039461_695_1900 400
419 3300046690 Ga0495624_0001032 Ga0495624_0001032_467_1690 400
420 3300046690 Ga0495624_0002583 Ga0495624_0002583_2719_3939 400
421 3300046690 Ga0495624_0011052 Ga0495624_0011052_3757_4989 400
422 3300046690 Ga0495624_0190177 Ga0495624_0190177_16_1221 400
423 3300046691 Ga0495670_0000018 Ga0495670_0000018_59499_60707 400
424 3300046691 Ga0495670_0000064 Ga0495670_0000064_41143_42348 400
425 3300046691 Ga0495670_0005461 Ga0495670_0005461_4807_6015 400
426 3300046692 Ga0495671_0001366 Ga0495671_0001366_11365_12573 400
427 3300046694 Ga0495649_0000978 Ga0495649_0000978_14829_16034 400
428 3300046694 Ga0495649_0004222 Ga0495649_0004222_5727_6929 400
429 3300046694 Ga0495649_0009739 Ga0495649_0009739_182_1390 400
430 3300046694 Ga0495649_0033583 Ga0495649_0033583_610_1818 400
431 3300046794 Ga0495589_0000035 Ga0495589_0000035_5685_6908 400
432 3300046794 Ga0495589_0000115 Ga0495589_0000115_51274_52485 400
433 3300046809 Ga0495600_0016188 Ga0495600_0016188_2688_3896 400
434 3300046810 Ga0495660_0000077 Ga0495660_0000077_27898_29109 400
435 3300046810 Ga0495660_0000414 Ga0495660_0000414_34021_35229 400
436 3300047318 Ga0495636_0000067 Ga0495636_0000067_8994_10199 400
437 3300047318 Ga0495636_0000559 Ga0495636_0000559_6086_7291 400
438 3300047319 Ga0495674_0006687 Ga0495674_0006687_7377_8597 400
439 3300047319 Ga0495674_0024227 Ga0495674_0024227_427_1632 400
440 3300047320 Ga0495672_0001199 Ga0495672_0001199_24480_25688 400
441 3300047320 Ga0495672_0001677 Ga0495672_0001677_20246_21457 400
442 3300047320 Ga0495672_0003238 Ga0495672_0003238_202_1416 400
443 3300047320 Ga0495672_0028639 Ga0495672_0028639_130_1338 400
444 3300047320 Ga0495672_0043041 Ga0495672_0043041_1297_2517 400
445 3300047321 Ga0495676_0000001 Ga0495676_0000001_359720_360928 400
446 3300047321 Ga0495676_0000398 Ga0495676_0000398_2516_3724 400
447 3300047321 Ga0495676_0098863 Ga0495676_0098863_191_1396 400
448 3300047322 Ga0495680_0000997 Ga0495680_0000997_23365_24573 400
449 3300047323 Ga0495683_0002883 Ga0495683_0002883_3033_4238 400
450 3300047323 Ga0495683_0004213 Ga0495683_0004213_5454_6665 400
451 3300047443 Ga0495687_000066 Ga0495687_000066_5685_6908 400
452 3300047443 Ga0495687_000086 Ga0495687_000086_63199_64410 400
453 3300047443 Ga0495687_000566 Ga0495687_000566_9116_10321 400
454 3300047443 Ga0495687_000603 Ga0495687_000603_5937_7142 400
455 3300047443 Ga0495687_003669 Ga0495687_003669_2324_3526 400
456 3300047444 Ga0495675_0032563 Ga0495675_0032563_1358_2566 400
457 3300047445 Ga0495677_0000321 Ga0495677_0000321_13814_15037 400
458 3300047445 Ga0495677_0000604 Ga0495677_0000604_7663_8868 400
459 3300047445 Ga0495677_0001554 Ga0495677_0001554_6997_8202 400
460 3300047445 Ga0495677_0001627 Ga0495677_0001627_3628_4833 400
461 3300047445 Ga0495677_0004008 Ga0495677_0004008_250_1461 400
462 3300047446 Ga0495679_000437 Ga0495679_000437_27465_28673 400
463 3300047447 Ga0495685_000020 Ga0495685_000020_12769_13974 400
464 3300047447 Ga0495685_000155 Ga0495685_000155_9088_10293 400
465 3300047447 Ga0495685_031809 Ga0495685_031809_317_1522 400
466 3300047469 Ga0495673_0000061 Ga0495673_0000061_177856_179076 400
467 3300047469 Ga0495673_0000873 Ga0495673_0000873_20554_21762 400
468 3300047469 Ga0495673_0001784 Ga0495673_0001784_6149_7357 400
469 3300047469 Ga0495673_0001859 Ga0495673_0001859_14074_15282 400
470 3300047469 Ga0495673_0006559 Ga0495673_0006559_2075_3280 400
471 3300047470 Ga0495681_0000003 Ga0495681_0000003_174134_175345 400
472 3300047470 Ga0495681_0000116 Ga0495681_0000116_48808_50016 400
473 3300047470 Ga0495681_0000394 Ga0495681_0000394_12752_13960 400
474 3300047470 Ga0495681_0011014 Ga0495681_0011014_1948_3156 400
475 3300047470 Ga0495681_0051588 Ga0495681_0051588_471_1703 400
476 3300047472 Ga0495686_0002101 Ga0495686_0002101_1833_3044 400
477 3300047472 Ga0495686_0015076 Ga0495686_0015076_191_1399 400
478 3300047472 Ga0495686_0033330 Ga0495686_0033330_1053_2261 400
479 3300047673 Ga0495593_0000083 Ga0495593_0000083_29072_30280 400
480 3300047673 Ga0495593_0001471 Ga0495593_0001471_3198_4418 400
481 3300048088 Ga0495602_0062060 Ga0495602_0062060_326_1549 400
482 3300048089 Ga0495614_0000499 Ga0495614_0000499_8094_9302 400
483 3300048090 Ga0495615_0000014 Ga0495615_0000014_20145_21347 400
484 3300048090 Ga0495615_0000211 Ga0495615_0000211_11981_13186 400
485 3300048090 Ga0495615_0005145 Ga0495615_0005145_1068_2300 400
486 3300048091 Ga0495626_0000011 Ga0495626_0000011_43515_44726 400
487 3300048091 Ga0495626_0000049 Ga0495626_0000049_151236_152471 400
488 3300048091 Ga0495626_0000119 Ga0495626_0000119_73845_75053 400
489 3300048091 Ga0495626_0000185 Ga0495626_0000185_16945_18153 400
490 3300048091 Ga0495626_0000376 Ga0495626_0000376_31899_33122 400
491 3300048091 Ga0495626_0000994 Ga0495626_0000994_20863_22086 400
492 3300048091 Ga0495626_0001379 Ga0495626_0001379_1717_2925 400
493 3300048091 Ga0495626_0059211 Ga0495626_0059211_369_1571 400
494 3300049459 Ga0495678_000008 Ga0495678_000008_412322_413530 400
495 3300049459 Ga0495678_000721 Ga0495678_000721_10108_11313 400
496 3300050489 nmdc:mga03683_11_c1 nmdc:mga03683_11_c1_38535_39737 400
497 3300050489 nmdc:mga03683_4377_c1 nmdc:mga03683_4377_c1_2552_3757 400
498 3300050490 nmdc:mga03n38_1_c1 nmdc:mga03n38_1_c1_86978_88180 400
499 3300050490 nmdc:mga03n38_20369_c1 nmdc:mga03n38_20369_c1_598_1803 400
500 3300050491 nmdc:mga00v17_1_c1 nmdc:mga00v17_1_c1_143649_144851 400
501 3300050491 nmdc:mga00v17_63868_c2 nmdc:mga00v17_63868_c2_84_1289 400
502 3300050492 nmdc:mga0yw44_61_c1 nmdc:mga0yw44_61_c1_7835_9037 400
503 3300050493 nmdc:mga0k408_34957_c1 nmdc:mga0k408_34957_c1_68_1273 400
504 3300050494 nmdc:mga06z11_319_c1 nmdc:mga06z11_319_c1_14650_15852 400
505 3300050495 nmdc:mga04h51_1247_c1 nmdc:mga04h51_1247_c1_4381_5583 400
506 3300050496 nmdc:mga07m45_2698_c1 nmdc:mga07m45_2698_c1_5193_6398 400
507 3300050496 nmdc:mga07m45_447_c1 nmdc:mga07m45_447_c1_8368_9570 400
508 3300050516 nmdc:mga0sz30_5_c1 nmdc:mga0sz30_5_c1_87454_88656 400
509 3300053080 Ga0500635_0000020 Ga0500635_0000020_78935_80143 400
510 3300053087 Ga0500643_000479 Ga0500643_000479_8946_10175 400
511 3300053087 Ga0500643_000763 Ga0500643_000763_7698_8906 400
512 3300053087 Ga0500643_001515 Ga0500643_001515_10007_11212 400
513 3300053087 Ga0500643_038076 Ga0500643_038076_80_1282 400
514 3300053093 Ga0500651_0000814 Ga0500651_0000814_7208_8416 400
515 3300053096 Ga0500641_0000014 Ga0500641_0000014_55878_57095 400
516 3300053096 Ga0500641_0000099 Ga0500641_0000099_10672_11901 400
517 3300053096 Ga0500641_0009067 Ga0500641_0009067_2319_3527 400
518 3300053104 Ga0500556_0001922 Ga0500556_0001922_3947_5176 400
519 3300053107 Ga0500560_003913 Ga0500560_003913_1246_2448 400
520 3300053108 Ga0500562_012630 Ga0500562_012630_496_1728 400
521 3300053110 Ga0500571_000074 Ga0500571_000074_19619_20827 400
522 3300053118 Ga0500594_0001910 Ga0500594_0001910_2796_3998 400
523 3300053120 Ga0500597_043269 Ga0500597_043269_215_1423 400
524 3300053122 Ga0500608_009923 Ga0500608_009923_574_1776 400
525 3300053123 Ga0500614_005361 Ga0500614_005361_893_2101 400
526 3300053125 Ga0500618_001379 Ga0500618_001379_9747_10961 400
527 3300053130 Ga0500642_0000526 Ga0500642_0000526_9480_10688 400
528 3300053133 Ga0500655_000065 Ga0500655_000065_6474_7682 400
529 3300053133 Ga0500655_000079 Ga0500655_000079_751_1959 400
530 3300053135 Ga0500659_0000019 Ga0500659_0000019_60150_61358 400
531 3300053136 Ga0500559_0000065 Ga0500559_0000065_67620_68822 400
532 3300053136 Ga0500559_0001529 Ga0500559_0001529_6919_8127 400
533 3300053136 Ga0500559_0007781 Ga0500559_0007781_1364_2572 400
534 3300053136 Ga0500559_0009080 Ga0500559_0009080_469_1671 400
535 3300053136 Ga0500559_0037577 Ga0500559_0037577_141_1349 400
536 3300053137 Ga0500561_0001849 Ga0500561_0001849_896_2098 400
537 3300053138 Ga0500564_000044 Ga0500564_000044_7296_8498 400
538 3300053138 Ga0500564_027646 Ga0500564_027646_675_1877 400
539 3300053139 Ga0500568_0047661 Ga0500568_0047661_230_1432 400
540 3300053140 Ga0500573_0000554 Ga0500573_0000554_9157_10377 400
541 3300053141 Ga0500574_000051 Ga0500574_000051_2393_3601 400
542 3300053148 Ga0500590_002892 Ga0500590_002892_2301_3503 400
543 3300053148 Ga0500590_004333 Ga0500590_004333_1327_2535 400
544 3300053151 Ga0500604_0000100 Ga0500604_0000100_2991_4199 400
545 3300053151 Ga0500604_0000480 Ga0500604_0000480_8937_10193 400
546 3300053151 Ga0500604_0007735 Ga0500604_0007735_507_1736 400
547 3300053153 Ga0500616_0008937 Ga0500616_0008937_3928_5148 400
548 3300053153 Ga0500616_0025648 Ga0500616_0025648_128_1351 400
549 3300053154 Ga0500619_041935 Ga0500619_041935_22_1224 400
550 3300053156 Ga0500622_0000501 Ga0500622_0000501_3837_5042 400
551 3300053156 Ga0500622_0000656 Ga0500622_0000656_26417_27619 400
552 3300053156 Ga0500622_0001205 Ga0500622_0001205_9240_10445 400
553 3300053156 Ga0500622_0003016 Ga0500622_0003016_6424_7656 400
554 3300053156 Ga0500622_0003097 Ga0500622_0003097_7198_8406 400
555 3300053156 Ga0500622_0048183 Ga0500622_0048183_542_1771 400
556 3300053157 Ga0500624_005946 Ga0500624_005946_279_1487 400
557 3300053158 Ga0500627_0028157 Ga0500627_0028157_368_1573 400
558 3300053161 Ga0500634_0009172 Ga0500634_0009172_2894_4102 400
559 3300053162 Ga0500638_000284 Ga0500638_000284_9665_10873 400
560 3300053177 Ga0500636_0000163 Ga0500636_0000163_17069_18271 400
561 3300053177 Ga0500636_0000543 Ga0500636_0000543_16034_17242 400
562 3300053177 Ga0500636_0003975 Ga0500636_0003975_2112_3320 400
563 3300053178 Ga0500637_0000868 Ga0500637_0000868_2861_4069 400
564 3300053723 Ga0500567_005394 Ga0500567_005394_1711_2913 400
565 3300053724 Ga0500570_000142 Ga0500570_000142_3103_4311 400
566 3300053729 Ga0500625_000007 Ga0500625_000007_29797_30999 400
567 3300053730 Ga0500645_000773 Ga0500645_000773_11228_12457 400
568 3300053735 Ga0500596_008798 Ga0500596_008798_206_1426 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

41

408

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.8978 1 373
1pt8-assembly1.cif.gz_B crystal structure of the yfdw gene product of e. coli, in complex with oxalate and acetyl-coa 0.8963 3 395
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8963 6 373
5yit-assembly1.cif.gz_A crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8963 1 377
5yit-assembly3.cif.gz_E-2 crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8942 6 370
ID Description Score Start End Superfamily
af_O06543_1_217_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.892 6 218 3.40.50.10540
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.887 26 229 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8809 3 283 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.875 3 283 3.40.50.10540
af_Q5AMS5_241_485_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8724 3 211 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A2E9XZ25-F1-model_v4 CoA transferase 0.9649 19 395 GO:0008410
AF-A0A1H8X7Q1-F1-model_v4 Crotonobetainyl-CoA:carnitine CoA-transferase CaiB 0.9576 8 399 GO:0008410
AF-A0A157SCF4-F1-model_v4 Acyl-CoA transferase (EC 2.8.3.16) 0.9567 8 380 GO:0033608
AF-A0A1D2UL53-F1-model_v4 Acetyl-CoA acetyltransferase 0.956 8 389 GO:0008410
AF-A0A1Q4AD53-F1-model_v4 CoA transferase 0.9555 20 388 GO:0008410

Feature Viewer

pLDDT pTM Quality
92.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map