F464532

General Info

Members Datasets Scaffolds Average Seq Length
567 266 557 177

Family's Representative Sequence

Representative Sequence 3300041498|Ga0451841_0795809|Ga0451841_0795809_23_619
Length 198
Sequence VFLRRDDRQIKRHGYRIELGEIEAILRRCDDIDAAAVVLHAGDGPALVKAYVVAEAPTDAVLDRLDAFIAGELPPPPIAGLMEFDLIEAEVGRVVFTCRPDESAYNPIGAIHGGLVCTLLDSVAGCALHSALPQGKGYTSVEIKVNYLKAVRLTSGLLTATGTVVKSGARVGFTEGAVTDESGALVATATSTLLIFDL

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
4 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
7 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
8 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
9 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
10 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
189 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
259 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
266 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 0.35
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.28
Nodule 0.18
Rhizoplane 11.82
Rhizosphere 65.43
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10016758 3300001990 Bacteria 2365
2 JGI24743J22301_10037976 3300001991 Bacteria 961
3 JGI24738J21930_10009036 3300002075 Bacteria 2253
4 JGI24738J21930_10021649 3300002075 Bacteria 1332
5 JGI24744J21845_10004069 3300002077 Bacteria 3017
6 JGI24744J21845_10006682 3300002077 Bacteria 2388
7 JGI24034J26672_10022752 3300002239 Bacteria 991
8 JGI24742J22300_10002645 3300002244 Bacteria 2874
9 Ga0007429J51699_1036235 3300003579 Bacteria 1018
10 Ga0055540_1004438 3300003792 Bacteria 6319
11 Ga0055540_1005258 3300003792 Bacteria 5519
12 Ga0070658_10384055 3300005327 Bacteria 1205
13 Ga0070676_10002208 3300005328 Bacteria 9930
14 Ga0070683_100018555 3300005329 Bacteria 6165
15 Ga0070690_100041926 3300005330 Bacteria 2898
16 Ga0070670_100233726 3300005331 Bacteria 1600
17 Ga0068869_100113739 3300005334 Bacteria 2062
18 Ga0070666_10016677 3300005335 Bacteria 4701
19 Ga0070682_100095872 3300005337 Bacteria 1949
20 Ga0068868_100001129 3300005338 Bacteria 18246
21 Ga0068868_100034735 3300005338 Bacteria 3894
22 Ga0068868_100327120 3300005338 Bacteria 1307
23 Ga0070660_100595636 3300005339 Bacteria 924
24 Ga0070689_100003566 3300005340 Bacteria 10365
25 Ga0070689_100378245 3300005340 Bacteria 1193
26 Ga0070689_100569162 3300005340 Bacteria 978
27 Ga0070691_10001974 3300005341 Bacteria 9032
28 Ga0070692_10002451 3300005345 Bacteria 7208
29 Ga0070668_100000258 3300005347 Bacteria 35205
30 Ga0070668_100002421 3300005347 Bacteria 13737
31 Ga0070668_100126669 3300005347 Bacteria 2046
32 Ga0070669_100000877 3300005353 Bacteria 21905
33 Ga0070675_100063420 3300005354 Bacteria 3055
34 Ga0070671_100004209 3300005355 Bacteria 11380
35 Ga0070674_100000948 3300005356 Bacteria 15118
36 Ga0070674_100047231 3300005356 Bacteria 2948
37 Ga0070674_101125311 3300005356 Bacteria 694
38 Ga0070673_100080343 3300005364 Bacteria 2642
39 Ga0070688_100010303 3300005365 Bacteria 5150
40 Ga0070659_100034968 3300005366 Bacteria 3911
41 Ga0070659_100834079 3300005366 Bacteria 803
42 Ga0070667_100001459 3300005367 Bacteria 21207
43 Ga0070667_100009264 3300005367 Bacteria 8157
44 Ga0070667_100024352 3300005367 Bacteria 5028
45 Ga0070667_100282225 3300005367 Bacteria 1491
46 Ga0070709_10054252 3300005434 Bacteria 2526
47 Ga0070709_10221269 3300005434 Bacteria 1350
48 Ga0070710_10000098 3300005437 Bacteria 39890
49 Ga0070701_10000353 3300005438 Bacteria 15255
50 Ga0070701_10052648 3300005438 Bacteria 2116
51 Ga0070711_100000552 3300005439 Bacteria 19570
52 Ga0070700_100001340 3300005441 Bacteria 12245
53 Ga0070700_100003379 3300005441 Bacteria 8229
54 Ga0070694_100003542 3300005444 Bacteria 9336
55 Ga0070708_100349650 3300005445 Bacteria 1393
56 Ga0070663_100026293 3300005455 Bacteria 3941
57 Ga0070663_100099400 3300005455 Bacteria 2169
58 Ga0070663_100313083 3300005455 Bacteria 1260
59 Ga0070663_100372091 3300005455 Bacteria 1162
60 Ga0070663_100676855 3300005455 Bacteria 875
61 Ga0070678_100000217 3300005456 Bacteria 25864
62 Ga0070678_100042976 3300005456 Bacteria 3216
63 Ga0070678_100129012 3300005456 Bacteria 2006
64 Ga0070678_100129341 3300005456 Bacteria 2004
65 Ga0070678_101183424 3300005456 Bacteria 708
66 Ga0070662_100094092 3300005457 Bacteria 2255
67 Ga0068867_100001472 3300005459 Bacteria 16320
68 Ga0068867_100014582 3300005459 Bacteria 5569
69 Ga0068867_100104628 3300005459 Bacteria 2167
70 Ga0070685_10199240 3300005466 Bacteria 1300
71 Ga0070685_10515585 3300005466 Bacteria 848
72 Ga0070684_100376801 3300005535 Bacteria 1307
73 Ga0068853_100001314 3300005539 Bacteria 17852
74 Ga0070672_100033087 3300005543 Bacteria 3912
75 Ga0070672_100677083 3300005543 Bacteria 902
76 Ga0070672_100695932 3300005543 Bacteria 890
77 Ga0070686_100193471 3300005544 Bacteria 1453
78 Ga0070695_100263740 3300005545 Bacteria 1259
79 Ga0070696_100002947 3300005546 Bacteria 11307
80 Ga0070696_100398208 3300005546 Bacteria 1077
81 Ga0070693_100003278 3300005547 Bacteria 7518
82 Ga0070693_100152864 3300005547 Bacteria 1463
83 Ga0070665_100001965 3300005548 Bacteria 23116
84 Ga0070665_100019903 3300005548 Bacteria 6739
85 Ga0070665_100121301 3300005548 Bacteria 2616
86 Ga0070665_100321690 3300005548 Bacteria 1551
87 Ga0070704_100000582 3300005549 Bacteria 17573
88 Ga0070704_100529836 3300005549 Bacteria 1026
89 Ga0068855_100026255 3300005563 Bacteria 6969
90 Ga0070664_100916317 3300005564 Unclassified 822
91 Ga0068854_100002471 3300005578 Bacteria 11432
92 Ga0068854_100020585 3300005578 Bacteria 4467
93 Ga0068854_100167195 3300005578 Bacteria 1708
94 Ga0068856_100297280 3300005614 Bacteria 1632
95 Ga0070702_100000377 3300005615 Bacteria 15724
96 Ga0070702_100000964 3300005615 Bacteria 11329
97 Ga0068852_100019965 3300005616 Bacteria 5319
98 Ga0068852_100517496 3300005616 Bacteria 1190
99 Ga0068859_100000438 3300005617 Bacteria 41832
100 Ga0068859_100006128 3300005617 Bacteria 12219
101 Ga0068864_100195654 3300005618 Bacteria 1855
102 Ga0068866_10000393 3300005718 Bacteria 20456
103 Ga0068866_10014104 3300005718 Bacteria 3521
104 Ga0068861_100018476 3300005719 Bacteria 4967
105 Ga0068861_100067595 3300005719 Bacteria 2759
106 Ga0068861_100728475 3300005719 Bacteria 924
107 Ga0068870_10014806 3300005840 Bacteria 3691
108 Ga0068863_100000777 3300005841 Bacteria 32074
109 Ga0068863_100005469 3300005841 Bacteria 12510
110 Ga0068863_100199146 3300005841 Bacteria 1926
111 Ga0068858_100002189 3300005842 Bacteria 19795
112 Ga0068858_100102059 3300005842 Bacteria 2676
113 Ga0068860_100000010 3300005843 Bacteria 359114
114 Ga0068860_100011965 3300005843 Bacteria 8550
115 Ga0068860_100221630 3300005843 Bacteria 1837
116 Ga0068860_100701412 3300005843 Bacteria 1022
117 Ga0068862_100000008 3300005844 Bacteria 305510
118 Ga0068862_100010466 3300005844 Bacteria 7660
119 Ga0068862_100163670 3300005844 Bacteria 1987
120 Ga0081455_10091090 3300005937 Bacteria 2470
121 Ga0075365_10002785 3300006038 Bacteria 8740
122 Ga0075365_10012403 3300006038 Bacteria 5061
123 Ga0075365_10096533 3300006038 Bacteria 2020
124 Ga0075365_10269804 3300006038 Bacteria 1197
125 Ga0075365_10383508 3300006038 Bacteria 991
126 Ga0075365_10621468 3300006038 Bacteria 764
127 Ga0075363_100001994 3300006048 Bacteria 8127
128 Ga0075363_100003564 3300006048 Bacteria 6653
129 Ga0075363_100007850 3300006048 Bacteria 4935
130 Ga0075363_100009826 3300006048 Bacteria 4511
131 Ga0075363_100069726 3300006048 Bacteria 1908
132 Ga0075363_100074579 3300006048 Bacteria 1847
133 Ga0075363_100093865 3300006048 Bacteria 1654
134 Ga0075363_100302053 3300006048 Bacteria 929
135 Ga0075364_10002788 3300006051 Bacteria 9824
136 Ga0075364_10004411 3300006051 Bacteria 8092
137 Ga0075364_10008722 3300006051 Bacteria 6064
138 Ga0075364_10112255 3300006051 Bacteria 1820
139 Ga0075364_10139326 3300006051 Bacteria 1631
140 Ga0075364_10139726 3300006051 Bacteria 1628
141 Ga0070715_10001372 3300006163 Bacteria 7025
142 Ga0070715_10001774 3300006163 Bacteria 6420
143 Ga0070716_100307867 3300006173 Bacteria 1105
144 Ga0070712_100001835 3300006175 Bacteria 12934
145 Ga0070712_100002568 3300006175 Bacteria 11215
146 Ga0075362_10053999 3300006177 Bacteria 1805
147 Ga0075362_10070256 3300006177 Bacteria 1598
148 Ga0075362_10092930 3300006177 Bacteria 1402
149 Ga0075362_10331581 3300006177 Bacteria 759
150 Ga0075367_10009953 3300006178 Bacteria 4982
151 Ga0075367_10074641 3300006178 Bacteria 2045
152 Ga0075367_10159378 3300006178 Bacteria 1403
153 Ga0075367_10277627 3300006178 Bacteria 1053
154 Ga0075369_10000552 3300006186 Bacteria 11831
155 Ga0075369_10021818 3300006186 Bacteria 2636
156 Ga0075369_10022081 3300006186 Bacteria 2623
157 Ga0075369_10039158 3300006186 Bacteria 2024
158 Ga0075369_10073775 3300006186 Bacteria 1505
159 Ga0075369_10101511 3300006186 Bacteria 1291
160 Ga0075369_10222826 3300006186 Bacteria 873
161 Ga0075366_10212028 3300006195 Bacteria 1179
162 Ga0075370_10009971 3300006353 Bacteria 4951
163 Ga0075370_10073196 3300006353 Bacteria 1962
164 Ga0075370_10135704 3300006353 Bacteria 1437
165 Ga0075370_10314072 3300006353 Bacteria 933
166 Ga0075370_10352185 3300006353 Bacteria 880
167 Ga0075428_100006332 3300006844 Bacteria 13167
168 Ga0075430_100159473 3300006846 Bacteria 1878
169 Ga0075431_100279572 3300006847 Bacteria 1690
170 Ga0068865_100002754 3300006881 Bacteria 10444
171 Ga0068865_100019660 3300006881 Bacteria 4372
172 Ga0068865_100462177 3300006881 Bacteria 1051
173 Ga0097620_100000438 3300006931 Bacteria 41832
174 Ga0097620_100006129 3300006931 Bacteria 12219
175 Ga0097620_101736329 3300006931 Bacteria 689
176 Ga0111539_10027078 3300009094 Bacteria 7002
177 Ga0111539_10899244 3300009094 Bacteria 1030
178 Ga0105245_10001613 3300009098 Bacteria 20521
179 Ga0105245_10047281 3300009098 Bacteria 3846
180 Ga0105245_10347933 3300009098 Bacteria 1468
181 Ga0105247_10000019 3300009101 Bacteria 245170
182 Ga0105247_10002822 3300009101 Bacteria 11597
183 Ga0114129_10006118 3300009147 Bacteria 17067
184 Ga0105243_10000890 3300009148 Bacteria 28112
185 Ga0105243_10016997 3300009148 Bacteria 5500
186 Ga0105243_10613882 3300009148 Bacteria 1049
187 Ga0105243_12245816 3300009148 Bacteria 583
188 Ga0105241_10017808 3300009174 Bacteria 5225
189 Ga0105242_10001840 3300009176 Bacteria 16659
190 Ga0105242_11280695 3300009176 Bacteria 756
191 Ga0105242_11366355 3300009176 Bacteria 734
192 Ga0105248_10000093 3300009177 Bacteria 98669
193 Ga0105248_10004508 3300009177 Bacteria 15409
194 Ga0105248_10250484 3300009177 Bacteria 1994
195 Ga0105248_10258620 3300009177 Bacteria 1960
196 Ga0105248_11024578 3300009177 Bacteria 933
197 Ga0105237_10260318 3300009545 Bacteria 1737
198 Ga0105238_10270503 3300009551 Bacteria 1680
199 Ga0105238_10274066 3300009551 Bacteria 1668
200 Ga0105249_10000019 3300009553 Bacteria 273807
201 Ga0105249_10002099 3300009553 Bacteria 17291
202 Ga0105249_10076726 3300009553 Bacteria 3098
203 Ga0105249_10703582 3300009553 Bacteria 1071
204 Ga0099796_10008233 3300010159 Unclassified 2771
205 Ga0105239_10009231 3300010375 Bacteria 11154
206 Ga0105239_10035779 3300010375 Bacteria 5453
207 Ga0105239_10199157 3300010375 Bacteria 2243
208 Ga0105239_10403347 3300010375 Bacteria 1547
209 Ga0105246_10588178 3300011119 Bacteria 960
210 Ga0157371_10147095 3300013102 Bacteria 1679
211 Ga0157369_11033304 3300013105 Bacteria 841
212 Ga0157378_10001194 3300013297 Bacteria 23585
213 Ga0163162_10001044 3300013306 Bacteria 25758
214 Ga0163162_10264423 3300013306 Bacteria 1852
215 Ga0157372_10003021 3300013307 Bacteria 18138
216 Ga0157372_10082136 3300013307 Bacteria 3648
217 Ga0157375_10004561 3300013308 Bacteria 12035
218 Ga0157375_10220649 3300013308 Bacteria 2054
219 Ga0157375_10556086 3300013308 Bacteria 1309
220 Ga0157375_11224824 3300013308 Bacteria 881
221 Ga0157375_11834793 3300013308 Bacteria 719
222 Ga0163163_10021502 3300014325 Bacteria 6090
223 Ga0163163_10028769 3300014325 Bacteria 5340
224 Ga0163163_10455132 3300014325 Bacteria 1340
225 Ga0163163_10497091 3300014325 Bacteria 1281
226 Ga0157380_10001018 3300014326 Bacteria 17841
227 Ga0157380_10003698 3300014326 Bacteria 10520
228 Ga0157377_10013701 3300014745 Bacteria 4110
229 Ga0157379_10002098 3300014968 Bacteria 16538
230 Ga0157379_10065148 3300014968 Bacteria 3257
231 Ga0157376_10195489 3300014969 Bacteria 1858
232 Ga0157376_11178669 3300014969 Bacteria 794
233 Ga0163161_10001662 3300017792 Bacteria 16323
234 Ga0163161_10268552 3300017792 Bacteria 1334
235 Ga0163161_10914605 3300017792 Bacteria 744
236 Ga0209673_1029948 3300025273 Bacteria 1724
237 Ga0209051_1000576 3300025303 Bacteria 44167
238 Ga0209051_1003991 3300025303 Bacteria 9367
239 Ga0207697_10054517 3300025315 Bacteria 1657
240 Ga0207692_10001803 3300025898 Bacteria 8121
241 Ga0207642_10002785 3300025899 Bacteria 5459
242 Ga0207710_10000036 3300025900 Bacteria 245176
243 Ga0207710_10010289 3300025900 Bacteria 3937
244 Ga0207688_10000796 3300025901 Bacteria 15756
245 Ga0207688_10003184 3300025901 Bacteria 8952
246 Ga0207688_10014662 3300025901 Bacteria 4257
247 Ga0207680_10018124 3300025903 Bacteria 3735
248 Ga0207680_10498960 3300025903 Bacteria 867
249 Ga0207647_10095038 3300025904 Bacteria 1775
250 Ga0207699_10238975 3300025906 Bacteria 1247
251 Ga0207645_10044577 3300025907 Bacteria 2838
252 Ga0207643_10015115 3300025908 Bacteria 4198
253 Ga0207643_10302807 3300025908 Bacteria 995
254 Ga0207654_10021917 3300025911 Bacteria 3403
255 Ga0207671_10002168 3300025914 Bacteria 21336
256 Ga0207671_10079357 3300025914 Bacteria 2459
257 Ga0207671_10453722 3300025914 Bacteria 1021
258 Ga0207693_10000819 3300025915 Bacteria 27762
259 Ga0207693_10001117 3300025915 Bacteria 24092
260 Ga0207663_10008571 3300025916 Bacteria 5358
261 Ga0207681_10002486 3300025923 Bacteria 11700
262 Ga0207681_10075483 3300025923 Bacteria 2364
263 Ga0207694_11287465 3300025924 Bacteria 618
264 Ga0207659_10119294 3300025926 Bacteria 2019
265 Ga0207687_10060852 3300025927 Bacteria 2665
266 Ga0207687_10105553 3300025927 Bacteria 2082
267 Ga0207644_10134113 3300025931 Bacteria 1899
268 Ga0207690_10091083 3300025932 Bacteria 2155
269 Ga0207706_10020531 3300025933 Bacteria 5937
270 Ga0207706_10042516 3300025933 Bacteria 4027
271 Ga0207686_10002419 3300025934 Bacteria 10162
272 Ga0207686_10353121 3300025934 Bacteria 1107
273 Ga0207709_10009475 3300025935 Bacteria 5357
274 Ga0207709_10258996 3300025935 Bacteria 1275
275 Ga0207709_10599922 3300025935 Bacteria 872
276 Ga0207670_10058344 3300025936 Bacteria 2622
277 Ga0207670_10083822 3300025936 Bacteria 2237
278 Ga0207670_10380022 3300025936 Bacteria 1125
279 Ga0207669_10000708 3300025937 Bacteria 14403
280 Ga0207669_10017091 3300025937 Bacteria 3710
281 Ga0207704_10001958 3300025938 Bacteria 9232
282 Ga0207704_10016635 3300025938 Bacteria 3786
283 Ga0207691_10013080 3300025940 Bacteria 7946
284 Ga0207691_10080096 3300025940 Bacteria 2938
285 Ga0207691_10511810 3300025940 Bacteria 1019
286 Ga0207711_10000102 3300025941 Bacteria 90198
287 Ga0207711_10015889 3300025941 Bacteria 6243
288 Ga0207711_10170807 3300025941 Bacteria 1973
289 Ga0207711_10457523 3300025941 Bacteria 1188
290 Ga0207661_10098580 3300025944 Bacteria 2449
291 Ga0207661_10243150 3300025944 Bacteria 1598
292 Ga0207661_10485884 3300025944 Bacteria 1128
293 Ga0207679_10266021 3300025945 Bacteria 1464
294 Ga0207679_10744865 3300025945 Bacteria 891
295 Ga0207651_10043726 3300025960 Bacteria 2992
296 Ga0207712_10000025 3300025961 Bacteria 274015
297 Ga0207712_10003273 3300025961 Bacteria 10277
298 Ga0207712_10360018 3300025961 Bacteria 1212
299 Ga0207668_10000768 3300025972 Bacteria 19620
300 Ga0207668_10030162 3300025972 Bacteria 3562
301 Ga0207668_10054128 3300025972 Bacteria 2784
302 Ga0207668_10121531 3300025972 Bacteria 1978
303 Ga0207668_10178183 3300025972 Bacteria 1674
304 Ga0207640_10002830 3300025981 Bacteria 9307
305 Ga0207640_10005389 3300025981 Bacteria 6974
306 Ga0207640_10271339 3300025981 Bacteria 1327
307 Ga0207640_10362321 3300025981 Bacteria 1169
308 Ga0207658_10000432 3300025986 Bacteria 39565
309 Ga0207658_10007719 3300025986 Bacteria 7328
310 Ga0207658_10167270 3300025986 Bacteria 1808
311 Ga0207658_10280295 3300025986 Bacteria 1428
312 Ga0207658_10601394 3300025986 Bacteria 988
313 Ga0207677_10004624 3300026023 Bacteria 7405
314 Ga0207677_10150037 3300026023 Bacteria 1797
315 Ga0207677_10375821 3300026023 Bacteria 1198
316 Ga0207703_10012412 3300026035 Bacteria 6640
317 Ga0207703_10078262 3300026035 Bacteria 2747
318 Ga0207703_10239435 3300026035 Bacteria 1631
319 Ga0207639_10449357 3300026041 Bacteria 1170
320 Ga0207678_10022482 3300026067 Bacteria 5522
321 Ga0207678_10130792 3300026067 Bacteria 2141
322 Ga0207678_10151135 3300026067 Bacteria 1983
323 Ga0207678_10353558 3300026067 Bacteria 1267
324 Ga0207678_10422280 3300026067 Bacteria 1156
325 Ga0207678_10593926 3300026067 Bacteria 970
326 Ga0207708_10000511 3300026075 Bacteria 29928
327 Ga0207708_10002118 3300026075 Bacteria 14635
328 Ga0207702_10254553 3300026078 Bacteria 1650
329 Ga0207641_10001204 3300026088 Bacteria 25896
330 Ga0207641_10044282 3300026088 Bacteria 3742
331 Ga0207648_10002201 3300026089 Bacteria 21169
332 Ga0207648_10006919 3300026089 Bacteria 11238
333 Ga0207648_10062697 3300026089 Bacteria 3241
334 Ga0207676_10399024 3300026095 Bacteria 1285
335 Ga0207675_100014086 3300026118 Bacteria 7457
336 Ga0207675_100035191 3300026118 Bacteria 4671
337 Ga0207675_100228179 3300026118 Bacteria 1796
338 Ga0207675_100273354 3300026118 Bacteria 1640
339 Ga0207683_10000147 3300026121 Bacteria 58383
340 Ga0207683_10027499 3300026121 Bacteria 4915
341 Ga0207683_10130627 3300026121 Bacteria 2259
342 Ga0207683_10450263 3300026121 Bacteria 1187
343 Ga0207683_10465305 3300026121 Bacteria 1166
344 Ga0209813_10031539 3300027866 Bacteria 1565
345 Ga0209813_10185335 3300027866 Bacteria 763
346 Ga0207428_10962659 3300027907 Bacteria 601
347 Ga0268266_10001834 3300028379 Bacteria 24026
348 Ga0268266_10085764 3300028379 Bacteria 2752
349 Ga0268265_10000007 3300028380 Bacteria 431817
350 Ga0268265_10029576 3300028380 Bacteria 3934
351 Ga0268265_10264151 3300028380 Bacteria 1532
352 Ga0268265_10460431 3300028380 Bacteria 1190
353 Ga0268265_10917955 3300028380 Bacteria 861
354 Ga0268264_10000007 3300028381 Bacteria 815790
355 Ga0268264_10012623 3300028381 Bacteria 6959
356 Ga0268264_10236648 3300028381 Bacteria 1689
357 Ga0268264_11984097 3300028381 Bacteria 591
358 Ga0307413_10016170 3300031824 Bacteria 3845
359 Ga0307413_10079659 3300031824 Bacteria 2095
360 Ga0307410_10113089 3300031852 Bacteria 1967
361 Ga0307406_10617453 3300031901 Bacteria 896
362 Ga0307407_10112779 3300031903 Bacteria 1710
363 Ga0307407_10357054 3300031903 Bacteria 1037
364 Ga0307409_100269649 3300031995 Bacteria 1567
365 Ga0307409_100709310 3300031995 Bacteria 1006
366 Ga0373958_0075561 3300034819 Bacteria 755
367 Ga0373939_0033847 3300035114 Bacteria 1496
368 Ga0373942_0065562 3300035207 Bacteria 1049
369 Ga0373962_0038631 3300035242 Bacteria 1337
370 Ga0373931_0277598 3300035691 Bacteria 1028
371 Ga0439461_0042372 3300041410 Bacteria 987
372 Ga0439466_0010916 3300041411 Bacteria 3367
373 Ga0439466_0013738 3300041411 Bacteria 2961
374 Ga0439466_0033545 3300041411 Unclassified 1744
375 Ga0439465_0019254 3300041413 Bacteria 2133
376 Ga0439465_0022046 3300041413 Bacteria 2000
377 Ga0439465_0034328 3300041413 Bacteria 1624
378 Ga0439465_0087175 3300041413 Unclassified 1064
379 Ga0451795_0391229 3300041456 Bacteria 1614
380 Ga0451795_1138658 3300041456 Bacteria 654
381 Ga0451802_0241162 3300041460 Bacteria 1462
382 Ga0451802_2147479 3300041460 Bacteria 680
383 Ga0451841_0795809 3300041498 Bacteria 776
384 Ga0451849_0033504 3300041505 Bacteria 568
385 Ga0451853_3691423 3300041512 Bacteria 1121
386 Ga0439431_0000657 3300041997 Bacteria 7369
387 Ga0439431_0014660 3300041997 Bacteria 1819
388 Ga0439442_019150 3300042002 Bacteria 1416
389 Ga0439445_0001437 3300042004 Bacteria 5174
390 Ga0439434_0056322 3300042435 Bacteria 1224
391 Ga0439435_0002024 3300042436 Bacteria 3918
392 Ga0439459_0001724 3300042438 Bacteria 3269
393 Ga0466972_0009846 3300044658 Bacteria 4800
394 Ga0466965_0006071 3300044683 Bacteria 5460
395 Ga0466965_0035072 3300044683 Bacteria 2456
396 Ga0466968_0000850 3300044735 Bacteria 10686
397 Ga0466968_0148141 3300044735 Bacteria 1077
398 Ga0466970_0094832 3300044765 Bacteria 1621
399 Ga0466970_0173174 3300044765 Bacteria 1196
400 Ga0466957_0002101 3300044842 Bacteria 10660
401 Ga0466957_0038571 3300044842 Bacteria 2878
402 Ga0466960_0001129 3300044901 Bacteria 9577
403 Ga0466959_0036518 3300045049 Bacteria 3631
404 Ga0466967_1459603 3300045976 Bacteria 681
405 Ga0495638_0001938 3300046460 Bacteria 17747
406 Ga0495583_0112108 3300046506 Bacteria 1155
407 Ga0495606_0136925 3300046507 Bacteria 1449
408 Ga0495648_0022048 3300046524 Bacteria 4395
409 Ga0495635_0092025 3300046663 Bacteria 2074
410 Ga0495649_0153099 3300046694 Bacteria 1211
411 Ga0495581_0181163 3300047315 Bacteria 1232
412 Ga0495672_0021675 3300047320 Bacteria 4188
413 Ga0495672_0026778 3300047320 Bacteria 3673
414 Ga0495673_0003829 3300047469 Bacteria 9716
415 Ga0495686_0000949 3300047472 Bacteria 35859
416 Ga0495686_0054287 3300047472 Bacteria 2509
417 Ga0495686_0195894 3300047472 Bacteria 1162
418 Ga0496100_0000644 3300048903 Bacteria 16569
419 Ga0496100_0005107 3300048903 Bacteria 7032
420 Ga0496100_0028862 3300048903 Bacteria 3426
421 Ga0496100_0051476 3300048903 Bacteria 2674
422 Ga0496100_0078259 3300048903 Bacteria 2225
423 Ga0496100_0660719 3300048903 Bacteria 814
424 Ga0496100_0960760 3300048903 Bacteria 672
425 Ga0496101_0000030 3300048904 Bacteria 198447
426 Ga0496101_0004169 3300048904 Bacteria 9052
427 Ga0496101_0038472 3300048904 Bacteria 3398
428 Ga0496102_0000001 3300048905 Bacteria 873433
429 Ga0496102_0001472 3300048905 Bacteria 20778
430 Ga0496102_0002025 3300048905 Bacteria 17513
431 Ga0496102_0076797 3300048905 Bacteria 3073
432 Ga0496102_0096221 3300048905 Bacteria 2745
433 Ga0496102_0111337 3300048905 Bacteria 2552
434 Ga0496102_0121401 3300048905 Bacteria 2441
435 Ga0496102_0336389 3300048905 Bacteria 1422
436 Ga0496102_0910753 3300048905 Bacteria 801
437 Ga0496103_0000003 3300048906 Bacteria 603967
438 Ga0496103_0000580 3300048906 Bacteria 28931
439 Ga0496103_0001100 3300048906 Bacteria 18821
440 Ga0496103_0066369 3300048906 Bacteria 2252
441 Ga0496103_0099672 3300048906 Bacteria 1838
442 Ga0496103_0403517 3300048906 Bacteria 878
443 Ga0496104_0032458 3300048907 Bacteria 4860
444 Ga0496104_0628494 3300048907 Bacteria 983
445 Ga0496105_0041013 3300048908 Bacteria 3815
446 Ga0496105_0270000 3300048908 Bacteria 1374
447 Ga0496106_0000487 3300048909 Bacteria 28167
448 Ga0496106_0005944 3300048909 Bacteria 9013
449 Ga0496106_0131366 3300048909 Bacteria 1964
450 Ga0496106_0188057 3300048909 Bacteria 1641
451 Ga0496106_0202109 3300048909 Bacteria 1581
452 Ga0496107_0000192 3300048910 Bacteria 31798
453 Ga0496107_0025930 3300048910 Bacteria 4154
454 Ga0496108_0013422 3300048911 Bacteria 6682
455 Ga0496108_0135947 3300048911 Bacteria 2115
456 Ga0496108_0140104 3300048911 Bacteria 2084
457 Ga0496108_0526967 3300048911 Bacteria 1031
458 Ga0496108_0687707 3300048911 Bacteria 888
459 Ga0496109_0016455 3300048912 Bacteria 6466
460 Ga0496109_0023451 3300048912 Bacteria 5478
461 Ga0496109_0192644 3300048912 Bacteria 1916
462 Ga0496109_1156103 3300048912 Bacteria 711
463 Ga0496110_0189072 3300048913 Bacteria 1870
464 Ga0496110_0602982 3300048913 Bacteria 996
465 Ga0496110_1335187 3300048913 Bacteria 626
466 Ga0496111_0093382 3300048914 Bacteria 2206
467 Ga0496111_0256207 3300048914 Bacteria 1298
468 Ga0496111_0293889 3300048914 Bacteria 1205
469 Ga0496112_0004488 3300048915 Bacteria 11839
470 Ga0496112_0044504 3300048915 Bacteria 4350
471 Ga0496112_0168117 3300048915 Bacteria 2159
472 Ga0496112_0248006 3300048915 Bacteria 1732
473 Ga0496113_0181036 3300048916 Bacteria 1671
474 Ga0496113_0531805 3300048916 Bacteria 943
475 Ga0496114_0001156 3300048917 Bacteria 19911
476 Ga0496114_0005375 3300048917 Bacteria 10014
477 Ga0496114_0111383 3300048917 Bacteria 2346
478 Ga0496114_0204817 3300048917 Bacteria 1729
479 Ga0496115_0003444 3300048918 Bacteria 11368
480 Ga0496115_0004908 3300048918 Bacteria 9708
481 Ga0496116_0000013 3300048919 Bacteria 603993
482 Ga0496116_0027873 3300048919 Bacteria 4103
483 Ga0496117_0000013 3300048920 Bacteria 603995
484 Ga0496117_0000719 3300048920 Bacteria 52226
485 Ga0496118_0000011 3300048921 Bacteria 603995
486 Ga0496118_0004910 3300048921 Bacteria 15539
487 Ga0496119_0000076 3300048922 Bacteria 143663
488 Ga0496119_0005042 3300048922 Bacteria 12835
489 Ga0496119_0073746 3300048922 Bacteria 1990
490 Ga0496120_0000633 3300048923 Bacteria 52382
491 Ga0496120_0006734 3300048923 Bacteria 8731
492 Ga0496121_0002131 3300048924 Bacteria 31103
493 Ga0496121_0002671 3300048924 Bacteria 26693
494 Ga0496124_0131630 3300048927 Bacteria 1986
495 Ga0496125_0014881 3300048928 Bacteria 7554
496 Ga0496126_0003011 3300048929 Bacteria 21857
497 Ga0496126_0006500 3300048929 Bacteria 13008
498 Ga0496126_0244970 3300048929 Bacteria 1496
499 Ga0496126_0877478 3300048929 Bacteria 682
500 Ga0501080_0132518 3300049742 Bacteria 2307
501 nmdc:mga03683_108486_c1 3300050489 Bacteria 1225
502 nmdc:mga03683_295864_c1 3300050489 Bacteria 758
503 nmdc:mga03n38_14617_c1 3300050490 Bacteria 3013
504 nmdc:mga03n38_146560_c1 3300050490 Bacteria 1184
505 nmdc:mga03n38_23368_c1 3300050490 Bacteria 2514
506 nmdc:mga03n38_5501_c1 3300050490 Bacteria 4319
507 nmdc:mga03n38_9118_c1 3300050490 Bacteria 3592
508 nmdc:mga00v17_1014_c1 3300050491 Bacteria 15023
509 nmdc:mga00v17_13142_c1 3300050491 Bacteria 4588
510 nmdc:mga00v17_139141_c1 3300050491 Bacteria 1555
511 nmdc:mga00v17_172754_c1 3300050491 Bacteria 1394
512 nmdc:mga00v17_219547_c1 3300050491 Bacteria 1231
513 nmdc:mga00v17_54678_c1 3300050491 Bacteria 2436
514 nmdc:mga0yw44_10437_c1 3300050492 Bacteria 4745
515 nmdc:mga0yw44_168349_c1 3300050492 Bacteria 1438
516 nmdc:mga0yw44_188817_c2 3300050492 Bacteria 768
517 nmdc:mga0yw44_292984_c1 3300050492 Bacteria 1089
518 nmdc:mga0yw44_338840_c1 3300050492 Bacteria 1011
519 nmdc:mga0yw44_432881_c1 3300050492 Bacteria 891
520 nmdc:mga0yw44_87864_c1 3300050492 Bacteria 1960
521 nmdc:mga0yw44_90091_c1 3300050492 Bacteria 1937
522 nmdc:mga0k408_228036_c1 3300050493 Bacteria 1112
523 nmdc:mga06z11_2830_c1 3300050494 Bacteria 6658
524 nmdc:mga06z11_52954_c1 3300050494 Bacteria 2085
525 nmdc:mga06z11_5942_c1 3300050494 Bacteria 4931
526 nmdc:mga04h51_213040_c1 3300050495 Bacteria 763
527 nmdc:mga04h51_6571_c1 3300050495 Bacteria 3022
528 nmdc:mga04h51_93534_c1 3300050495 Bacteria 1085
529 nmdc:mga07m45_2899_c1 3300050496 Bacteria 8129
530 nmdc:mga07m45_40092_c1 3300050496 Bacteria 2620
531 nmdc:mga07m45_47937_c1 3300050496 Bacteria 1841
532 nmdc:mga07m45_68525_c1 3300050496 Bacteria 2017
533 nmdc:mga05p37_14576_c1 3300050507 Bacteria 9440
534 nmdc:mga0qj67_108194_c1 3300050509 Bacteria 2243
535 nmdc:mga06r32_182405_c1 3300050510 Bacteria 2085
536 nmdc:mga08y16_371431_c2 3300050511 Bacteria 918
537 nmdc:mga08y16_40862_c1 3300050511 Bacteria 4859
538 nmdc:mga0sz30_123609_c1 3300050516 Bacteria 1138
539 nmdc:mga0sz30_21568_c1 3300050516 Bacteria 2608
540 nmdc:mga0sz30_3967_c1 3300050516 Bacteria 5331
541 nmdc:mga0sz30_4801_c1 3300050516 Bacteria 4918
542 nmdc:mga0sz30_72170_c1 3300050516 Bacteria 1487
543 Ga0500610_0029892 3300053079 Bacteria 2756
544 Ga0500635_0002000 3300053080 Bacteria 4976
545 Ga0495655_0125436 3300053083 Bacteria 786
546 Ga0500643_018512 3300053087 Bacteria 2310
547 Ga0500644_0161142 3300053088 Bacteria 907
548 Ga0500646_0130196 3300053090 Bacteria 817
549 Ga0500556_0004567 3300053104 Bacteria 3937
550 Ga0500556_0008394 3300053104 Bacteria 2977
551 Ga0500556_0098780 3300053104 Bacteria 1122
552 Ga0500562_011945 3300053108 Bacteria 2204
553 Ga0500593_006798 3300053117 Bacteria 4602
554 Ga0500652_000943 3300053131 Bacteria 9626
555 Ga0500616_0024554 3300053153 Bacteria 3348
556 Ga0500627_0098479 3300053158 Bacteria 1312
557 Ga0587091_025440 3300059511 Bacteria 1071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10269804 Ga0075365_102698042 162
2 3300013308 Ga0157375_10556086 Ga0157375_105560863 162
3 3300050492 nmdc:mga0yw44_432881_c1 nmdc:mga0yw44_432881_c1_29_517 162
4 3300053117 Ga0500593_006798 Ga0500593_006798_4042_4530 162
5 3300048929 Ga0496126_0877478 Ga0496126_0877478_116_607 163
6 3300053083 Ga0495655_0125436 Ga0495655_0125436_74_571 165
7 iso_pu_bacteria 2643221687 2644489183 165
8 iso_pu_bacteria 2902837492 2902837748 165
9 3300053104 Ga0500556_0004567 Ga0500556_0004567_150_653 167
10 iso_pu_bacteria 2751185725 2753036035 168
11 iso_pu_bacteria 2751185792 2753323907 168
12 iso_pu_bacteria 2842134933 2842135922 168
13 3300003792 Ga0055540_1004438 Ga0055540_10044386 169
14 3300003792 Ga0055540_1005258 Ga0055540_10052583 169
15 3300005455 Ga0070663_100372091 Ga0070663_1003720913 169
16 3300005466 Ga0070685_10515585 Ga0070685_105155851 169
17 3300025273 Ga0209673_1029948 Ga0209673_10299483 169
18 3300025303 Ga0209051_1000576 Ga0209051_10005768 169
19 3300025303 Ga0209051_1003991 Ga0209051_10039914 169
20 3300026067 Ga0207678_10151135 Ga0207678_101511353 169
21 3300041456 Ga0451795_0391229 Ga0451795_0391229_322_843 169
22 3300041505 Ga0451849_0033504 Ga0451849_0033504_12_533 169
23 3300002075 JGI24738J21930_10021649 JGI24738J21930_100216492 170
24 3300002077 JGI24744J21845_10006682 JGI24744J21845_100066823 170
25 3300005329 Ga0070683_100018555 Ga0070683_1000185556 170
26 3300005337 Ga0070682_100095872 Ga0070682_1000958723 170
27 3300005339 Ga0070660_100595636 Ga0070660_1005956362 170
28 3300005340 Ga0070689_100378245 Ga0070689_1003782452 170
29 3300005345 Ga0070692_10002451 Ga0070692_100024517 170
30 3300005364 Ga0070673_100080343 Ga0070673_1000803432 170
31 3300005366 Ga0070659_100834079 Ga0070659_1008340791 170
32 3300005438 Ga0070701_10052648 Ga0070701_100526483 170
33 3300005441 Ga0070700_100003379 Ga0070700_1000033795 170
34 3300005455 Ga0070663_100313083 Ga0070663_1003130832 170
35 3300005459 Ga0068867_100014582 Ga0068867_1000145826 170
36 3300005535 Ga0070684_100376801 Ga0070684_1003768012 170
37 3300005543 Ga0070672_100033087 Ga0070672_1000330875 170
38 3300005578 Ga0068854_100020585 Ga0068854_1000205852 170
39 3300005615 Ga0070702_100000964 Ga0070702_1000009647 170
40 3300005616 Ga0068852_100019965 Ga0068852_1000199655 170
41 3300005618 Ga0068864_100195654 Ga0068864_1001956541 170
42 3300005718 Ga0068866_10014104 Ga0068866_100141043 170
43 3300005719 Ga0068861_100067595 Ga0068861_1000675953 170
44 3300005840 Ga0068870_10014806 Ga0068870_100148062 170
45 3300005844 Ga0068862_100163670 Ga0068862_1001636703 170
46 3300006178 Ga0075367_10159378 Ga0075367_101593782 170
47 3300006881 Ga0068865_100019660 Ga0068865_1000196605 170
48 3300009094 Ga0111539_10027078 Ga0111539_100270783 170
49 3300009148 Ga0105243_10016997 Ga0105243_100169975 170
50 3300009176 Ga0105242_11280695 Ga0105242_112806951 170
51 3300009177 Ga0105248_10258620 Ga0105248_102586202 170
52 3300009551 Ga0105238_10270503 Ga0105238_102705032 170
53 3300013105 Ga0157369_11033304 Ga0157369_110333042 170
54 3300013307 Ga0157372_10082136 Ga0157372_100821364 170
55 3300014325 Ga0163163_10455132 Ga0163163_104551322 170
56 3300014326 Ga0157380_10003698 Ga0157380_100036987 170
57 3300014745 Ga0157377_10013701 Ga0157377_100137013 170
58 3300025315 Ga0207697_10054517 Ga0207697_100545172 170
59 3300025901 Ga0207688_10014662 Ga0207688_100146625 170
60 3300025908 Ga0207643_10015115 Ga0207643_100151152 170
61 3300025924 Ga0207694_11287465 Ga0207694_112874651 170
62 3300025927 Ga0207687_10060852 Ga0207687_100608523 170
63 3300025935 Ga0207709_10258996 Ga0207709_102589961 170
64 3300025936 Ga0207670_10380022 Ga0207670_103800221 170
65 3300025938 Ga0207704_10016635 Ga0207704_100166355 170
66 3300025940 Ga0207691_10013080 Ga0207691_100130807 170
67 3300025941 Ga0207711_10457523 Ga0207711_104575231 170
68 3300025944 Ga0207661_10098580 Ga0207661_100985801 170
69 3300025944 Ga0207661_10243150 Ga0207661_102431501 170
70 3300025945 Ga0207679_10266021 Ga0207679_102660212 170
71 3300025960 Ga0207651_10043726 Ga0207651_100437262 170
72 3300025981 Ga0207640_10005389 Ga0207640_100053895 170
73 3300025986 Ga0207658_10601394 Ga0207658_106013942 170
74 3300026023 Ga0207677_10150037 Ga0207677_101500373 170
75 3300026067 Ga0207678_10353558 Ga0207678_103535582 170
76 3300026075 Ga0207708_10000511 Ga0207708_1000051124 170
77 3300026089 Ga0207648_10006919 Ga0207648_1000691910 170
78 3300026118 Ga0207675_100035191 Ga0207675_1000351912 170
79 3300026121 Ga0207683_10130627 Ga0207683_101306272 170
80 3300027907 Ga0207428_10962659 Ga0207428_109626591 170
81 3300028380 Ga0268265_10264151 Ga0268265_102641512 170
82 3300041498 Ga0451841_0795809 Ga0451841_0795809_23_619 170
83 3300041512 Ga0451853_3691423 Ga0451853_3691423_31_585 170
84 3300048905 Ga0496102_0336389 Ga0496102_0336389_791_1315 170
85 3300048906 Ga0496103_0403517 Ga0496103_0403517_76_597 170
86 3300048909 Ga0496106_0188057 Ga0496106_0188057_954_1475 170
87 3300048911 Ga0496108_0140104 Ga0496108_0140104_114_668 170
88 3300048913 Ga0496110_0602982 Ga0496110_0602982_274_828 170
89 3300048917 Ga0496114_0204817 Ga0496114_0204817_589_1110 170
90 3300050492 nmdc:mga0yw44_168349_c1 nmdc:mga0yw44_168349_c1_557_1078 170
91 3300050511 nmdc:mga08y16_40862_c1 nmdc:mga08y16_40862_c1_3754_4275 170
92 iso_pu_bacteria 2857481737 2857484831 170
93 iso_pu_bacteria 2929212328 2929216021 170
94 3300005564 Ga0070664_100916317 Ga0070664_1009163171 171
95 3300005616 Ga0068852_100517496 Ga0068852_1005174962 171
96 3300005719 Ga0068861_100728475 Ga0068861_1007284752 171
97 3300025945 Ga0207679_10744865 Ga0207679_107448651 171
98 3300028380 Ga0268265_10917955 Ga0268265_109179552 171
99 iso_pu_bacteria 2643221715 2644638579 172
100 iso_pu_bacteria 2939582691 2939588634 172
101 3300003579 Ga0007429J51699_1036235 Ga0007429J51699_10362352 174
102 3300005455 Ga0070663_100676855 Ga0070663_1006768551 174
103 3300005543 Ga0070672_100695932 Ga0070672_1006959321 174
104 3300005578 Ga0068854_100167195 Ga0068854_1001671952 174
105 3300006048 Ga0075363_100003564 Ga0075363_1000035644 174
106 3300006051 Ga0075364_10008722 Ga0075364_100087225 174
107 3300006177 Ga0075362_10053999 Ga0075362_100539991 174
108 3300006178 Ga0075367_10009953 Ga0075367_100099531 174
109 3300006186 Ga0075369_10073775 Ga0075369_100737753 174
110 3300006353 Ga0075370_10009971 Ga0075370_100099715 174
111 3300009098 Ga0105245_10347933 Ga0105245_103479331 174
112 3300014969 Ga0157376_11178669 Ga0157376_111786691 174
113 3300017792 Ga0163161_10268552 Ga0163161_102685522 174
114 3300025981 Ga0207640_10362321 Ga0207640_103623212 174
115 3300026067 Ga0207678_10422280 Ga0207678_104222802 174
116 3300027866 Ga0209813_10031539 Ga0209813_100315392 174
117 3300031824 Ga0307413_10016170 Ga0307413_100161705 174
118 3300031824 Ga0307413_10079659 Ga0307413_100796593 174
119 3300031852 Ga0307410_10113089 Ga0307410_101130892 174
120 3300031903 Ga0307407_10357054 Ga0307407_103570542 174
121 3300031995 Ga0307409_100269649 Ga0307409_1002696492 174
122 3300041456 Ga0451795_1138658 Ga0451795_1138658_83_625 174
123 3300044683 Ga0466965_0035072 Ga0466965_0035072_746_1273 174
124 3300044735 Ga0466968_0000850 Ga0466968_0000850_1099_1644 174
125 3300044735 Ga0466968_0148141 Ga0466968_0148141_152_676 174
126 3300044765 Ga0466970_0094832 Ga0466970_0094832_197_724 174
127 3300044842 Ga0466957_0038571 Ga0466957_0038571_2137_2682 174
128 3300044901 Ga0466960_0001129 Ga0466960_0001129_8983_9510 174
129 3300045049 Ga0466959_0036518 Ga0466959_0036518_2573_3118 174
130 3300048911 Ga0496108_0687707 Ga0496108_0687707_296_823 174
131 3300050491 nmdc:mga00v17_54678_c1 nmdc:mga00v17_54678_c1_1048_1572 174
132 3300050492 nmdc:mga0yw44_10437_c1 nmdc:mga0yw44_10437_c1_2928_3452 174
133 3300050494 nmdc:mga06z11_2830_c1 nmdc:mga06z11_2830_c1_2808_3332 174
134 3300050495 nmdc:mga04h51_6571_c1 nmdc:mga04h51_6571_c1_2038_2562 174
135 3300050496 nmdc:mga07m45_2899_c1 nmdc:mga07m45_2899_c1_3264_3788 174
136 3300050511 nmdc:mga08y16_371431_c2 nmdc:mga08y16_371431_c2_63_593 174
137 3300050516 nmdc:mga0sz30_123609_c1 nmdc:mga0sz30_123609_c1_272_796 174
138 3300053080 Ga0500635_0002000 Ga0500635_0002000_4382_4909 174
139 3300053131 Ga0500652_000943 Ga0500652_000943_1326_1853 174
140 3300059511 Ga0587091_025440 Ga0587091_025440_145_681 174
141 3300006177 Ga0075362_10331581 Ga0075362_103315812 175
142 3300009177 Ga0105248_11024578 Ga0105248_110245782 175
143 3300010375 Ga0105239_10403347 Ga0105239_104033472 175
144 3300025914 Ga0207671_10002168 Ga0207671_100021689 175
145 3300025944 Ga0207661_10485884 Ga0207661_104858842 175
146 3300041411 Ga0439466_0033545 Ga0439466_0033545_253_783 175
147 3300041413 Ga0439465_0087175 Ga0439465_0087175_84_614 175
148 3300041997 Ga0439431_0014660 Ga0439431_0014660_445_975 175
149 3300042438 Ga0439459_0001724 Ga0439459_0001724_2665_3216 175
150 3300046506 Ga0495583_0112108 Ga0495583_0112108_143_670 175
151 3300046507 Ga0495606_0136925 Ga0495606_0136925_244_771 175
152 3300046524 Ga0495648_0022048 Ga0495648_0022048_1624_2151 175
153 3300046663 Ga0495635_0092025 Ga0495635_0092025_295_846 175
154 3300047320 Ga0495672_0026778 Ga0495672_0026778_477_1004 175
155 3300047469 Ga0495673_0003829 Ga0495673_0003829_3308_3835 175
156 3300047472 Ga0495686_0000949 Ga0495686_0000949_14687_15217 175
157 3300047472 Ga0495686_0054287 Ga0495686_0054287_466_993 175
158 3300048903 Ga0496100_0000644 Ga0496100_0000644_5672_6199 175
159 3300048904 Ga0496101_0000030 Ga0496101_0000030_75135_75662 175
160 3300048905 Ga0496102_0000001 Ga0496102_0000001_600856_601383 175
161 3300048906 Ga0496103_0000003 Ga0496103_0000003_331918_332445 175
162 3300048908 Ga0496105_0270000 Ga0496105_0270000_10_537 175
163 3300048909 Ga0496106_0131366 Ga0496106_0131366_978_1505 175
164 3300048911 Ga0496108_0135947 Ga0496108_0135947_907_1434 175
165 3300048912 Ga0496109_0016455 Ga0496109_0016455_2877_3404 175
166 3300048914 Ga0496111_0293889 Ga0496111_0293889_63_590 175
167 3300048915 Ga0496112_0044504 Ga0496112_0044504_1650_2177 175
168 3300048915 Ga0496112_0248006 Ga0496112_0248006_645_1172 175
169 3300048916 Ga0496113_0181036 Ga0496113_0181036_1099_1626 175
170 3300048919 Ga0496116_0000013 Ga0496116_0000013_271549_272076 175
171 3300048920 Ga0496117_0000013 Ga0496117_0000013_331918_332445 175
172 3300048921 Ga0496118_0000011 Ga0496118_0000011_271551_272078 175
173 3300048922 Ga0496119_0000076 Ga0496119_0000076_31842_32369 175
174 3300048922 Ga0496119_0073746 Ga0496119_0073746_1357_1884 175
175 3300048923 Ga0496120_0000633 Ga0496120_0000633_76_603 175
176 3300048924 Ga0496121_0002131 Ga0496121_0002131_26596_27123 175
177 3300048929 Ga0496126_0003011 Ga0496126_0003011_17688_18215 175
178 3300050489 nmdc:mga03683_295864_c1 nmdc:mga03683_295864_c1_109_642 175
179 3300053087 Ga0500643_018512 Ga0500643_018512_1448_1975 175
180 3300053153 Ga0500616_0024554 Ga0500616_0024554_403_930 175
181 iso_pu_bacteria 2902792274 2902796727 175
182 3300001990 JGI24737J22298_10016758 JGI24737J22298_100167582 176
183 3300001991 JGI24743J22301_10037976 JGI24743J22301_100379761 176
184 3300002075 JGI24738J21930_10009036 JGI24738J21930_100090362 176
185 3300002077 JGI24744J21845_10004069 JGI24744J21845_100040693 176
186 3300002239 JGI24034J26672_10022752 JGI24034J26672_100227522 176
187 3300002244 JGI24742J22300_10002645 JGI24742J22300_100026454 176
188 3300005327 Ga0070658_10384055 Ga0070658_103840552 176
189 3300005328 Ga0070676_10002208 Ga0070676_100022082 176
190 3300005330 Ga0070690_100041926 Ga0070690_1000419262 176
191 3300005331 Ga0070670_100233726 Ga0070670_1002337262 176
192 3300005334 Ga0068869_100113739 Ga0068869_1001137393 176
193 3300005335 Ga0070666_10016677 Ga0070666_100166772 176
194 3300005338 Ga0068868_100001129 Ga0068868_10000112913 176
195 3300005338 Ga0068868_100034735 Ga0068868_1000347351 176
196 3300005338 Ga0068868_100327120 Ga0068868_1003271202 176
197 3300005340 Ga0070689_100003566 Ga0070689_1000035665 176
198 3300005340 Ga0070689_100569162 Ga0070689_1005691622 176
199 3300005341 Ga0070691_10001974 Ga0070691_100019745 176
200 3300005347 Ga0070668_100000258 Ga0070668_1000002586 176
201 3300005347 Ga0070668_100002421 Ga0070668_1000024212 176
202 3300005347 Ga0070668_100126669 Ga0070668_1001266693 176
203 3300005353 Ga0070669_100000877 Ga0070669_1000008772 176
204 3300005354 Ga0070675_100063420 Ga0070675_1000634203 176
205 3300005355 Ga0070671_100004209 Ga0070671_1000042095 176
206 3300005356 Ga0070674_100000948 Ga0070674_1000009487 176
207 3300005356 Ga0070674_100047231 Ga0070674_1000472312 176
208 3300005356 Ga0070674_101125311 Ga0070674_1011253111 176
209 3300005365 Ga0070688_100010303 Ga0070688_1000103036 176
210 3300005366 Ga0070659_100034968 Ga0070659_1000349682 176
211 3300005367 Ga0070667_100001459 Ga0070667_10000145911 176
212 3300005367 Ga0070667_100009264 Ga0070667_1000092646 176
213 3300005367 Ga0070667_100024352 Ga0070667_1000243525 176
214 3300005367 Ga0070667_100282225 Ga0070667_1002822253 176
215 3300005434 Ga0070709_10054252 Ga0070709_100542524 176
216 3300005434 Ga0070709_10221269 Ga0070709_102212692 176
217 3300005437 Ga0070710_10000098 Ga0070710_100000986 176
218 3300005438 Ga0070701_10000353 Ga0070701_1000035313 176
219 3300005439 Ga0070711_100000552 Ga0070711_10000055215 176
220 3300005441 Ga0070700_100001340 Ga0070700_1000013404 176
221 3300005444 Ga0070694_100003542 Ga0070694_1000035428 176
222 3300005445 Ga0070708_100349650 Ga0070708_1003496502 176
223 3300005455 Ga0070663_100026293 Ga0070663_1000262933 176
224 3300005455 Ga0070663_100099400 Ga0070663_1000994002 176
225 3300005456 Ga0070678_100000217 Ga0070678_1000002175 176
226 3300005456 Ga0070678_100042976 Ga0070678_1000429764 176
227 3300005456 Ga0070678_100129012 Ga0070678_1001290122 176
228 3300005456 Ga0070678_100129341 Ga0070678_1001293412 176
229 3300005456 Ga0070678_101183424 Ga0070678_1011834241 176
230 3300005457 Ga0070662_100094092 Ga0070662_1000940922 176
231 3300005459 Ga0068867_100001472 Ga0068867_1000014725 176
232 3300005459 Ga0068867_100104628 Ga0068867_1001046283 176
233 3300005466 Ga0070685_10199240 Ga0070685_101992402 176
234 3300005539 Ga0068853_100001314 Ga0068853_1000013149 176
235 3300005543 Ga0070672_100677083 Ga0070672_1006770832 176
236 3300005544 Ga0070686_100193471 Ga0070686_1001934712 176
237 3300005545 Ga0070695_100263740 Ga0070695_1002637402 176
238 3300005546 Ga0070696_100002947 Ga0070696_1000029479 176
239 3300005546 Ga0070696_100398208 Ga0070696_1003982081 176
240 3300005547 Ga0070693_100003278 Ga0070693_1000032785 176
241 3300005547 Ga0070693_100152864 Ga0070693_1001528642 176
242 3300005548 Ga0070665_100001965 Ga0070665_10000196515 176
243 3300005548 Ga0070665_100019903 Ga0070665_1000199037 176
244 3300005548 Ga0070665_100121301 Ga0070665_1001213013 176
245 3300005548 Ga0070665_100321690 Ga0070665_1003216902 176
246 3300005549 Ga0070704_100000582 Ga0070704_10000058212 176
247 3300005549 Ga0070704_100529836 Ga0070704_1005298362 176
248 3300005563 Ga0068855_100026255 Ga0068855_1000262552 176
249 3300005578 Ga0068854_100002471 Ga0068854_1000024716 176
250 3300005614 Ga0068856_100297280 Ga0068856_1002972801 176
251 3300005615 Ga0070702_100000377 Ga0070702_1000003778 176
252 3300005617 Ga0068859_100000438 Ga0068859_10000043830 176
253 3300005617 Ga0068859_100006128 Ga0068859_1000061289 176
254 3300005718 Ga0068866_10000393 Ga0068866_1000039318 176
255 3300005719 Ga0068861_100018476 Ga0068861_1000184763 176
256 3300005841 Ga0068863_100000777 Ga0068863_1000007776 176
257 3300005841 Ga0068863_100005469 Ga0068863_1000054698 176
258 3300005841 Ga0068863_100199146 Ga0068863_1001991462 176
259 3300005842 Ga0068858_100002189 Ga0068858_1000021892 176
260 3300005842 Ga0068858_100102059 Ga0068858_1001020592 176
261 3300005843 Ga0068860_100000010 Ga0068860_100000010230 176
262 3300005843 Ga0068860_100011965 Ga0068860_1000119654 176
263 3300005843 Ga0068860_100221630 Ga0068860_1002216303 176
264 3300005843 Ga0068860_100701412 Ga0068860_1007014121 176
265 3300005844 Ga0068862_100000008 Ga0068862_10000000893 176
266 3300005844 Ga0068862_100010466 Ga0068862_1000104662 176
267 3300005937 Ga0081455_10091090 Ga0081455_100910903 176
268 3300006038 Ga0075365_10002785 Ga0075365_100027856 176
269 3300006038 Ga0075365_10012403 Ga0075365_100124032 176
270 3300006038 Ga0075365_10096533 Ga0075365_100965334 176
271 3300006038 Ga0075365_10383508 Ga0075365_103835082 176
272 3300006038 Ga0075365_10621468 Ga0075365_106214682 176
273 3300006048 Ga0075363_100001994 Ga0075363_1000019944 176
274 3300006048 Ga0075363_100007850 Ga0075363_1000078502 176
275 3300006048 Ga0075363_100009826 Ga0075363_1000098264 176
276 3300006048 Ga0075363_100069726 Ga0075363_1000697263 176
277 3300006048 Ga0075363_100074579 Ga0075363_1000745792 176
278 3300006048 Ga0075363_100093865 Ga0075363_1000938651 176
279 3300006048 Ga0075363_100302053 Ga0075363_1003020532 176
280 3300006051 Ga0075364_10002788 Ga0075364_100027887 176
281 3300006051 Ga0075364_10004411 Ga0075364_100044114 176
282 3300006051 Ga0075364_10112255 Ga0075364_101122552 176
283 3300006051 Ga0075364_10139326 Ga0075364_101393262 176
284 3300006051 Ga0075364_10139726 Ga0075364_101397262 176
285 3300006163 Ga0070715_10001372 Ga0070715_100013726 176
286 3300006163 Ga0070715_10001774 Ga0070715_100017744 176
287 3300006173 Ga0070716_100307867 Ga0070716_1003078671 176
288 3300006175 Ga0070712_100001835 Ga0070712_1000018356 176
289 3300006175 Ga0070712_100002568 Ga0070712_1000025683 176
290 3300006177 Ga0075362_10070256 Ga0075362_100702562 176
291 3300006177 Ga0075362_10092930 Ga0075362_100929302 176
292 3300006178 Ga0075367_10074641 Ga0075367_100746412 176
293 3300006178 Ga0075367_10277627 Ga0075367_102776271 176
294 3300006186 Ga0075369_10000552 Ga0075369_1000055211 176
295 3300006186 Ga0075369_10021818 Ga0075369_100218183 176
296 3300006186 Ga0075369_10022081 Ga0075369_100220813 176
297 3300006186 Ga0075369_10039158 Ga0075369_100391582 176
298 3300006186 Ga0075369_10101511 Ga0075369_101015112 176
299 3300006186 Ga0075369_10222826 Ga0075369_102228262 176
300 3300006195 Ga0075366_10212028 Ga0075366_102120281 176
301 3300006353 Ga0075370_10073196 Ga0075370_100731963 176
302 3300006353 Ga0075370_10135704 Ga0075370_101357043 176
303 3300006353 Ga0075370_10314072 Ga0075370_103140722 176
304 3300006353 Ga0075370_10352185 Ga0075370_103521852 176
305 3300006844 Ga0075428_100006332 Ga0075428_1000063323 176
306 3300006846 Ga0075430_100159473 Ga0075430_1001594732 176
307 3300006847 Ga0075431_100279572 Ga0075431_1002795723 176
308 3300006881 Ga0068865_100002754 Ga0068865_1000027542 176
309 3300006881 Ga0068865_100462177 Ga0068865_1004621772 176
310 3300006931 Ga0097620_100000438 Ga0097620_10000043830 176
311 3300006931 Ga0097620_100006129 Ga0097620_1000061294 176
312 3300006931 Ga0097620_101736329 Ga0097620_1017363292 176
313 3300009094 Ga0111539_10899244 Ga0111539_108992442 176
314 3300009098 Ga0105245_10001613 Ga0105245_100016135 176
315 3300009098 Ga0105245_10047281 Ga0105245_100472812 176
316 3300009101 Ga0105247_10000019 Ga0105247_10000019162 176
317 3300009101 Ga0105247_10002822 Ga0105247_100028227 176
318 3300009147 Ga0114129_10006118 Ga0114129_1000611812 176
319 3300009148 Ga0105243_10000890 Ga0105243_100008907 176
320 3300009148 Ga0105243_10613882 Ga0105243_106138822 176
321 3300009148 Ga0105243_12245816 Ga0105243_122458161 176
322 3300009174 Ga0105241_10017808 Ga0105241_100178083 176
323 3300009176 Ga0105242_10001840 Ga0105242_1000184011 176
324 3300009176 Ga0105242_11366355 Ga0105242_113663552 176
325 3300009177 Ga0105248_10000093 Ga0105248_1000009338 176
326 3300009177 Ga0105248_10004508 Ga0105248_100045083 176
327 3300009177 Ga0105248_10250484 Ga0105248_102504842 176
328 3300009545 Ga0105237_10260318 Ga0105237_102603182 176
329 3300009551 Ga0105238_10274066 Ga0105238_102740663 176
330 3300009553 Ga0105249_10000019 Ga0105249_1000001991 176
331 3300009553 Ga0105249_10002099 Ga0105249_1000209914 176
332 3300009553 Ga0105249_10076726 Ga0105249_100767262 176
333 3300009553 Ga0105249_10703582 Ga0105249_107035822 176
334 3300010159 Ga0099796_10008233 Ga0099796_100082333 176
335 3300010375 Ga0105239_10009231 Ga0105239_100092314 176
336 3300010375 Ga0105239_10035779 Ga0105239_100357794 176
337 3300010375 Ga0105239_10199157 Ga0105239_101991572 176
338 3300011119 Ga0105246_10588178 Ga0105246_105881782 176
339 3300013102 Ga0157371_10147095 Ga0157371_101470953 176
340 3300013297 Ga0157378_10001194 Ga0157378_100011948 176
341 3300013306 Ga0163162_10001044 Ga0163162_1000104423 176
342 3300013306 Ga0163162_10264423 Ga0163162_102644232 176
343 3300013307 Ga0157372_10003021 Ga0157372_100030213 176
344 3300013308 Ga0157375_10004561 Ga0157375_1000456111 176
345 3300013308 Ga0157375_10220649 Ga0157375_102206493 176
346 3300013308 Ga0157375_11224824 Ga0157375_112248242 176
347 3300013308 Ga0157375_11834793 Ga0157375_118347932 176
348 3300014325 Ga0163163_10021502 Ga0163163_100215023 176
349 3300014325 Ga0163163_10028769 Ga0163163_100287693 176
350 3300014325 Ga0163163_10497091 Ga0163163_104970912 176
351 3300014326 Ga0157380_10001018 Ga0157380_1000101810 176
352 3300014968 Ga0157379_10002098 Ga0157379_100020989 176
353 3300014968 Ga0157379_10065148 Ga0157379_100651483 176
354 3300014969 Ga0157376_10195489 Ga0157376_101954892 176
355 3300017792 Ga0163161_10001662 Ga0163161_1000166211 176
356 3300017792 Ga0163161_10914605 Ga0163161_109146052 176
357 3300025898 Ga0207692_10001803 Ga0207692_100018032 176
358 3300025899 Ga0207642_10002785 Ga0207642_100027854 176
359 3300025900 Ga0207710_10000036 Ga0207710_1000003676 176
360 3300025900 Ga0207710_10010289 Ga0207710_100102895 176
361 3300025901 Ga0207688_10000796 Ga0207688_100007967 176
362 3300025901 Ga0207688_10003184 Ga0207688_100031842 176
363 3300025903 Ga0207680_10018124 Ga0207680_100181242 176
364 3300025903 Ga0207680_10498960 Ga0207680_104989601 176
365 3300025904 Ga0207647_10095038 Ga0207647_100950382 176
366 3300025906 Ga0207699_10238975 Ga0207699_102389752 176
367 3300025907 Ga0207645_10044577 Ga0207645_100445772 176
368 3300025908 Ga0207643_10302807 Ga0207643_103028072 176
369 3300025911 Ga0207654_10021917 Ga0207654_100219172 176
370 3300025914 Ga0207671_10079357 Ga0207671_100793572 176
371 3300025914 Ga0207671_10453722 Ga0207671_104537222 176
372 3300025915 Ga0207693_10000819 Ga0207693_100008199 176
373 3300025915 Ga0207693_10001117 Ga0207693_1000111718 176
374 3300025916 Ga0207663_10008571 Ga0207663_100085714 176
375 3300025923 Ga0207681_10002486 Ga0207681_1000248610 176
376 3300025923 Ga0207681_10075483 Ga0207681_100754832 176
377 3300025926 Ga0207659_10119294 Ga0207659_101192943 176
378 3300025927 Ga0207687_10105553 Ga0207687_101055532 176
379 3300025931 Ga0207644_10134113 Ga0207644_101341133 176
380 3300025932 Ga0207690_10091083 Ga0207690_100910832 176
381 3300025933 Ga0207706_10020531 Ga0207706_100205313 176
382 3300025933 Ga0207706_10042516 Ga0207706_100425163 176
383 3300025934 Ga0207686_10002419 Ga0207686_100024194 176
384 3300025934 Ga0207686_10353121 Ga0207686_103531212 176
385 3300025935 Ga0207709_10009475 Ga0207709_100094754 176
386 3300025935 Ga0207709_10599922 Ga0207709_105999222 176
387 3300025936 Ga0207670_10058344 Ga0207670_100583443 176
388 3300025936 Ga0207670_10083822 Ga0207670_100838222 176
389 3300025937 Ga0207669_10000708 Ga0207669_100007084 176
390 3300025937 Ga0207669_10017091 Ga0207669_100170912 176
391 3300025938 Ga0207704_10001958 Ga0207704_100019589 176
392 3300025940 Ga0207691_10080096 Ga0207691_100800961 176
393 3300025940 Ga0207691_10511810 Ga0207691_105118101 176
394 3300025941 Ga0207711_10000102 Ga0207711_1000010245 176
395 3300025941 Ga0207711_10015889 Ga0207711_100158897 176
396 3300025941 Ga0207711_10170807 Ga0207711_101708072 176
397 3300025961 Ga0207712_10000025 Ga0207712_10000025160 176
398 3300025961 Ga0207712_10003273 Ga0207712_100032738 176
399 3300025961 Ga0207712_10360018 Ga0207712_103600181 176
400 3300025972 Ga0207668_10000768 Ga0207668_1000076814 176
401 3300025972 Ga0207668_10030162 Ga0207668_100301624 176
402 3300025972 Ga0207668_10054128 Ga0207668_100541282 176
403 3300025972 Ga0207668_10121531 Ga0207668_101215313 176
404 3300025972 Ga0207668_10178183 Ga0207668_101781832 176
405 3300025981 Ga0207640_10002830 Ga0207640_100028302 176
406 3300025981 Ga0207640_10271339 Ga0207640_102713391 176
407 3300025986 Ga0207658_10000432 Ga0207658_100004329 176
408 3300025986 Ga0207658_10007719 Ga0207658_100077193 176
409 3300025986 Ga0207658_10167270 Ga0207658_101672703 176
410 3300025986 Ga0207658_10280295 Ga0207658_102802952 176
411 3300026023 Ga0207677_10004624 Ga0207677_100046245 176
412 3300026023 Ga0207677_10375821 Ga0207677_103758212 176
413 3300026035 Ga0207703_10012412 Ga0207703_100124125 176
414 3300026035 Ga0207703_10078262 Ga0207703_100782621 176
415 3300026035 Ga0207703_10239435 Ga0207703_102394353 176
416 3300026041 Ga0207639_10449357 Ga0207639_104493572 176
417 3300026067 Ga0207678_10022482 Ga0207678_100224825 176
418 3300026067 Ga0207678_10130792 Ga0207678_101307922 176
419 3300026067 Ga0207678_10593926 Ga0207678_105939262 176
420 3300026075 Ga0207708_10002118 Ga0207708_100021184 176
421 3300026078 Ga0207702_10254553 Ga0207702_102545533 176
422 3300026088 Ga0207641_10001204 Ga0207641_100012042 176
423 3300026088 Ga0207641_10044282 Ga0207641_100442822 176
424 3300026089 Ga0207648_10002201 Ga0207648_1000220111 176
425 3300026089 Ga0207648_10062697 Ga0207648_100626972 176
426 3300026095 Ga0207676_10399024 Ga0207676_103990242 176
427 3300026118 Ga0207675_100014086 Ga0207675_1000140867 176
428 3300026118 Ga0207675_100228179 Ga0207675_1002281792 176
429 3300026118 Ga0207675_100273354 Ga0207675_1002733542 176
430 3300026121 Ga0207683_10000147 Ga0207683_1000014717 176
431 3300026121 Ga0207683_10027499 Ga0207683_100274996 176
432 3300026121 Ga0207683_10450263 Ga0207683_104502632 176
433 3300026121 Ga0207683_10465305 Ga0207683_104653053 176
434 3300027866 Ga0209813_10185335 Ga0209813_101853352 176
435 3300028379 Ga0268266_10001834 Ga0268266_100018343 176
436 3300028379 Ga0268266_10085764 Ga0268266_100857642 176
437 3300028380 Ga0268265_10000007 Ga0268265_1000000791 176
438 3300028380 Ga0268265_10029576 Ga0268265_100295765 176
439 3300028380 Ga0268265_10460431 Ga0268265_104604312 176
440 3300028381 Ga0268264_10000007 Ga0268264_10000007227 176
441 3300028381 Ga0268264_10012623 Ga0268264_100126235 176
442 3300028381 Ga0268264_10236648 Ga0268264_102366483 176
443 3300028381 Ga0268264_11984097 Ga0268264_119840971 176
444 3300031901 Ga0307406_10617453 Ga0307406_106174532 176
445 3300031903 Ga0307407_10112779 Ga0307407_101127792 176
446 3300031995 Ga0307409_100709310 Ga0307409_1007093102 176
447 3300034819 Ga0373958_0075561 Ga0373958_0075561_127_681 176
448 3300035114 Ga0373939_0033847 Ga0373939_0033847_592_1122 176
449 3300035207 Ga0373942_0065562 Ga0373942_0065562_509_1039 176
450 3300035242 Ga0373962_0038631 Ga0373962_0038631_719_1273 176
451 3300035691 Ga0373931_0277598 Ga0373931_0277598_328_858 176
452 3300041410 Ga0439461_0042372 Ga0439461_0042372_184_717 176
453 3300041411 Ga0439466_0010916 Ga0439466_0010916_2292_2822 176
454 3300041411 Ga0439466_0013738 Ga0439466_0013738_1425_1958 176
455 3300041413 Ga0439465_0019254 Ga0439465_0019254_815_1345 176
456 3300041413 Ga0439465_0022046 Ga0439465_0022046_1147_1680 176
457 3300041413 Ga0439465_0034328 Ga0439465_0034328_451_984 176
458 3300041460 Ga0451802_0241162 Ga0451802_0241162_432_962 176
459 3300041460 Ga0451802_2147479 Ga0451802_2147479_67_597 176
460 3300041997 Ga0439431_0000657 Ga0439431_0000657_392_925 176
461 3300042002 Ga0439442_019150 Ga0439442_019150_275_805 176
462 3300042004 Ga0439445_0001437 Ga0439445_0001437_1441_1971 176
463 3300042435 Ga0439434_0056322 Ga0439434_0056322_296_826 176
464 3300042436 Ga0439435_0002024 Ga0439435_0002024_1943_2473 176
465 3300044658 Ga0466972_0009846 Ga0466972_0009846_3549_4079 176
466 3300044683 Ga0466965_0006071 Ga0466965_0006071_519_1058 176
467 3300044765 Ga0466970_0173174 Ga0466970_0173174_340_879 176
468 3300044842 Ga0466957_0002101 Ga0466957_0002101_340_879 176
469 3300045976 Ga0466967_1459603 Ga0466967_1459603_105_635 176
470 3300046460 Ga0495638_0001938 Ga0495638_0001938_6551_7081 176
471 3300046694 Ga0495649_0153099 Ga0495649_0153099_46_576 176
472 3300047315 Ga0495581_0181163 Ga0495581_0181163_11_541 176
473 3300047320 Ga0495672_0021675 Ga0495672_0021675_397_927 176
474 3300047472 Ga0495686_0195894 Ga0495686_0195894_431_961 176
475 3300048903 Ga0496100_0005107 Ga0496100_0005107_4917_5447 176
476 3300048903 Ga0496100_0028862 Ga0496100_0028862_1832_2362 176
477 3300048903 Ga0496100_0051476 Ga0496100_0051476_1406_1936 176
478 3300048903 Ga0496100_0078259 Ga0496100_0078259_427_957 176
479 3300048903 Ga0496100_0660719 Ga0496100_0660719_50_580 176
480 3300048903 Ga0496100_0960760 Ga0496100_0960760_45_575 176
481 3300048904 Ga0496101_0004169 Ga0496101_0004169_7227_7757 176
482 3300048904 Ga0496101_0038472 Ga0496101_0038472_756_1286 176
483 3300048905 Ga0496102_0001472 Ga0496102_0001472_15918_16448 176
484 3300048905 Ga0496102_0002025 Ga0496102_0002025_4380_4910 176
485 3300048905 Ga0496102_0076797 Ga0496102_0076797_1395_1925 176
486 3300048905 Ga0496102_0096221 Ga0496102_0096221_2145_2675 176
487 3300048905 Ga0496102_0111337 Ga0496102_0111337_1595_2125 176
488 3300048905 Ga0496102_0121401 Ga0496102_0121401_435_965 176
489 3300048905 Ga0496102_0910753 Ga0496102_0910753_132_662 176
490 3300048906 Ga0496103_0000580 Ga0496103_0000580_15910_16440 176
491 3300048906 Ga0496103_0001100 Ga0496103_0001100_2297_2827 176
492 3300048906 Ga0496103_0066369 Ga0496103_0066369_234_764 176
493 3300048906 Ga0496103_0099672 Ga0496103_0099672_559_1089 176
494 3300048907 Ga0496104_0032458 Ga0496104_0032458_1161_1691 176
495 3300048907 Ga0496104_0628494 Ga0496104_0628494_364_894 176
496 3300048908 Ga0496105_0041013 Ga0496105_0041013_1054_1584 176
497 3300048909 Ga0496106_0000487 Ga0496106_0000487_10880_11434 176
498 3300048909 Ga0496106_0005944 Ga0496106_0005944_5123_5653 176
499 3300048909 Ga0496106_0202109 Ga0496106_0202109_1027_1557 176
500 3300048910 Ga0496107_0000192 Ga0496107_0000192_9574_10128 176
501 3300048910 Ga0496107_0025930 Ga0496107_0025930_3405_3935 176
502 3300048911 Ga0496108_0013422 Ga0496108_0013422_1551_2081 176
503 3300048911 Ga0496108_0526967 Ga0496108_0526967_180_710 176
504 3300048912 Ga0496109_0023451 Ga0496109_0023451_819_1349 176
505 3300048912 Ga0496109_0192644 Ga0496109_0192644_1048_1578 176
506 3300048912 Ga0496109_1156103 Ga0496109_1156103_157_687 176
507 3300048913 Ga0496110_0189072 Ga0496110_0189072_759_1289 176
508 3300048913 Ga0496110_1335187 Ga0496110_1335187_81_611 176
509 3300048914 Ga0496111_0093382 Ga0496111_0093382_787_1317 176
510 3300048914 Ga0496111_0256207 Ga0496111_0256207_410_940 176
511 3300048915 Ga0496112_0004488 Ga0496112_0004488_2628_3158 176
512 3300048915 Ga0496112_0168117 Ga0496112_0168117_749_1279 176
513 3300048916 Ga0496113_0531805 Ga0496113_0531805_289_819 176
514 3300048917 Ga0496114_0001156 Ga0496114_0001156_2226_2756 176
515 3300048917 Ga0496114_0005375 Ga0496114_0005375_733_1287 176
516 3300048917 Ga0496114_0111383 Ga0496114_0111383_1515_2045 176
517 3300048918 Ga0496115_0003444 Ga0496115_0003444_7844_8374 176
518 3300048918 Ga0496115_0004908 Ga0496115_0004908_6331_6885 176
519 3300048919 Ga0496116_0027873 Ga0496116_0027873_936_1466 176
520 3300048920 Ga0496117_0000719 Ga0496117_0000719_43185_43715 176
521 3300048921 Ga0496118_0004910 Ga0496118_0004910_11824_12354 176
522 3300048922 Ga0496119_0005042 Ga0496119_0005042_8631_9161 176
523 3300048923 Ga0496120_0006734 Ga0496120_0006734_4743_5273 176
524 3300048924 Ga0496121_0002671 Ga0496121_0002671_5592_6122 176
525 3300048927 Ga0496124_0131630 Ga0496124_0131630_521_1051 176
526 3300048928 Ga0496125_0014881 Ga0496125_0014881_1753_2283 176
527 3300048929 Ga0496126_0006500 Ga0496126_0006500_2994_3524 176
528 3300048929 Ga0496126_0244970 Ga0496126_0244970_546_1076 176
529 3300049742 Ga0501080_0132518 Ga0501080_0132518_1358_1888 176
530 3300050489 nmdc:mga03683_108486_c1 nmdc:mga03683_108486_c1_563_1093 176
531 3300050490 nmdc:mga03n38_14617_c1 nmdc:mga03n38_14617_c1_1608_2138 176
532 3300050490 nmdc:mga03n38_146560_c1 nmdc:mga03n38_146560_c1_542_1072 176
533 3300050490 nmdc:mga03n38_23368_c1 nmdc:mga03n38_23368_c1_415_945 176
534 3300050490 nmdc:mga03n38_5501_c1 nmdc:mga03n38_5501_c1_2706_3236 176
535 3300050490 nmdc:mga03n38_9118_c1 nmdc:mga03n38_9118_c1_1319_1849 176
536 3300050491 nmdc:mga00v17_1014_c1 nmdc:mga00v17_1014_c1_321_851 176
537 3300050491 nmdc:mga00v17_13142_c1 nmdc:mga00v17_13142_c1_2812_3342 176
538 3300050491 nmdc:mga00v17_139141_c1 nmdc:mga00v17_139141_c1_17_547 176
539 3300050491 nmdc:mga00v17_172754_c1 nmdc:mga00v17_172754_c1_843_1373 176
540 3300050491 nmdc:mga00v17_219547_c1 nmdc:mga00v17_219547_c1_167_697 176
541 3300050492 nmdc:mga0yw44_188817_c2 nmdc:mga0yw44_188817_c2_48_578 176
542 3300050492 nmdc:mga0yw44_292984_c1 nmdc:mga0yw44_292984_c1_151_681 176
543 3300050492 nmdc:mga0yw44_338840_c1 nmdc:mga0yw44_338840_c1_268_813 176
544 3300050492 nmdc:mga0yw44_87864_c1 nmdc:mga0yw44_87864_c1_918_1448 176
545 3300050492 nmdc:mga0yw44_90091_c1 nmdc:mga0yw44_90091_c1_1174_1704 176
546 3300050493 nmdc:mga0k408_228036_c1 nmdc:mga0k408_228036_c1_104_634 176
547 3300050494 nmdc:mga06z11_52954_c1 nmdc:mga06z11_52954_c1_838_1368 176
548 3300050494 nmdc:mga06z11_5942_c1 nmdc:mga06z11_5942_c1_4020_4550 176
549 3300050495 nmdc:mga04h51_213040_c1 nmdc:mga04h51_213040_c1_101_631 176
550 3300050495 nmdc:mga04h51_93534_c1 nmdc:mga04h51_93534_c1_120_650 176
551 3300050496 nmdc:mga07m45_40092_c1 nmdc:mga07m45_40092_c1_736_1266 176
552 3300050496 nmdc:mga07m45_47937_c1 nmdc:mga07m45_47937_c1_1099_1629 176
553 3300050496 nmdc:mga07m45_68525_c1 nmdc:mga07m45_68525_c1_938_1468 176
554 3300050507 nmdc:mga05p37_14576_c1 nmdc:mga05p37_14576_c1_1222_1752 176
555 3300050509 nmdc:mga0qj67_108194_c1 nmdc:mga0qj67_108194_c1_1299_1829 176
556 3300050510 nmdc:mga06r32_182405_c1 nmdc:mga06r32_182405_c1_996_1526 176
557 3300050516 nmdc:mga0sz30_21568_c1 nmdc:mga0sz30_21568_c1_1160_1690 176
558 3300050516 nmdc:mga0sz30_3967_c1 nmdc:mga0sz30_3967_c1_4627_5157 176
559 3300050516 nmdc:mga0sz30_4801_c1 nmdc:mga0sz30_4801_c1_944_1474 176
560 3300050516 nmdc:mga0sz30_72170_c1 nmdc:mga0sz30_72170_c1_504_1034 176
561 3300053079 Ga0500610_0029892 Ga0500610_0029892_1106_1636 176
562 3300053088 Ga0500644_0161142 Ga0500644_0161142_46_576 176
563 3300053090 Ga0500646_0130196 Ga0500646_0130196_119_649 176
564 3300053104 Ga0500556_0008394 Ga0500556_0008394_693_1223 176
565 3300053104 Ga0500556_0098780 Ga0500556_0098780_102_632 176
566 3300053108 Ga0500562_011945 Ga0500562_011945_1252_1782 176
567 3300053158 Ga0500627_0098479 Ga0500627_0098479_169_699 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

108

187

0.97

PF14539

DUF4442

Domain of unknown function (DUF4442)

76

195

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.9499 62 175
4zrb-assembly2.cif.gz_G crystal structure of hypothetical thioesterase protein sp_1851 with coenzyme a from streptococcus pneumoniae tigr4 0.9458 62 175
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9415 54 172
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9389 53 174
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9382 52 176
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9387 56 173 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9352 52 172 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9349 62 176 3.10.129.10
3lw3B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9343 62 174 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9299 54 176 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A401Y420-F1-model_v4 Thioesterase domain-containing protein 0.9934 63 176 GO:0047617
AF-A0A2A7NX81-F1-model_v4 PaaI family thioesterase 0.9914 37 176 GO:0047617
AF-A0A522T373-F1-model_v4 PaaI family thioesterase 0.9866 37 175 GO:0005829
GO:0061522
AF-A0A7Y1TWN8-F1-model_v4 PaaI family thioesterase 0.986 37 175 GO:0047617
AF-A0A430BAR7-F1-model_v4 Thioesterase 0.9857 63 176 GO:0005829
GO:0061522

Feature Viewer

pLDDT pTM Quality
91.9 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map