F464487

General Info

Members Datasets Scaffolds Average Seq Length
567 212 1134 119

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100167184|Ga0070708_1001671843
Length 117
Sequence MPREPSRVELLQGTLDLLILRTLRCGPTHGHAIAKHIQQTSEDLLQVETGSLYPALHRLEAKGWIEASWRLSERGKRARYYRLTAPGRKQFNTEQSKWRAFSRAVGLILSPPDEEAP

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.23
Rhizosphere 97.35
Stem 0
Stem Tuber 0
Unclassified 24.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100167184 3300005445 Unclassified 2052
2 Ga0070658_10067012 3300005327 Bacteria 2933
3 Ga0070676_10087912 3300005328 Bacteria 1898
4 Ga0070683_100066640 3300005329 Bacteria 3354
5 Ga0070683_100529735 3300005329 Bacteria 1126
6 Ga0070683_100560441 3300005329 Bacteria 1092
7 Ga0070683_100781237 3300005329 Unclassified 915
8 Ga0070680_100017799 3300005336 Bacteria 5605
9 Ga0070680_100119480 3300005336 Bacteria 2199
10 Ga0070680_100176832 3300005336 Unclassified 1797
11 Ga0070680_100998534 3300005336 Bacteria 723
12 Ga0070682_100706184 3300005337 Unclassified 809
13 Ga0070660_100018607 3300005339 Bacteria 5079
14 Ga0070689_100039620 3300005340 Bacteria 3609
15 Ga0070689_100449577 3300005340 Bacteria 1096
16 Ga0070691_10146824 3300005341 Bacteria 1206
17 Ga0070691_10485489 3300005341 Bacteria 711
18 Ga0070661_100036379 3300005344 Bacteria 3578
19 Ga0070661_100618384 3300005344 Bacteria 877
20 Ga0070661_100962189 3300005344 Unclassified 707
21 Ga0070661_101052502 3300005344 Bacteria 677
22 Ga0070668_100061484 3300005347 Bacteria 2910
23 Ga0070669_100302424 3300005353 Bacteria 1287
24 Ga0070675_101059636 3300005354 Bacteria 745
25 Ga0070671_100322845 3300005355 Bacteria 1316
26 Ga0070674_100154683 3300005356 Bacteria 1734
27 Ga0070673_100923071 3300005364 Bacteria 810
28 Ga0070659_100636179 3300005366 Bacteria 919
29 Ga0070667_100166315 3300005367 Bacteria 1945
30 Ga0070667_100181549 3300005367 Bacteria 1861
31 Ga0070709_10012596 3300005434 Bacteria 4736
32 Ga0070709_10053943 3300005434 Bacteria 2532
33 Ga0070709_10095868 3300005434 Bacteria 1966
34 Ga0070709_10155033 3300005434 Bacteria 1587
35 Ga0070709_10222683 3300005434 Unclassified 1346
36 Ga0070709_10240706 3300005434 Bacteria 1299
37 Ga0070709_10846760 3300005434 Bacteria 720
38 Ga0070714_100015171 3300005435 Bacteria 6196
39 Ga0070714_100032910 3300005435 Bacteria 4331
40 Ga0070714_100063672 3300005435 Bacteria 3172
41 Ga0070714_100124316 3300005435 Unclassified 2298
42 Ga0070714_100166106 3300005435 Bacteria 2000
43 Ga0070714_100361803 3300005435 Bacteria 1364
44 Ga0070714_100448004 3300005435 Unclassified 1226
45 Ga0070713_100117378 3300005436 Unclassified 2328
46 Ga0070713_100157390 3300005436 Bacteria 2026
47 Ga0070713_100244306 3300005436 Bacteria 1635
48 Ga0070713_100270032 3300005436 Unclassified 1557
49 Ga0070710_10056138 3300005437 Bacteria 2227
50 Ga0070710_10059886 3300005437 Unclassified 2164
51 Ga0070710_10376637 3300005437 Bacteria 946
52 Ga0070710_10380118 3300005437 Unclassified 942
53 Ga0070711_100301098 3300005439 Unclassified 1275
54 Ga0070711_100681989 3300005439 Unclassified 864
55 Ga0070711_101885628 3300005439 Unclassified 525
56 Ga0070663_100384448 3300005455 Bacteria 1144
57 Ga0070681_10005927 3300005458 Bacteria 11828
58 Ga0070681_10007968 3300005458 Bacteria 10369
59 Ga0070681_10038689 3300005458 Bacteria 4781
60 Ga0070681_10069195 3300005458 Bacteria 3496
61 Ga0070681_10077703 3300005458 Unclassified 3277
62 Ga0070681_10194701 3300005458 Unclassified 1946
63 Ga0070681_10342482 3300005458 Bacteria 1405
64 Ga0070681_10540857 3300005458 Bacteria 1078
65 Ga0070681_11104894 3300005458 Bacteria 714
66 Ga0068867_100982048 3300005459 Bacteria 765
67 Ga0070685_11004225 3300005466 Bacteria 626
68 Ga0070706_100096079 3300005467 Bacteria 2751
69 Ga0070706_100621898 3300005467 Unclassified 1003
70 Ga0070707_100016548 3300005468 Bacteria 6921
71 Ga0070679_100037194 3300005530 Bacteria 4834
72 Ga0070679_100164490 3300005530 Bacteria 2193
73 Ga0070679_100224803 3300005530 Bacteria 1837
74 Ga0070679_100299829 3300005530 Bacteria 1558
75 Ga0070679_100412798 3300005530 Bacteria 1295
76 Ga0070679_100473969 3300005530 Bacteria 1196
77 Ga0070684_100029567 3300005535 Bacteria 4645
78 Ga0070684_100102731 3300005535 Bacteria 2556
79 Ga0070684_100135212 3300005535 Bacteria 2226
80 Ga0070684_100188348 3300005535 Bacteria 1877
81 Ga0070684_100874399 3300005535 Bacteria 842
82 Ga0070697_100001015 3300005536 Bacteria 21202
83 Ga0068853_100006468 3300005539 Bacteria 9312
84 Ga0068853_100263517 3300005539 Bacteria 1585
85 Ga0068853_100714348 3300005539 Bacteria 956
86 Ga0068853_100926870 3300005539 Bacteria 837
87 Ga0070672_100676602 3300005543 Bacteria 902
88 Ga0070686_100713932 3300005544 Bacteria 801
89 Ga0070695_100537493 3300005545 Unclassified 909
90 Ga0070693_100024607 3300005547 Unclassified 3230
91 Ga0070693_100040162 3300005547 Bacteria 2625
92 Ga0070693_100149540 3300005547 Bacteria 1478
93 Ga0070665_101610422 3300005548 Bacteria 657
94 Ga0068855_100018331 3300005563 Bacteria 8409
95 Ga0068855_100050252 3300005563 Bacteria 4915
96 Ga0068855_100221322 3300005563 Unclassified 2122
97 Ga0068855_100635300 3300005563 Bacteria 1148
98 Ga0068855_100669111 3300005563 Unclassified 1113
99 Ga0068855_102499152 3300005563 Bacteria 514
100 Ga0070664_100329128 3300005564 Unclassified 1386
101 Ga0070664_100536212 3300005564 Bacteria 1081
102 Ga0070664_101083943 3300005564 Bacteria 754
103 Ga0068857_100024516 3300005577 Bacteria 5311
104 Ga0068857_100422997 3300005577 Unclassified 1242
105 Ga0068854_100123475 3300005578 Bacteria 1969
106 Ga0068856_100016775 3300005614 Bacteria 7096
107 Ga0068856_100085264 3300005614 Unclassified 3138
108 Ga0068856_100133369 3300005614 Bacteria 2489
109 Ga0068856_100338376 3300005614 Unclassified 1523
110 Ga0068856_100378423 3300005614 Unclassified 1435
111 Ga0068856_100688359 3300005614 Bacteria 1043
112 Ga0068856_100717868 3300005614 Bacteria 1020
113 Ga0068856_101189161 3300005614 Bacteria 779
114 Ga0068856_101551013 3300005614 Bacteria 676
115 Ga0068856_101964540 3300005614 Bacteria 596
116 Ga0068852_100207367 3300005616 Bacteria 1857
117 Ga0068852_100689366 3300005616 Bacteria 1031
118 Ga0068852_101878745 3300005616 Unclassified 621
119 Ga0068852_102776299 3300005616 Unclassified 508
120 Ga0068859_100912007 3300005617 Unclassified 963
121 Ga0068864_100026417 3300005618 Bacteria 4898
122 Ga0068851_10260032 3300005834 Bacteria 987
123 Ga0068863_100256831 3300005841 Bacteria 1689
124 Ga0068863_100455520 3300005841 Bacteria 1256
125 Ga0068858_100434574 3300005842 Bacteria 1263
126 Ga0068858_101013339 3300005842 Bacteria 814
127 Ga0070717_10015276 3300006028 Bacteria 5926
128 Ga0070717_10364720 3300006028 Bacteria 1294
129 Ga0070716_100483391 3300006173 Bacteria 910
130 Ga0070712_100145504 3300006175 Unclassified 1813
131 Ga0070712_100175771 3300006175 Bacteria 1665
132 Ga0070712_100691757 3300006175 Unclassified 869
133 Ga0070712_101454065 3300006175 Unclassified 599
134 Ga0068871_100602902 3300006358 Bacteria 999
135 Ga0075436_100004411 3300006914 Bacteria 9665
136 Ga0075436_100005381 3300006914 Bacteria 8810
137 Ga0075436_100006569 3300006914 Bacteria 7964
138 Ga0075436_100368470 3300006914 Bacteria 1037
139 Ga0097620_100912105 3300006931 Unclassified 963
140 Ga0105240_10043404 3300009093 Bacteria 5721
141 Ga0105240_10077184 3300009093 Bacteria 4105
142 Ga0105240_10251958 3300009093 Bacteria 2041
143 Ga0105240_10465226 3300009093 Bacteria 1412
144 Ga0105240_10787438 3300009093 Unclassified 1031
145 Ga0105240_11709380 3300009093 Bacteria 657
146 Ga0105245_10071038 3300009098 Bacteria 3160
147 Ga0105245_10219551 3300009098 Bacteria 1834
148 Ga0105245_10239239 3300009098 Bacteria 1759
149 Ga0105247_10174698 3300009101 Bacteria 1430
150 Ga0105247_10278634 3300009101 Bacteria 1153
151 Ga0105243_11196585 3300009148 Bacteria 773
152 Ga0105241_10243644 3300009174 Bacteria 1521
153 Ga0105241_10402524 3300009174 Bacteria 1201
154 Ga0105241_10782570 3300009174 Bacteria 877
155 Ga0105241_12283619 3300009174 Unclassified 538
156 Ga0105242_10144243 3300009176 Bacteria 2069
157 Ga0105242_10149711 3300009176 Bacteria 2034
158 Ga0105248_10352123 3300009177 Bacteria 1658
159 Ga0105237_10397682 3300009545 Bacteria 1382
160 Ga0105237_10403404 3300009545 Unclassified 1372
161 Ga0105237_10427206 3300009545 Bacteria 1331
162 Ga0105238_10016372 3300009551 Bacteria 7504
163 Ga0105238_10057079 3300009551 Bacteria 3915
164 Ga0105238_10066030 3300009551 Bacteria 3619
165 Ga0105238_10095866 3300009551 Bacteria 2953
166 Ga0105238_10514825 3300009551 Bacteria 1199
167 Ga0105238_12877192 3300009551 Bacteria 517
168 Ga0105249_10585434 3300009553 Bacteria 1169
169 Ga0105239_11681402 3300010375 Unclassified 735
170 Ga0157373_10026271 3300013100 Bacteria 4208
171 Ga0157373_10671552 3300013100 Unclassified 758
172 Ga0157373_10691772 3300013100 Bacteria 747
173 Ga0157371_11117141 3300013102 Unclassified 605
174 Ga0157370_10036708 3300013104 Unclassified 4754
175 Ga0157370_10071912 3300013104 Bacteria 3263
176 Ga0157370_10412731 3300013104 Bacteria 1242
177 Ga0157370_10416432 3300013104 Bacteria 1236
178 Ga0157370_10652097 3300013104 Unclassified 962
179 Ga0157369_10004951 3300013105 Bacteria 15605
180 Ga0157369_10047732 3300013105 Unclassified 4647
181 Ga0157369_10099195 3300013105 Bacteria 3106
182 Ga0157369_10180769 3300013105 Bacteria 2219
183 Ga0157369_10218065 3300013105 Bacteria 1998
184 Ga0157369_10343262 3300013105 Bacteria 1551
185 Ga0157369_10695616 3300013105 Bacteria 1047
186 Ga0157369_10721073 3300013105 Bacteria 1026
187 Ga0157369_10781747 3300013105 Bacteria 981
188 Ga0157369_12251789 3300013105 Unclassified 552
189 Ga0157374_10410721 3300013296 Bacteria 1351
190 Ga0157374_10630688 3300013296 Unclassified 1083
191 Ga0157378_10754745 3300013297 Bacteria 996
192 Ga0157378_11591689 3300013297 Bacteria 699
193 Ga0157378_12994409 3300013297 Bacteria 524
194 Ga0163162_10579989 3300013306 Bacteria 1248
195 Ga0157372_10046473 3300013307 Unclassified 4820
196 Ga0157372_10055232 3300013307 Bacteria 4434
197 Ga0157372_10062634 3300013307 Bacteria 4168
198 Ga0157372_10087472 3300013307 Bacteria 3536
199 Ga0157372_10093790 3300013307 Bacteria 3417
200 Ga0157372_10097154 3300013307 Bacteria 3358
201 Ga0157372_10098040 3300013307 Bacteria 3344
202 Ga0157372_10264890 3300013307 Bacteria 1996
203 Ga0157372_10659477 3300013307 Bacteria 1218
204 Ga0157372_11482669 3300013307 Bacteria 782
205 Ga0157372_12328147 3300013307 Bacteria 615
206 Ga0157375_10152070 3300013308 Bacteria 2451
207 Ga0163163_10236977 3300014325 Bacteria 1874
208 Ga0157376_10325699 3300014969 Unclassified 1462
209 Ga0157376_11176109 3300014969 Bacteria 794
210 Ga0206356_11843739 3300020070 Bacteria 990
211 Ga0213876_10022096 3300021384 Bacteria 3365
212 Ga0213876_10105684 3300021384 Bacteria 1494
213 Ga0213876_10456526 3300021384 Unclassified 680
214 Ga0207692_10166244 3300025898 Bacteria 1275
215 Ga0207699_10021694 3300025906 Bacteria 3467
216 Ga0207699_10026936 3300025906 Bacteria 3176
217 Ga0207699_10135887 3300025906 Bacteria 1610
218 Ga0207699_10171698 3300025906 Bacteria 1451
219 Ga0207699_10188103 3300025906 Bacteria 1392
220 Ga0207699_10219718 3300025906 Bacteria 1296
221 Ga0207645_10042698 3300025907 Bacteria 2901
222 Ga0207645_10298945 3300025907 Bacteria 1071
223 Ga0207705_10352274 3300025909 Bacteria 1134
224 Ga0207705_10872156 3300025909 Bacteria 698
225 Ga0207684_10028632 3300025910 Bacteria 4747
226 Ga0207684_10821062 3300025910 Bacteria 785
227 Ga0207684_11113540 3300025910 Unclassified 657
228 Ga0207654_10196530 3300025911 Unclassified 1325
229 Ga0207654_10634984 3300025911 Bacteria 764
230 Ga0207654_11054262 3300025911 Bacteria 592
231 Ga0207707_10002608 3300025912 Bacteria 16140
232 Ga0207707_10005351 3300025912 Bacteria 11214
233 Ga0207707_10006090 3300025912 Bacteria 10554
234 Ga0207707_10145294 3300025912 Bacteria 2073
235 Ga0207707_10228517 3300025912 Bacteria 1619
236 Ga0207707_10841664 3300025912 Bacteria 762
237 Ga0207707_11037731 3300025912 Unclassified 671
238 Ga0207695_10006711 3300025913 Bacteria 14854
239 Ga0207695_10028286 3300025913 Bacteria 6222
240 Ga0207695_10054798 3300025913 Bacteria 4161
241 Ga0207695_10303812 3300025913 Bacteria 1487
242 Ga0207671_10274844 3300025914 Unclassified 1328
243 Ga0207671_10608432 3300025914 Bacteria 871
244 Ga0207693_10031675 3300025915 Bacteria 4178
245 Ga0207693_10045866 3300025915 Bacteria 3434
246 Ga0207693_10061151 3300025915 Bacteria 2950
247 Ga0207663_10013977 3300025916 Unclassified 4381
248 Ga0207663_10244240 3300025916 Unclassified 1318
249 Ga0207660_10020154 3300025917 Bacteria 4472
250 Ga0207660_10296689 3300025917 Bacteria 1286
251 Ga0207660_10364121 3300025917 Bacteria 1160
252 Ga0207660_10385116 3300025917 Unclassified 1128
253 Ga0207660_11029327 3300025917 Bacteria 671
254 Ga0207649_10395027 3300025920 Bacteria 1034
255 Ga0207649_10950918 3300025920 Unclassified 675
256 Ga0207652_10028372 3300025921 Bacteria 4670
257 Ga0207652_10069474 3300025921 Bacteria 3058
258 Ga0207652_10100654 3300025921 Bacteria 2551
259 Ga0207652_10246523 3300025921 Bacteria 1611
260 Ga0207652_10261129 3300025921 Bacteria 1562
261 Ga0207652_10590419 3300025921 Bacteria 997
262 Ga0207646_10050953 3300025922 Bacteria 3705
263 Ga0207681_10367705 3300025923 Bacteria 1155
264 Ga0207694_10139575 3300025924 Bacteria 1948
265 Ga0207694_10228601 3300025924 Bacteria 1519
266 Ga0207694_10562445 3300025924 Bacteria 958
267 Ga0207694_10776350 3300025924 Bacteria 809
268 Ga0207694_11787533 3300025924 Bacteria 517
269 Ga0207659_10441032 3300025926 Bacteria 1095
270 Ga0207659_11418157 3300025926 Bacteria 595
271 Ga0207687_10658568 3300025927 Bacteria 886
272 Ga0207700_10039649 3300025928 Unclassified 3431
273 Ga0207700_10054631 3300025928 Bacteria 2999
274 Ga0207700_10232184 3300025928 Bacteria 1569
275 Ga0207700_10291631 3300025928 Unclassified 1406
276 Ga0207700_11649102 3300025928 Unclassified 566
277 Ga0207664_10022781 3300025929 Bacteria 4684
278 Ga0207664_10044943 3300025929 Bacteria 3461
279 Ga0207664_10207876 3300025929 Unclassified 1692
280 Ga0207664_10254892 3300025929 Bacteria 1532
281 Ga0207664_10266150 3300025929 Unclassified 1500
282 Ga0207644_10299864 3300025931 Bacteria 1295
283 Ga0207690_10237645 3300025932 Bacteria 1402
284 Ga0207686_10019530 3300025934 Bacteria 3857
285 Ga0207686_10235161 3300025934 Unclassified 1331
286 Ga0207670_10380155 3300025936 Bacteria 1125
287 Ga0207669_10767021 3300025937 Bacteria 798
288 Ga0207704_11054132 3300025938 Bacteria 689
289 Ga0207711_10754941 3300025941 Unclassified 907
290 Ga0207711_10834041 3300025941 Unclassified 858
291 Ga0207661_10013356 3300025944 Bacteria 5999
292 Ga0207661_10071127 3300025944 Bacteria 2842
293 Ga0207661_10102404 3300025944 Unclassified 2407
294 Ga0207661_10149544 3300025944 Unclassified 2017
295 Ga0207661_10752506 3300025944 Bacteria 897
296 Ga0207661_11356339 3300025944 Bacteria 653
297 Ga0207679_10672610 3300025945 Unclassified 938
298 Ga0207679_10696982 3300025945 Unclassified 921
299 Ga0207679_11348696 3300025945 Unclassified 654
300 Ga0207667_10030773 3300025949 Bacteria 5801
301 Ga0207667_10160674 3300025949 Unclassified 2311
302 Ga0207667_10192657 3300025949 Bacteria 2092
303 Ga0207667_10197043 3300025949 Bacteria 2066
304 Ga0207667_11949465 3300025949 Unclassified 548
305 Ga0207651_11275899 3300025960 Bacteria 660
306 Ga0207640_10180252 3300025981 Bacteria 1583
307 Ga0207640_10360458 3300025981 Bacteria 1171
308 Ga0207658_10860238 3300025986 Bacteria 825
309 Ga0207658_11264594 3300025986 Bacteria 675
310 Ga0207677_10219172 3300026023 Bacteria 1525
311 Ga0207703_10557884 3300026035 Bacteria 1080
312 Ga0207639_10089856 3300026041 Bacteria 2455
313 Ga0207639_10794089 3300026041 Bacteria 882
314 Ga0207678_10269501 3300026067 Bacteria 1460
315 Ga0207702_10016057 3300026078 Bacteria 6199
316 Ga0207702_10105487 3300026078 Bacteria 2496
317 Ga0207702_10210532 3300026078 Unclassified 1807
318 Ga0207702_10282088 3300026078 Bacteria 1571
319 Ga0207702_10453811 3300026078 Unclassified 1244
320 Ga0207702_10803559 3300026078 Bacteria 930
321 Ga0207702_10938538 3300026078 Bacteria 858
322 Ga0207702_11071786 3300026078 Bacteria 800
323 Ga0207702_11091681 3300026078 Unclassified 792
324 Ga0207702_11618926 3300026078 Bacteria 641
325 Ga0207641_10622717 3300026088 Bacteria 1058
326 Ga0207648_10204982 3300026089 Bacteria 1750
327 Ga0207674_10022356 3300026116 Bacteria 6791
328 Ga0207674_11211697 3300026116 Unclassified 724
329 Ga0207698_11098405 3300026142 Unclassified 808
330 Ga0307407_10208886 3300031903 Bacteria 1313
331 Ga0373958_0055687 3300034819 Bacteria 845
332 Ga0373926_0245938 3300035083 Unclassified 693
333 Ga0373926_0302530 3300035083 Unclassified 624
334 Ga0373934_0001464 3300035086 Bacteria 8640
335 Ga0373934_0002788 3300035086 Bacteria 6405
336 Ga0373934_0066177 3300035086 Unclassified 1443
337 Ga0373944_0007827 3300035089 Bacteria 2874
338 Ga0373944_0011446 3300035089 Bacteria 2431
339 Ga0373944_0236605 3300035089 Unclassified 671
340 Ga0373944_0364609 3300035089 Bacteria 552
341 Ga0373951_0250163 3300035091 Unclassified 532
342 Ga0373923_0171207 3300035111 Bacteria 994
343 Ga0373936_0012347 3300035113 Unclassified 3249
344 Ga0373941_0159858 3300035115 Unclassified 832
345 Ga0373941_0178288 3300035115 Bacteria 796
346 Ga0373945_0110897 3300035116 Bacteria 1082
347 Ga0373945_0127350 3300035116 Bacteria 1018
348 Ga0373954_0011239 3300035118 Bacteria 3964
349 Ga0373954_0062209 3300035118 Unclassified 1763
350 Ga0373954_0118990 3300035118 Bacteria 1281
351 Ga0373956_0000649 3300035119 Bacteria 14286
352 Ga0373956_0048510 3300035119 Unclassified 1902
353 Ga0373956_0193951 3300035119 Bacteria 962
354 Ga0373957_0010314 3300035120 Bacteria 3084
355 Ga0373957_0074179 3300035120 Bacteria 1335
356 Ga0373943_0002038 3300035170 Bacteria 9167
357 Ga0373943_0002839 3300035170 Bacteria 7870
358 Ga0373943_0835929 3300035170 Unclassified 549
359 Ga0373946_0019998 3300035171 Bacteria 2584
360 Ga0373955_0001868 3300035172 Bacteria 9065
361 Ga0373955_0007584 3300035172 Bacteria 4995
362 Ga0373931_0137613 3300035691 Unclassified 1411
363 Ga0373931_0324442 3300035691 Bacteria 957
364 Ga0373935_0014905 3300035692 Bacteria 4694
365 Ga0373935_0025550 3300035692 Bacteria 3639
366 Ga0373935_0142884 3300035692 Unclassified 1618
367 Ga0373935_0563858 3300035692 Unclassified 831
368 Ga0373935_1044755 3300035692 Unclassified 607
369 Ga0373927_0004220 3300035695 Bacteria 10089
370 Ga0373927_0035379 3300035695 Bacteria 3247
371 Ga0373927_0219391 3300035695 Unclassified 1249
372 Ga0373933_0000070 3300035724 Bacteria 62610
373 Ga0373933_0630545 3300035724 Unclassified 704
374 Ga0373933_0715901 3300035724 Unclassified 658
375 Ga0373947_0000184 3300035725 Bacteria 34389
376 Ga0373947_0000566 3300035725 Bacteria 21563
377 Ga0373947_0116716 3300035725 Bacteria 1693
378 Ga0373937_0000153 3300036401 Bacteria 66867
379 Ga0373937_0002683 3300036401 Bacteria 14844
380 Ga0373937_0008461 3300036401 Bacteria 8943
381 Ga0373937_0511616 3300036401 Unclassified 1141
382 Ga0373925_0000532 3300037068 Bacteria 37813
383 Ga0373925_0003918 3300037068 Bacteria 11364
384 Ga0373925_0146381 3300037068 Bacteria 1852
385 Ga0373925_0533258 3300037068 Bacteria 965
386 Ga0436365_0371588 3300039437 Bacteria 1468
387 Ga0436365_0417655 3300039437 Bacteria 938
388 Ga0436365_0775268 3300039437 Bacteria 3206
389 Ga0436365_1658826 3300039437 Bacteria 2638
390 Ga0436365_1865895 3300039437 Bacteria 3353
391 Ga0466961_0800257 3300044693 Unclassified 563
392 Ga0466957_0148730 3300044842 Bacteria 1513
393 Ga0466957_0981338 3300044842 Bacteria 606
394 Ga0466959_0011884 3300045049 Bacteria 6272
395 Ga0451576_0438858 3300045051 Bacteria 1370
396 Ga0451576_0659609 3300045051 Bacteria 1099
397 Ga0466958_0281567 3300045836 Bacteria 1066
398 Ga0466958_0626869 3300045836 Bacteria 700
399 Ga0495592_0008083 3300046454 Bacteria 7899
400 Ga0495603_0039720 3300046455 Bacteria 2818
401 Ga0495629_0023076 3300046459 Bacteria 4434
402 Ga0495629_0036059 3300046459 Bacteria 3493
403 Ga0495629_0082383 3300046459 Bacteria 2245
404 Ga0495629_0232646 3300046459 Bacteria 1270
405 Ga0495629_0457189 3300046459 Unclassified 864
406 Ga0495629_0700116 3300046459 Unclassified 673
407 Ga0495651_0000554 3300046462 Bacteria 28830
408 Ga0495651_0024644 3300046462 Bacteria 4680
409 Ga0495651_0032988 3300046462 Bacteria 4039
410 Ga0495651_0039572 3300046462 Bacteria 3670
411 Ga0495651_0077138 3300046462 Unclassified 2523
412 Ga0495653_0000160 3300046463 Bacteria 55860
413 Ga0495653_0008288 3300046463 Bacteria 8522
414 Ga0495580_0000636 3300046472 Bacteria 29752
415 Ga0495580_0075935 3300046472 Unclassified 2344
416 Ga0495580_0080169 3300046472 Bacteria 2276
417 Ga0495582_0001686 3300046473 Bacteria 12471
418 Ga0495582_0004177 3300046473 Bacteria 8119
419 Ga0495582_0007752 3300046473 Bacteria 5936
420 Ga0495582_0545789 3300046473 Bacteria 670
421 Ga0495582_0813878 3300046473 Unclassified 540
422 Ga0495639_0000243 3300046475 Bacteria 27102
423 Ga0495639_0013787 3300046475 Bacteria 3495
424 Ga0495664_0054906 3300046477 Bacteria 2369
425 Ga0495664_0127809 3300046477 Unclassified 1538
426 Ga0495664_0502907 3300046477 Bacteria 724
427 Ga0495585_0284689 3300046492 Bacteria 816
428 Ga0495594_0002174 3300046499 Bacteria 10203
429 Ga0495594_0003773 3300046499 Bacteria 7773
430 Ga0495594_0104246 3300046499 Unclassified 1597
431 Ga0495594_0408672 3300046499 Bacteria 772
432 Ga0495608_0015544 3300046511 Bacteria 5276
433 Ga0495608_0083033 3300046511 Bacteria 2080
434 Ga0495608_0122175 3300046511 Unclassified 1669
435 Ga0495608_0128381 3300046511 Unclassified 1623
436 Ga0495608_0688370 3300046511 Unclassified 609
437 Ga0495618_0003790 3300046514 Bacteria 9362
438 Ga0495618_0157139 3300046514 Unclassified 1451
439 Ga0495628_0004881 3300046516 Bacteria 11805
440 Ga0495628_0109544 3300046516 Unclassified 2125
441 Ga0495628_0165453 3300046516 Bacteria 1679
442 Ga0495630_0001567 3300046517 Bacteria 15898
443 Ga0495630_0004421 3300046517 Bacteria 9869
444 Ga0495630_0439748 3300046517 Bacteria 999
445 Ga0495666_0217362 3300046526 Bacteria 876
446 Ga0495666_0261154 3300046526 Bacteria 788
447 Ga0495652_0001424 3300046529 Bacteria 26545
448 Ga0495652_0006004 3300046529 Bacteria 11359
449 Ga0495652_0054390 3300046529 Bacteria 3409
450 Ga0495652_0575973 3300046529 Unclassified 771
451 Ga0495652_0868233 3300046529 Unclassified 597
452 Ga0495665_0000033 3300046531 Bacteria 53617
453 Ga0495665_0186367 3300046531 Bacteria 1077
454 Ga0495586_0012835 3300046535 Bacteria 4441
455 Ga0495586_0072487 3300046535 Bacteria 1883
456 Ga0495586_0074719 3300046535 Unclassified 1855
457 Ga0495586_0377488 3300046535 Unclassified 815
458 Ga0495587_0000193 3300046536 Bacteria 45053
459 Ga0495587_0002182 3300046536 Bacteria 13099
460 Ga0495587_0005272 3300046536 Bacteria 8448
461 Ga0495587_0096622 3300046536 Bacteria 1704
462 Ga0495645_0000129 3300046543 Bacteria 51343
463 Ga0495645_0001420 3300046543 Bacteria 16132
464 Ga0495645_0001470 3300046543 Bacteria 15935
465 Ga0495645_0043556 3300046543 Bacteria 3274
466 Ga0495645_0261971 3300046543 Bacteria 1144
467 Ga0495645_0321708 3300046543 Bacteria 1004
468 Ga0495622_0359545 3300046557 Unclassified 630
469 Ga0495667_0000116 3300046559 Bacteria 57861
470 Ga0495667_0002264 3300046559 Bacteria 12882
471 Ga0495667_0013213 3300046559 Bacteria 5591
472 Ga0495667_0014359 3300046559 Bacteria 5350
473 Ga0495667_0075731 3300046559 Bacteria 2189
474 Ga0495634_0162148 3300046642 Bacteria 1409
475 Ga0495635_0000064 3300046663 Bacteria 65195
476 Ga0495635_0109680 3300046663 Bacteria 1885
477 Ga0495635_0181577 3300046663 Bacteria 1430
478 Ga0495635_0201672 3300046663 Unclassified 1349
479 Ga0495588_0010779 3300046674 Bacteria 4265
480 Ga0495588_0211054 3300046674 Bacteria 1025
481 Ga0495588_0489925 3300046674 Unclassified 644
482 Ga0495657_0006957 3300046675 Bacteria 8781
483 Ga0495657_0035768 3300046675 Bacteria 3439
484 Ga0495657_0039648 3300046675 Bacteria 3235
485 Ga0495599_0000656 3300046678 Bacteria 19571
486 Ga0495599_0004444 3300046678 Bacteria 8299
487 Ga0495599_0102833 3300046678 Unclassified 1780
488 Ga0495623_0000017 3300046679 Bacteria 108556
489 Ga0495623_0016819 3300046679 Bacteria 4725
490 Ga0495623_0028958 3300046679 Unclassified 3564
491 Ga0495623_0038929 3300046679 Unclassified 3040
492 Ga0495623_0048130 3300046679 Unclassified 2705
493 Ga0495623_0584369 3300046679 Unclassified 582
494 Ga0495646_0008578 3300046680 Bacteria 6491
495 Ga0495646_0077852 3300046680 Bacteria 1939
496 Ga0495646_0334446 3300046680 Bacteria 796
497 Ga0495658_0000154 3300046683 Bacteria 38312
498 Ga0495658_0000475 3300046683 Bacteria 22227
499 Ga0495613_0046784 3300046689 Bacteria 3198
500 Ga0495613_0221074 3300046689 Unclassified 1329
501 Ga0495613_1043784 3300046689 Unclassified 523
502 Ga0495670_0143429 3300046691 Bacteria 1250
503 Ga0495600_0000414 3300046809 Bacteria 22070
504 Ga0495600_0057717 3300046809 Unclassified 2535
505 Ga0495581_0000369 3300047315 Bacteria 22599
506 Ga0495581_0005667 3300047315 Bacteria 7242
507 Ga0495581_0260767 3300047315 Bacteria 1013
508 Ga0495581_0338243 3300047315 Unclassified 879
509 Ga0495581_0741231 3300047315 Unclassified 565
510 Ga0495581_0906512 3300047315 Bacteria 503
511 Ga0495604_0000017 3300047317 Bacteria 192029
512 Ga0495604_0148768 3300047317 Unclassified 1666
513 Ga0495674_0001736 3300047319 Bacteria 21417
514 Ga0495674_0066534 3300047319 Unclassified 3126
515 Ga0495674_0172213 3300047319 Bacteria 1806
516 Ga0495674_0246660 3300047319 Unclassified 1470
517 Ga0495674_0572634 3300047319 Unclassified 897
518 Ga0495674_0916606 3300047319 Bacteria 676
519 Ga0495680_0038318 3300047322 Bacteria 3832
520 Ga0495680_0040939 3300047322 Bacteria 3687
521 Ga0495680_0155095 3300047322 Bacteria 1667
522 Ga0495675_0000588 3300047444 Bacteria 23376
523 Ga0495675_0010712 3300047444 Bacteria 5739
524 Ga0495675_0012928 3300047444 Bacteria 5261
525 Ga0495675_0026776 3300047444 Unclassified 3676
526 Ga0495684_0000983 3300047471 Bacteria 23167
527 Ga0495684_0002650 3300047471 Bacteria 14204
528 Ga0495684_0058421 3300047471 Bacteria 2938
529 Ga0495684_0158701 3300047471 Bacteria 1688
530 Ga0495684_0670145 3300047471 Bacteria 691
531 Ga0495593_0000764 3300047673 Bacteria 18692
532 Ga0495593_0072745 3300047673 Bacteria 1784
533 Ga0495593_0094066 3300047673 Unclassified 1542
534 Ga0495593_0685280 3300047673 Unclassified 514
535 Ga0495602_0005702 3300048088 Bacteria 13056
536 Ga0495602_0016644 3300048088 Bacteria 7390
537 Ga0495602_0048589 3300048088 Bacteria 3811
538 Ga0495602_0600255 3300048088 Bacteria 757
539 Ga0495614_0000006 3300048089 Bacteria 71718
540 Ga0495614_0000409 3300048089 Bacteria 17538
541 Ga0495614_0399265 3300048089 Bacteria 646
542 Ga0496105_0428309 3300048908 Bacteria 1047
543 Ga0496106_0876369 3300048909 Bacteria 710
544 Ga0496108_0109558 3300048911 Bacteria 2360
545 Ga0496109_1768351 3300048912 Bacteria 551
546 Ga0496112_0047026 3300048915 Bacteria 4232
547 Ga0496112_1320323 3300048915 Bacteria 637
548 Ga0496113_0054492 3300048916 Bacteria 2994
549 Ga0501047_0511763 3300049581 Bacteria 1027
550 Ga0501067_0550496 3300049583 Unclassified 646
551 nmdc:mga05p37_198170_c1 3300050507 Bacteria 2434
552 nmdc:mga0n895_131746_c1 3300050512 Bacteria 2525
553 nmdc:mga0n895_359444_c1 3300050512 Unclassified 1474
554 nmdc:mga0rr50_1068586_c1 3300050513 Unclassified 687
555 nmdc:mga08x19_13297_c1 3300050514 Bacteria 4972
556 nmdc:mga08x19_27897_c1 3300050514 Unclassified 3533
557 nmdc:mga08x19_8679_c1 3300050514 Bacteria 6060
558 Ga0495601_0053474 3300053077 Bacteria 2553
559 Ga0495601_0193316 3300053077 Unclassified 1330
560 Ga0495601_0239398 3300053077 Bacteria 1185
561 Ga0495612_0008474 3300053078 Bacteria 4169
562 Ga0495595_0016707 3300053084 Unclassified 3145
563 Ga0495619_0002679 3300053085 Bacteria 11654
564 Ga0495619_0035617 3300053085 Bacteria 3238
565 Ga0495619_0097569 3300053085 Unclassified 1997
566 Ga0590071_074106 3300059421 Unclassified 841
567 Ga0466962_0341725 3300061719 Bacteria 745
568 Ga0070708_100167184
569 Ga0070658_10067012
570 Ga0070676_10087912
571 Ga0070683_100066640
572 Ga0070683_100529735
573 Ga0070683_100560441
574 Ga0070683_100781237
575 Ga0070680_100017799
576 Ga0070680_100119480
577 Ga0070680_100176832
578 Ga0070680_100998534
579 Ga0070682_100706184
580 Ga0070660_100018607
581 Ga0070689_100039620
582 Ga0070689_100449577
583 Ga0070691_10146824
584 Ga0070691_10485489
585 Ga0070661_100036379
586 Ga0070661_100618384
587 Ga0070661_100962189
588 Ga0070661_101052502
589 Ga0070668_100061484
590 Ga0070669_100302424
591 Ga0070675_101059636
592 Ga0070671_100322845
593 Ga0070674_100154683
594 Ga0070673_100923071
595 Ga0070659_100636179
596 Ga0070667_100166315
597 Ga0070667_100181549
598 Ga0070709_10012596
599 Ga0070709_10053943
600 Ga0070709_10095868
601 Ga0070709_10155033
602 Ga0070709_10222683
603 Ga0070709_10240706
604 Ga0070709_10846760
605 Ga0070714_100015171
606 Ga0070714_100032910
607 Ga0070714_100063672
608 Ga0070714_100124316
609 Ga0070714_100166106
610 Ga0070714_100361803
611 Ga0070714_100448004
612 Ga0070713_100117378
613 Ga0070713_100157390
614 Ga0070713_100244306
615 Ga0070713_100270032
616 Ga0070710_10056138
617 Ga0070710_10059886
618 Ga0070710_10376637
619 Ga0070710_10380118
620 Ga0070711_100301098
621 Ga0070711_100681989
622 Ga0070711_101885628
623 Ga0070663_100384448
624 Ga0070681_10005927
625 Ga0070681_10007968
626 Ga0070681_10038689
627 Ga0070681_10069195
628 Ga0070681_10077703
629 Ga0070681_10194701
630 Ga0070681_10342482
631 Ga0070681_10540857
632 Ga0070681_11104894
633 Ga0068867_100982048
634 Ga0070685_11004225
635 Ga0070706_100096079
636 Ga0070706_100621898
637 Ga0070707_100016548
638 Ga0070679_100037194
639 Ga0070679_100164490
640 Ga0070679_100224803
641 Ga0070679_100299829
642 Ga0070679_100412798
643 Ga0070679_100473969
644 Ga0070684_100029567
645 Ga0070684_100102731
646 Ga0070684_100135212
647 Ga0070684_100188348
648 Ga0070684_100874399
649 Ga0070697_100001015
650 Ga0068853_100006468
651 Ga0068853_100263517
652 Ga0068853_100714348
653 Ga0068853_100926870
654 Ga0070672_100676602
655 Ga0070686_100713932
656 Ga0070695_100537493
657 Ga0070693_100024607
658 Ga0070693_100040162
659 Ga0070693_100149540
660 Ga0070665_101610422
661 Ga0068855_100018331
662 Ga0068855_100050252
663 Ga0068855_100221322
664 Ga0068855_100635300
665 Ga0068855_100669111
666 Ga0068855_102499152
667 Ga0070664_100329128
668 Ga0070664_100536212
669 Ga0070664_101083943
670 Ga0068857_100024516
671 Ga0068857_100422997
672 Ga0068854_100123475
673 Ga0068856_100016775
674 Ga0068856_100085264
675 Ga0068856_100133369
676 Ga0068856_100338376
677 Ga0068856_100378423
678 Ga0068856_100688359
679 Ga0068856_100717868
680 Ga0068856_101189161
681 Ga0068856_101551013
682 Ga0068856_101964540
683 Ga0068852_100207367
684 Ga0068852_100689366
685 Ga0068852_101878745
686 Ga0068852_102776299
687 Ga0068859_100912007
688 Ga0068864_100026417
689 Ga0068851_10260032
690 Ga0068863_100256831
691 Ga0068863_100455520
692 Ga0068858_100434574
693 Ga0068858_101013339
694 Ga0070717_10015276
695 Ga0070717_10364720
696 Ga0070716_100483391
697 Ga0070712_100145504
698 Ga0070712_100175771
699 Ga0070712_100691757
700 Ga0070712_101454065
701 Ga0068871_100602902
702 Ga0075436_100004411
703 Ga0075436_100005381
704 Ga0075436_100006569
705 Ga0075436_100368470
706 Ga0097620_100912105
707 Ga0105240_10043404
708 Ga0105240_10077184
709 Ga0105240_10251958
710 Ga0105240_10465226
711 Ga0105240_10787438
712 Ga0105240_11709380
713 Ga0105245_10071038
714 Ga0105245_10219551
715 Ga0105245_10239239
716 Ga0105247_10174698
717 Ga0105247_10278634
718 Ga0105243_11196585
719 Ga0105241_10243644
720 Ga0105241_10402524
721 Ga0105241_10782570
722 Ga0105241_12283619
723 Ga0105242_10144243
724 Ga0105242_10149711
725 Ga0105248_10352123
726 Ga0105237_10397682
727 Ga0105237_10403404
728 Ga0105237_10427206
729 Ga0105238_10016372
730 Ga0105238_10057079
731 Ga0105238_10066030
732 Ga0105238_10095866
733 Ga0105238_10514825
734 Ga0105238_12877192
735 Ga0105249_10585434
736 Ga0105239_11681402
737 Ga0157373_10026271
738 Ga0157373_10671552
739 Ga0157373_10691772
740 Ga0157371_11117141
741 Ga0157370_10036708
742 Ga0157370_10071912
743 Ga0157370_10412731
744 Ga0157370_10416432
745 Ga0157370_10652097
746 Ga0157369_10004951
747 Ga0157369_10047732
748 Ga0157369_10099195
749 Ga0157369_10180769
750 Ga0157369_10218065
751 Ga0157369_10343262
752 Ga0157369_10695616
753 Ga0157369_10721073
754 Ga0157369_10781747
755 Ga0157369_12251789
756 Ga0157374_10410721
757 Ga0157374_10630688
758 Ga0157378_10754745
759 Ga0157378_11591689
760 Ga0157378_12994409
761 Ga0163162_10579989
762 Ga0157372_10046473
763 Ga0157372_10055232
764 Ga0157372_10062634
765 Ga0157372_10087472
766 Ga0157372_10093790
767 Ga0157372_10097154
768 Ga0157372_10098040
769 Ga0157372_10264890
770 Ga0157372_10659477
771 Ga0157372_11482669
772 Ga0157372_12328147
773 Ga0157375_10152070
774 Ga0163163_10236977
775 Ga0157376_10325699
776 Ga0157376_11176109
777 Ga0206356_11843739
778 Ga0213876_10022096
779 Ga0213876_10105684
780 Ga0213876_10456526
781 Ga0207692_10166244
782 Ga0207699_10021694
783 Ga0207699_10026936
784 Ga0207699_10135887
785 Ga0207699_10171698
786 Ga0207699_10188103
787 Ga0207699_10219718
788 Ga0207645_10042698
789 Ga0207645_10298945
790 Ga0207705_10352274
791 Ga0207705_10872156
792 Ga0207684_10028632
793 Ga0207684_10821062
794 Ga0207684_11113540
795 Ga0207654_10196530
796 Ga0207654_10634984
797 Ga0207654_11054262
798 Ga0207707_10002608
799 Ga0207707_10005351
800 Ga0207707_10006090
801 Ga0207707_10145294
802 Ga0207707_10228517
803 Ga0207707_10841664
804 Ga0207707_11037731
805 Ga0207695_10006711
806 Ga0207695_10028286
807 Ga0207695_10054798
808 Ga0207695_10303812
809 Ga0207671_10274844
810 Ga0207671_10608432
811 Ga0207693_10031675
812 Ga0207693_10045866
813 Ga0207693_10061151
814 Ga0207663_10013977
815 Ga0207663_10244240
816 Ga0207660_10020154
817 Ga0207660_10296689
818 Ga0207660_10364121
819 Ga0207660_10385116
820 Ga0207660_11029327
821 Ga0207649_10395027
822 Ga0207649_10950918
823 Ga0207652_10028372
824 Ga0207652_10069474
825 Ga0207652_10100654
826 Ga0207652_10246523
827 Ga0207652_10261129
828 Ga0207652_10590419
829 Ga0207646_10050953
830 Ga0207681_10367705
831 Ga0207694_10139575
832 Ga0207694_10228601
833 Ga0207694_10562445
834 Ga0207694_10776350
835 Ga0207694_11787533
836 Ga0207659_10441032
837 Ga0207659_11418157
838 Ga0207687_10658568
839 Ga0207700_10039649
840 Ga0207700_10054631
841 Ga0207700_10232184
842 Ga0207700_10291631
843 Ga0207700_11649102
844 Ga0207664_10022781
845 Ga0207664_10044943
846 Ga0207664_10207876
847 Ga0207664_10254892
848 Ga0207664_10266150
849 Ga0207644_10299864
850 Ga0207690_10237645
851 Ga0207686_10019530
852 Ga0207686_10235161
853 Ga0207670_10380155
854 Ga0207669_10767021
855 Ga0207704_11054132
856 Ga0207711_10754941
857 Ga0207711_10834041
858 Ga0207661_10013356
859 Ga0207661_10071127
860 Ga0207661_10102404
861 Ga0207661_10149544
862 Ga0207661_10752506
863 Ga0207661_11356339
864 Ga0207679_10672610
865 Ga0207679_10696982
866 Ga0207679_11348696
867 Ga0207667_10030773
868 Ga0207667_10160674
869 Ga0207667_10192657
870 Ga0207667_10197043
871 Ga0207667_11949465
872 Ga0207651_11275899
873 Ga0207640_10180252
874 Ga0207640_10360458
875 Ga0207658_10860238
876 Ga0207658_11264594
877 Ga0207677_10219172
878 Ga0207703_10557884
879 Ga0207639_10089856
880 Ga0207639_10794089
881 Ga0207678_10269501
882 Ga0207702_10016057
883 Ga0207702_10105487
884 Ga0207702_10210532
885 Ga0207702_10282088
886 Ga0207702_10453811
887 Ga0207702_10803559
888 Ga0207702_10938538
889 Ga0207702_11071786
890 Ga0207702_11091681
891 Ga0207702_11618926
892 Ga0207641_10622717
893 Ga0207648_10204982
894 Ga0207674_10022356
895 Ga0207674_11211697
896 Ga0207698_11098405
897 Ga0307407_10208886
898 Ga0373958_0055687
899 Ga0373926_0245938
900 Ga0373926_0302530
901 Ga0373934_0001464
902 Ga0373934_0002788
903 Ga0373934_0066177
904 Ga0373944_0007827
905 Ga0373944_0011446
906 Ga0373944_0236605
907 Ga0373944_0364609
908 Ga0373951_0250163
909 Ga0373923_0171207
910 Ga0373936_0012347
911 Ga0373941_0159858
912 Ga0373941_0178288
913 Ga0373945_0110897
914 Ga0373945_0127350
915 Ga0373954_0011239
916 Ga0373954_0062209
917 Ga0373954_0118990
918 Ga0373956_0000649
919 Ga0373956_0048510
920 Ga0373956_0193951
921 Ga0373957_0010314
922 Ga0373957_0074179
923 Ga0373943_0002038
924 Ga0373943_0002839
925 Ga0373943_0835929
926 Ga0373946_0019998
927 Ga0373955_0001868
928 Ga0373955_0007584
929 Ga0373931_0137613
930 Ga0373931_0324442
931 Ga0373935_0014905
932 Ga0373935_0025550
933 Ga0373935_0142884
934 Ga0373935_0563858
935 Ga0373935_1044755
936 Ga0373927_0004220
937 Ga0373927_0035379
938 Ga0373927_0219391
939 Ga0373933_0000070
940 Ga0373933_0630545
941 Ga0373933_0715901
942 Ga0373947_0000184
943 Ga0373947_0000566
944 Ga0373947_0116716
945 Ga0373937_0000153
946 Ga0373937_0002683
947 Ga0373937_0008461
948 Ga0373937_0511616
949 Ga0373925_0000532
950 Ga0373925_0003918
951 Ga0373925_0146381
952 Ga0373925_0533258
953 Ga0436365_0371588
954 Ga0436365_0417655
955 Ga0436365_0775268
956 Ga0436365_1658826
957 Ga0436365_1865895
958 Ga0466961_0800257
959 Ga0466957_0148730
960 Ga0466957_0981338
961 Ga0466959_0011884
962 Ga0451576_0438858
963 Ga0451576_0659609
964 Ga0466958_0281567
965 Ga0466958_0626869
966 Ga0495592_0008083
967 Ga0495603_0039720
968 Ga0495629_0023076
969 Ga0495629_0036059
970 Ga0495629_0082383
971 Ga0495629_0232646
972 Ga0495629_0457189
973 Ga0495629_0700116
974 Ga0495651_0000554
975 Ga0495651_0024644
976 Ga0495651_0032988
977 Ga0495651_0039572
978 Ga0495651_0077138
979 Ga0495653_0000160
980 Ga0495653_0008288
981 Ga0495580_0000636
982 Ga0495580_0075935
983 Ga0495580_0080169
984 Ga0495582_0001686
985 Ga0495582_0004177
986 Ga0495582_0007752
987 Ga0495582_0545789
988 Ga0495582_0813878
989 Ga0495639_0000243
990 Ga0495639_0013787
991 Ga0495664_0054906
992 Ga0495664_0127809
993 Ga0495664_0502907
994 Ga0495585_0284689
995 Ga0495594_0002174
996 Ga0495594_0003773
997 Ga0495594_0104246
998 Ga0495594_0408672
999 Ga0495608_0015544
1000 Ga0495608_0083033
1001 Ga0495608_0122175
1002 Ga0495608_0128381
1003 Ga0495608_0688370
1004 Ga0495618_0003790
1005 Ga0495618_0157139
1006 Ga0495628_0004881
1007 Ga0495628_0109544
1008 Ga0495628_0165453
1009 Ga0495630_0001567
1010 Ga0495630_0004421
1011 Ga0495630_0439748
1012 Ga0495666_0217362
1013 Ga0495666_0261154
1014 Ga0495652_0001424
1015 Ga0495652_0006004
1016 Ga0495652_0054390
1017 Ga0495652_0575973
1018 Ga0495652_0868233
1019 Ga0495665_0000033
1020 Ga0495665_0186367
1021 Ga0495586_0012835
1022 Ga0495586_0072487
1023 Ga0495586_0074719
1024 Ga0495586_0377488
1025 Ga0495587_0000193
1026 Ga0495587_0002182
1027 Ga0495587_0005272
1028 Ga0495587_0096622
1029 Ga0495645_0000129
1030 Ga0495645_0001420
1031 Ga0495645_0001470
1032 Ga0495645_0043556
1033 Ga0495645_0261971
1034 Ga0495645_0321708
1035 Ga0495622_0359545
1036 Ga0495667_0000116
1037 Ga0495667_0002264
1038 Ga0495667_0013213
1039 Ga0495667_0014359
1040 Ga0495667_0075731
1041 Ga0495634_0162148
1042 Ga0495635_0000064
1043 Ga0495635_0109680
1044 Ga0495635_0181577
1045 Ga0495635_0201672
1046 Ga0495588_0010779
1047 Ga0495588_0211054
1048 Ga0495588_0489925
1049 Ga0495657_0006957
1050 Ga0495657_0035768
1051 Ga0495657_0039648
1052 Ga0495599_0000656
1053 Ga0495599_0004444
1054 Ga0495599_0102833
1055 Ga0495623_0000017
1056 Ga0495623_0016819
1057 Ga0495623_0028958
1058 Ga0495623_0038929
1059 Ga0495623_0048130
1060 Ga0495623_0584369
1061 Ga0495646_0008578
1062 Ga0495646_0077852
1063 Ga0495646_0334446
1064 Ga0495658_0000154
1065 Ga0495658_0000475
1066 Ga0495613_0046784
1067 Ga0495613_0221074
1068 Ga0495613_1043784
1069 Ga0495670_0143429
1070 Ga0495600_0000414
1071 Ga0495600_0057717
1072 Ga0495581_0000369
1073 Ga0495581_0005667
1074 Ga0495581_0260767
1075 Ga0495581_0338243
1076 Ga0495581_0741231
1077 Ga0495581_0906512
1078 Ga0495604_0000017
1079 Ga0495604_0148768
1080 Ga0495674_0001736
1081 Ga0495674_0066534
1082 Ga0495674_0172213
1083 Ga0495674_0246660
1084 Ga0495674_0572634
1085 Ga0495674_0916606
1086 Ga0495680_0038318
1087 Ga0495680_0040939
1088 Ga0495680_0155095
1089 Ga0495675_0000588
1090 Ga0495675_0010712
1091 Ga0495675_0012928
1092 Ga0495675_0026776
1093 Ga0495684_0000983
1094 Ga0495684_0002650
1095 Ga0495684_0058421
1096 Ga0495684_0158701
1097 Ga0495684_0670145
1098 Ga0495593_0000764
1099 Ga0495593_0072745
1100 Ga0495593_0094066
1101 Ga0495593_0685280
1102 Ga0495602_0005702
1103 Ga0495602_0016644
1104 Ga0495602_0048589
1105 Ga0495602_0600255
1106 Ga0495614_0000006
1107 Ga0495614_0000409
1108 Ga0495614_0399265
1109 Ga0496105_0428309
1110 Ga0496106_0876369
1111 Ga0496108_0109558
1112 Ga0496109_1768351
1113 Ga0496112_0047026
1114 Ga0496112_1320323
1115 Ga0496113_0054492
1116 Ga0501047_0511763
1117 Ga0501067_0550496
1118 nmdc:mga05p37_198170_c1
1119 nmdc:mga0n895_131746_c1
1120 nmdc:mga0n895_359444_c1
1121 nmdc:mga0rr50_1068586_c1
1122 nmdc:mga08x19_13297_c1
1123 nmdc:mga08x19_27897_c1
1124 nmdc:mga08x19_8679_c1
1125 Ga0495601_0053474
1126 Ga0495601_0193316
1127 Ga0495601_0239398
1128 Ga0495612_0008474
1129 Ga0495595_0016707
1130 Ga0495619_0002679
1131 Ga0495619_0035617
1132 Ga0495619_0097569
1133 Ga0590071_074106
1134 Ga0466962_0341725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

19

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8839 8 112
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8759 8 112
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8723 8 111
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8669 11 109
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8486 8 111
ID Description Score Start End Superfamily
af_Q9SU39_105_239_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9644 69 84 3.40.50.1000
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8772 11 109 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8693 6 110 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8669 11 109 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8587 17 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8YKJ6-F1-model_v4 PadR family transcriptional regulator 0.9624 14 111
AF-A0A416EI77-F1-model_v4 PadR family transcriptional regulator 0.9581 8 110
AF-E8V6A6-F1-model_v4 Transcriptional regulator, PadR-like family 0.9566 14 115
AF-A0A2V9QNV6-F1-model_v4 PadR family transcriptional regulator 0.9554 7 86
AF-A0A3N5LHC2-F1-model_v4 PadR family transcriptional regulator 0.9546 15 114

Map