F464461

General Info

Members Datasets Scaffolds Average Seq Length
566 263 517 246

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581311|2585292821
Length 241
Sequence ILIIGATSAIATACARRWTNGTRLFLVGRNAARLQQVTDDLNSRGASATCMQLDVNDYAGHQALFARLEVEMPTIDIALIAPGTLPDQDMCQHDAVIAVREFNTNATSLIALLTPLANRMEAHKHGVIAVISSVAGDRGRPSNYLYGSAKAALSTFCEGLRARLAKSNVHLVTVKPGFVDTPMTAGLPLPGPLVATADKVAADIDRAIAKRINVLYTPWFWSGIMLIIRSIPQFVFKRISL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231021 Pseudomonas sp. GM78 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
13 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
14 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
15 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
16 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
17 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
18 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
19 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
20 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
21 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
22 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
23 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
24 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
25 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
26 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
27 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
28 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
29 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
30 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
31 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
32 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
33 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
34 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
35 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
36 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
37 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
38 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
39 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
40 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
41 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
42 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
43 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
44 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
45 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
46 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
47 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
48 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
49 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
139 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
140 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
143 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
144 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
145 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
146 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
147 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
150 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
258 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
259 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
260 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
261 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
262 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
263 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.34
Metatranscriptomes 0.18
Isolates 8.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.47
Nodule 1.59
Rhizoplane 3.71
Rhizosphere 78.98
Stem 0
Stem Tuber 0
Unclassified 13.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_7381 2124908027 Bacteria 3043
2 MRS2a_Contig_8530 2124908027 Bacteria 3038
3 MRS2a_Contig_9777 2124908027 Bacteria 1443
4 JGI24735J21928_10010979 3300002067 Bacteria 2877
5 JGI25162J39368_1000216 3300002737 Bacteria 60602
6 JGI25163J39215_1000422 3300002771 Bacteria 13137
7 JGI25164J39214_1000176 3300002772 Bacteria 59249
8 JGI25165J46597_1000306 3300003214 Bacteria 60602
9 rootH1_10069774 3300003323 Bacteria 3059
10 JGI25160J50197_1029645 3300003354 Bacteria 1442
11 Ga0055536_1000202 3300003781 Bacteria 48758
12 Ga0065714_10091474 3300005288 Bacteria 1909
13 Ga0065714_10133796 3300005288 Bacteria 1227
14 Ga0065712_10068210 3300005290 Bacteria 13033
15 Ga0070658_10491252 3300005327 Bacteria 1060
16 Ga0070676_10058900 3300005328 Bacteria 2277
17 Ga0070690_100083460 3300005330 Bacteria 2093
18 Ga0070670_100002657 3300005331 Bacteria 14780
19 Ga0070670_100106293 3300005331 Bacteria 2419
20 Ga0068869_100100353 3300005334 Bacteria 2189
21 Ga0070666_10071070 3300005335 Bacteria 2368
22 Ga0070660_100044536 3300005339 Bacteria 3395
23 Ga0070675_100089144 3300005354 Bacteria 2582
24 Ga0070667_100138695 3300005367 Bacteria 2128
25 Ga0070662_100059591 3300005457 Bacteria 2781
26 Ga0070662_100295519 3300005457 Bacteria 1314
27 Ga0070681_10749516 3300005458 Bacteria 893
28 Ga0070672_100082651 3300005543 Bacteria 2577
29 Ga0068855_100249332 3300005563 Bacteria 1981
30 Ga0070664_100009019 3300005564 Bacteria 8091
31 Ga0068857_100106154 3300005577 Unclassified 2522
32 Ga0068854_100248003 3300005578 Bacteria 1421
33 Ga0068856_100036828 3300005614 Bacteria 4797
34 Ga0068852_100172943 3300005616 Bacteria 2026
35 Ga0068859_100124974 3300005617 Bacteria 2641
36 Ga0068864_100158645 3300005618 Bacteria 2055
37 Ga0068863_100045354 3300005841 Bacteria 4172
38 Ga0068860_100031611 3300005843 Bacteria 5088
39 Ga0068862_100281479 3300005844 Bacteria 1524
40 Ga0097621_100066710 3300006237 Bacteria 2964
41 Ga0097620_100124973 3300006931 Bacteria 2641
42 Ga0079104_1002868 3300006946 Bacteria 8614
43 Ga0105251_10005072 3300009011 Bacteria 8726
44 Ga0105251_10007371 3300009011 Bacteria 6795
45 Ga0105244_10000547 3300009036 Bacteria 33532
46 Ga0105244_10002169 3300009036 Bacteria 15048
47 Ga0105244_10002784 3300009036 Bacteria 13032
48 Ga0105244_10005981 3300009036 Bacteria 7971
49 Ga0105244_10006623 3300009036 Bacteria 7464
50 Ga0105244_10100368 3300009036 Bacteria 1416
51 Ga0105244_10100380 3300009036 Bacteria 1416
52 Ga0105250_10000802 3300009092 Bacteria 18942
53 Ga0105240_10423946 3300009093 Bacteria 1494
54 Ga0105243_10597356 3300009148 Unclassified 1062
55 Ga0105241_10046171 3300009174 Bacteria 3307
56 Ga0105239_10045370 3300010375 Bacteria 4817
57 Ga0105246_10091664 3300011119 Unclassified 2191
58 Ga0157373_10000705 3300013100 Bacteria 26209
59 Ga0157373_10004133 3300013100 Bacteria 10948
60 Ga0157373_10004773 3300013100 Bacteria 10201
61 Ga0157373_10011757 3300013100 Bacteria 6430
62 Ga0157373_10213034 3300013100 Bacteria 1362
63 Ga0157373_10416359 3300013100 Bacteria 964
64 Ga0157371_10006831 3300013102 Bacteria 9324
65 Ga0157371_10041487 3300013102 Bacteria 3283
66 Ga0157370_10003320 3300013104 Bacteria 18958
67 Ga0157370_10012282 3300013104 Bacteria 8888
68 Ga0157369_10002104 3300013105 Bacteria 23998
69 Ga0157369_10023692 3300013105 Bacteria 6836
70 Ga0157369_10486539 3300013105 Bacteria 1277
71 Ga0163162_10000188 3300013306 Bacteria 57231
72 Ga0163162_10000307 3300013306 Bacteria 45339
73 Ga0157375_10130021 3300013308 Bacteria 2636
74 Ga0182008_10004199 3300014497 Bacteria 8472
75 Ga0182008_10008909 3300014497 Bacteria 5442
76 Ga0182008_10034396 3300014497 Bacteria 2541
77 Ga0157376_10128188 3300014969 Bacteria 2260
78 Ga0182006_1033133 3300015261 Bacteria 2072
79 Ga0182007_10000633 3300015262 Bacteria 20430
80 Ga0182007_10001455 3300015262 Bacteria 12711
81 Ga0182007_10013951 3300015262 Bacteria 3046
82 Ga0182007_10029106 3300015262 Bacteria 1893
83 Ga0182005_1023061 3300015265 Bacteria 1703
84 Ga0182005_1023614 3300015265 Bacteria 1680
85 Ga0163161_10000482 3300017792 Bacteria 32775
86 Ga0163161_10010145 3300017792 Bacteria 6520
87 Ga0163161_10213657 3300017792 Bacteria 1491
88 Ga0163161_10417132 3300017792 Bacteria 1079
89 Ga0209435_106156 3300025206 Bacteria 1338
90 Ga0209760_100011 3300025207 Bacteria 197221
91 Ga0207427_100008 3300025231 Bacteria 740731
92 Ga0209437_100014 3300025233 Bacteria 740714
93 Ga0209759_1000711 3300025256 Bacteria 29498
94 Ga0209233_1000008 3300025261 Bacteria 1356712
95 Ga0209676_1000270 3300025292 Bacteria 108368
96 Ga0207426_1001782 3300025302 Bacteria 16168
97 Ga0207696_1000097 3300025711 Bacteria 175696
98 Ga0207655_1000706 3300025728 Bacteria 38597
99 Ga0207655_1000711 3300025728 Bacteria 38267
100 Ga0207655_1001196 3300025728 Bacteria 25074
101 Ga0207655_1002594 3300025728 Bacteria 14396
102 Ga0207655_1002966 3300025728 Bacteria 13044
103 Ga0207655_1005353 3300025728 Bacteria 8755
104 Ga0207713_1022484 3300025735 Bacteria 2991
105 Ga0207713_1032383 3300025735 Bacteria 2296
106 Ga0207680_10044008 3300025903 Bacteria 2622
107 Ga0207647_10057009 3300025904 Bacteria 2396
108 Ga0207695_10181236 3300025913 Bacteria 2027
109 Ga0207671_10242695 3300025914 Bacteria 1415
110 Ga0207657_10023926 3300025919 Bacteria 5672
111 Ga0207649_10086194 3300025920 Bacteria 2046
112 Ga0207650_10000186 3300025925 Bacteria 72380
113 Ga0207706_10068107 3300025933 Bacteria 3133
114 Ga0207691_10101520 3300025940 Bacteria 2567
115 Ga0207689_10337191 3300025942 Bacteria 1252
116 Ga0207674_10030426 3300026116 Bacteria 5675
117 Ga0209281_1001531 3300027111 Bacteria 12971
118 Ga0209970_1000551 3300027614 Bacteria 6498
119 Ga0209974_10020176 3300027876 Bacteria 2210
120 Ga0268265_10808321 3300028380 Bacteria 914
121 Ga0268264_10028245 3300028381 Bacteria 4587
122 Ga0316178_1100236 3300030735 Bacteria 17770
123 Ga0307408_100001237 3300031548 Bacteria 19178
124 Ga0307408_100005313 3300031548 Bacteria 8626
125 Ga0307405_10104871 3300031731 Bacteria 1903
126 Ga0307405_10343442 3300031731 Bacteria 1149
127 Ga0307406_10661634 3300031901 Bacteria 868
128 Ga0307412_10043174 3300031911 Bacteria 2934
129 Ga0307411_10035891 3300032005 Bacteria 3101
130 Ga0395905_0006954 3300037471 Bacteria 11305
131 Ga0439438_000292 3300041405 Bacteria 22487
132 Ga0439438_000826 3300041405 Bacteria 13851
133 Ga0439447_005596 3300041407 Bacteria 4157
134 Ga0439466_0000770 3300041411 Bacteria 12140
135 Ga0439466_0003280 3300041411 Bacteria 6303
136 Ga0439432_001340 3300042006 Bacteria 9320
137 Ga0439432_003687 3300042006 Bacteria 5668
138 Ga0439451_000014 3300042009 Bacteria 42560
139 Ga0439451_001878 3300042009 Bacteria 4194
140 Ga0439451_004135 3300042009 Bacteria 2946
141 Ga0439452_000198 3300042010 Bacteria 43963
142 Ga0439452_000355 3300042010 Bacteria 28112
143 Ga0439463_000496 3300042016 Bacteria 10997
144 Ga0439463_000546 3300042016 Bacteria 10548
145 Ga0439463_002161 3300042016 Bacteria 5080
146 Ga0439463_002372 3300042016 Bacteria 4799
147 Ga0439463_005119 3300042016 Bacteria 3263
148 Ga0450911_000155 3300042115 Bacteria 27707
149 Ga0450911_006345 3300042115 Bacteria 1768
150 Ga0450900_000072 3300042136 Bacteria 5031
151 Ga0450903_015187 3300042138 Bacteria 1214
152 Ga0450904_000887 3300042139 Bacteria 4867
153 Ga0450906_000034 3300042145 Bacteria 21936
154 Ga0450908_031229 3300042184 Bacteria 925
155 Ga0439460_0000080 3300042461 Bacteria 14889
156 Ga0439460_0003531 3300042461 Bacteria 3780
157 Ga0439460_0046645 3300042461 Bacteria 1288
158 Ga0439440_0000005 3300042993 Bacteria 31981
159 Ga0466978_0312335 3300044671 Unclassified 883
160 Ga0466957_0219247 3300044842 Bacteria 1256
161 Ga0466967_0374407 3300045976 Bacteria 1382
162 Ga0495617_018191 3300046452 Bacteria 2376
163 Ga0495617_030973 3300046452 Bacteria 1798
164 Ga0495627_000058 3300046453 Bacteria 143802
165 Ga0495627_000134 3300046453 Bacteria 88155
166 Ga0495627_000169 3300046453 Bacteria 74332
167 Ga0495627_006395 3300046453 Bacteria 4620
168 Ga0495590_0010728 3300046457 Bacteria 3434
169 Ga0495590_0108756 3300046457 Bacteria 988
170 Ga0495591_000040 3300046458 Bacteria 155841
171 Ga0495591_000078 3300046458 Bacteria 109382
172 Ga0495591_000906 3300046458 Bacteria 20625
173 Ga0495591_002439 3300046458 Bacteria 10345
174 Ga0495591_002699 3300046458 Bacteria 9627
175 Ga0495629_0021044 3300046459 Bacteria 4654
176 Ga0495629_0025925 3300046459 Bacteria 4165
177 Ga0495629_0075647 3300046459 Bacteria 2351
178 Ga0495651_0074929 3300046462 Bacteria 2567
179 Ga0495653_0355902 3300046463 Bacteria 940
180 Ga0495650_0000388 3300046471 Bacteria 75543
181 Ga0495650_0004420 3300046471 Bacteria 9642
182 Ga0495650_0005056 3300046471 Bacteria 8730
183 Ga0495650_0007552 3300046471 Bacteria 6512
184 Ga0495650_0014920 3300046471 Bacteria 4010
185 Ga0495580_0004548 3300046472 Bacteria 11645
186 Ga0495580_0005234 3300046472 Bacteria 10781
187 Ga0495580_0008357 3300046472 Bacteria 8233
188 Ga0495580_0052884 3300046472 Bacteria 2867
189 Ga0495580_0110658 3300046472 Bacteria 1908
190 Ga0495582_0086513 3300046473 Bacteria 1744
191 Ga0495605_0000007 3300046474 Bacteria 358289
192 Ga0495605_0000017 3300046474 Bacteria 273775
193 Ga0495605_0001122 3300046474 Bacteria 17813
194 Ga0495605_0001446 3300046474 Bacteria 15562
195 Ga0495605_0001706 3300046474 Bacteria 14091
196 Ga0495605_0003690 3300046474 Bacteria 9089
197 Ga0495605_0014594 3300046474 Bacteria 4296
198 Ga0495605_0019100 3300046474 Bacteria 3667
199 Ga0495605_0034876 3300046474 Bacteria 2545
200 Ga0495605_0091818 3300046474 Bacteria 1406
201 Ga0495605_0107856 3300046474 Bacteria 1273
202 Ga0495639_0000020 3300046475 Bacteria 73983
203 Ga0495639_0002251 3300046475 Bacteria 8470
204 Ga0495662_0071705 3300046476 Bacteria 1679
205 Ga0495664_0003274 3300046477 Bacteria 8803
206 Ga0495664_0012857 3300046477 Bacteria 4741
207 Ga0495664_0128498 3300046477 Bacteria 1534
208 Ga0495584_0001338 3300046491 Bacteria 14929
209 Ga0495584_0004876 3300046491 Bacteria 7170
210 Ga0495584_0131801 3300046491 Bacteria 1268
211 Ga0495585_0000900 3300046492 Bacteria 25180
212 Ga0495585_0062181 3300046492 Bacteria 2051
213 Ga0495585_0076862 3300046492 Unclassified 1813
214 Ga0495585_0209215 3300046492 Bacteria 989
215 Ga0495594_0011357 3300046499 Bacteria 4626
216 Ga0495594_0052918 3300046499 Bacteria 2235
217 Ga0495596_0008778 3300046500 Bacteria 4474
218 Ga0495607_0000022 3300046501 Bacteria 162516
219 Ga0495607_0000171 3300046501 Bacteria 68792
220 Ga0495607_0000588 3300046501 Bacteria 35433
221 Ga0495607_0000882 3300046501 Bacteria 27974
222 Ga0495607_0002164 3300046501 Bacteria 16364
223 Ga0495607_0002976 3300046501 Bacteria 13280
224 Ga0495607_0004047 3300046501 Bacteria 10990
225 Ga0495607_0005383 3300046501 Bacteria 9183
226 Ga0495607_0007023 3300046501 Bacteria 7830
227 Ga0495607_0025425 3300046501 Bacteria 3682
228 Ga0495607_0044748 3300046501 Bacteria 2608
229 Ga0495607_0058789 3300046501 Bacteria 2196
230 Ga0495607_0063128 3300046501 Bacteria 2097
231 Ga0495607_0139122 3300046501 Bacteria 1254
232 Ga0495607_0253261 3300046501 Bacteria 846
233 Ga0495583_0000007 3300046506 Bacteria 434661
234 Ga0495583_0000499 3300046506 Bacteria 56843
235 Ga0495583_0000692 3300046506 Bacteria 43669
236 Ga0495583_0001320 3300046506 Bacteria 25760
237 Ga0495583_0002912 3300046506 Bacteria 13839
238 Ga0495583_0003049 3300046506 Bacteria 13316
239 Ga0495583_0003189 3300046506 Bacteria 12862
240 Ga0495583_0007816 3300046506 Bacteria 6644
241 Ga0495606_0000362 3300046507 Bacteria 77675
242 Ga0495606_0003398 3300046507 Bacteria 16909
243 Ga0495606_0003680 3300046507 Bacteria 16053
244 Ga0495606_0005555 3300046507 Bacteria 12021
245 Ga0495606_0023465 3300046507 Bacteria 4468
246 Ga0495606_0024645 3300046507 Bacteria 4329
247 Ga0495610_0012720 3300046512 Bacteria 5043
248 Ga0495610_0016838 3300046512 Bacteria 4189
249 Ga0495610_0041749 3300046512 Bacteria 2300
250 Ga0495616_0013026 3300046513 Bacteria 4703
251 Ga0495616_0092327 3300046513 Bacteria 1431
252 Ga0495618_0242429 3300046514 Bacteria 1133
253 Ga0495620_0000129 3300046515 Bacteria 61499
254 Ga0495620_0002500 3300046515 Bacteria 10653
255 Ga0495620_0002804 3300046515 Bacteria 10018
256 Ga0495620_0004982 3300046515 Bacteria 7443
257 Ga0495620_0034599 3300046515 Bacteria 2280
258 Ga0495620_0049998 3300046515 Bacteria 1785
259 Ga0495628_0011932 3300046516 Bacteria 7329
260 Ga0495628_0012253 3300046516 Bacteria 7228
261 Ga0495630_0001333 3300046517 Bacteria 16949
262 Ga0495630_0008836 3300046517 Bacteria 7234
263 Ga0495631_0001552 3300046518 Bacteria 13825
264 Ga0495631_0003595 3300046518 Bacteria 8455
265 Ga0495631_0006038 3300046518 Bacteria 6296
266 Ga0495631_0012025 3300046518 Bacteria 4241
267 Ga0495631_0042775 3300046518 Bacteria 2000
268 Ga0495632_0000190 3300046519 Bacteria 62298
269 Ga0495632_0000744 3300046519 Bacteria 29345
270 Ga0495632_0014017 3300046519 Bacteria 4550
271 Ga0495632_0016640 3300046519 Bacteria 4083
272 Ga0495632_0020023 3300046519 Bacteria 3633
273 Ga0495632_0026074 3300046519 Bacteria 3082
274 Ga0495632_0027784 3300046519 Bacteria 2958
275 Ga0495632_0088530 3300046519 Bacteria 1470
276 Ga0495632_0174059 3300046519 Bacteria 987
277 Ga0495637_0000043 3300046520 Bacteria 112526
278 Ga0495637_0000094 3300046520 Bacteria 70119
279 Ga0495637_0000550 3300046520 Bacteria 26965
280 Ga0495637_0005142 3300046520 Bacteria 6706
281 Ga0495637_0005190 3300046520 Bacteria 6671
282 Ga0495637_0007587 3300046520 Bacteria 5367
283 Ga0495637_0018164 3300046520 Bacteria 3267
284 Ga0495637_0038100 3300046520 Bacteria 2083
285 Ga0495637_0061286 3300046520 Bacteria 1542
286 Ga0495643_0001156 3300046522 Bacteria 25856
287 Ga0495643_0003060 3300046522 Bacteria 12567
288 Ga0495643_0014244 3300046522 Bacteria 4735
289 Ga0495643_0085379 3300046522 Bacteria 1636
290 Ga0495644_0016796 3300046523 Bacteria 2800
291 Ga0495648_0000218 3300046524 Bacteria 65786
292 Ga0495648_0002815 3300046524 Bacteria 15648
293 Ga0495648_0010286 3300046524 Bacteria 7140
294 Ga0495648_0015403 3300046524 Bacteria 5553
295 Ga0495648_0015431 3300046524 Bacteria 5548
296 Ga0495648_0064432 3300046524 Bacteria 2159
297 Ga0495666_0003235 3300046526 Bacteria 8209
298 Ga0495666_0008068 3300046526 Bacteria 5279
299 Ga0495666_0057913 3300046526 Bacteria 1855
300 Ga0495666_0076510 3300046526 Bacteria 1586
301 Ga0495652_0025653 3300046529 Bacteria 5210
302 Ga0495652_0237918 3300046529 Bacteria 1357
303 Ga0495654_0000445 3300046530 Bacteria 35088
304 Ga0495654_0001646 3300046530 Bacteria 15120
305 Ga0495654_0002906 3300046530 Bacteria 10737
306 Ga0495654_0004403 3300046530 Bacteria 8371
307 Ga0495654_0010769 3300046530 Bacteria 4969
308 Ga0495654_0045726 3300046530 Bacteria 2159
309 Ga0495665_0067945 3300046531 Bacteria 1879
310 Ga0495665_0183978 3300046531 Bacteria 1085
311 Ga0495586_0006087 3300046535 Bacteria 6450
312 Ga0495587_0005780 3300046536 Bacteria 8056
313 Ga0495587_0107892 3300046536 Bacteria 1601
314 Ga0495609_0000004 3300046538 Bacteria 697346
315 Ga0495609_0000045 3300046538 Bacteria 159595
316 Ga0495609_0000623 3300046538 Bacteria 27545
317 Ga0495609_0003821 3300046538 Bacteria 8468
318 Ga0495609_0020622 3300046538 Bacteria 3044
319 Ga0495597_0000002 3300046542 Bacteria 420382
320 Ga0495597_0000460 3300046542 Bacteria 34777
321 Ga0495597_0003694 3300046542 Bacteria 8780
322 Ga0495597_0010727 3300046542 Bacteria 4467
323 Ga0495645_0066308 3300046543 Bacteria 2609
324 Ga0495645_0089661 3300046543 Bacteria 2199
325 Ga0495622_0000240 3300046557 Bacteria 42783
326 Ga0495622_0021909 3300046557 Bacteria 2976
327 Ga0495633_0000020 3300046558 Bacteria 227180
328 Ga0495656_0002432 3300046615 Bacteria 6181
329 Ga0495656_0022651 3300046615 Unclassified 2463
330 Ga0495668_0015011 3300046616 Bacteria 4531
331 Ga0495668_0078471 3300046616 Bacteria 1813
332 Ga0495611_0000723 3300046648 Bacteria 18594
333 Ga0495611_0001882 3300046648 Bacteria 9992
334 Ga0495611_0008019 3300046648 Bacteria 4485
335 Ga0495611_0008600 3300046648 Bacteria 4318
336 Ga0495611_0013031 3300046648 Bacteria 3536
337 Ga0495625_0000070 3300046660 Bacteria 167336
338 Ga0495625_0003869 3300046660 Bacteria 14464
339 Ga0495625_0049318 3300046660 Bacteria 3027
340 Ga0495625_0089323 3300046660 Bacteria 2133
341 Ga0495635_0000131 3300046663 Bacteria 45264
342 Ga0495635_0038080 3300046663 Bacteria 3329
343 Ga0495659_0000094 3300046664 Bacteria 39086
344 Ga0495661_0000009 3300046665 Bacteria 291327
345 Ga0495661_0000042 3300046665 Bacteria 150599
346 Ga0495661_0000512 3300046665 Bacteria 40328
347 Ga0495661_0015509 3300046665 Bacteria 5084
348 Ga0495661_0020167 3300046665 Bacteria 4357
349 Ga0495661_0058635 3300046665 Bacteria 2294
350 Ga0495661_0087762 3300046665 Bacteria 1777
351 Ga0495661_0126734 3300046665 Bacteria 1404
352 Ga0495588_0017571 3300046674 Bacteria 3477
353 Ga0495599_0063073 3300046678 Bacteria 2315
354 Ga0495599_0210096 3300046678 Bacteria 1194
355 Ga0495623_0007224 3300046679 Bacteria 7209
356 Ga0495646_0000801 3300046680 Bacteria 17555
357 Ga0495646_0035542 3300046680 Bacteria 3090
358 Ga0495669_0001978 3300046684 Bacteria 8409
359 Ga0495613_0031286 3300046689 Bacteria 3952
360 Ga0495624_0007109 3300046690 Bacteria 7877
361 Ga0495624_0089898 3300046690 Bacteria 1894
362 Ga0495670_0014681 3300046691 Bacteria 3852
363 Ga0495670_0023599 3300046691 Bacteria 3035
364 Ga0495671_0002141 3300046692 Bacteria 12611
365 Ga0495671_0005974 3300046692 Bacteria 7077
366 Ga0495671_0037565 3300046692 Bacteria 2448
367 Ga0495649_0000335 3300046694 Bacteria 40508
368 Ga0495649_0044856 3300046694 Bacteria 2412
369 Ga0495649_0071000 3300046694 Bacteria 1866
370 Ga0495589_0001467 3300046794 Bacteria 13572
371 Ga0495589_0004997 3300046794 Bacteria 7022
372 Ga0495600_0002930 3300046809 Bacteria 9944
373 Ga0495600_0005165 3300046809 Bacteria 7847
374 Ga0495600_0093849 3300046809 Bacteria 1957
375 Ga0495660_0000111 3300046810 Bacteria 87624
376 Ga0495660_0000844 3300046810 Bacteria 22635
377 Ga0495660_0006406 3300046810 Bacteria 6965
378 Ga0495660_0018603 3300046810 Bacteria 3994
379 Ga0495660_0021744 3300046810 Bacteria 3668
380 Ga0495660_0036084 3300046810 Bacteria 2758
381 Ga0495581_0029843 3300047315 Bacteria 3161
382 Ga0495604_0016312 3300047317 Bacteria 5936
383 Ga0495604_0020609 3300047317 Bacteria 5265
384 Ga0495604_0138321 3300047317 Bacteria 1743
385 Ga0495604_0216898 3300047317 Bacteria 1319
386 Ga0495636_0000538 3300047318 Bacteria 13944
387 Ga0495636_0002277 3300047318 Bacteria 7369
388 Ga0495674_0000648 3300047319 Bacteria 32676
389 Ga0495674_0005119 3300047319 Bacteria 12593
390 Ga0495674_0013088 3300047319 Bacteria 7804
391 Ga0495674_0031010 3300047319 Bacteria 4858
392 Ga0495672_0009661 3300047320 Bacteria 6961
393 Ga0495672_0010392 3300047320 Bacteria 6635
394 Ga0495672_0011470 3300047320 Bacteria 6252
395 Ga0495672_0087070 3300047320 Bacteria 1726
396 Ga0495672_0115782 3300047320 Bacteria 1432
397 Ga0495672_0125282 3300047320 Bacteria 1359
398 Ga0495676_0000019 3300047321 Bacteria 167261
399 Ga0495676_0000378 3300047321 Bacteria 36410
400 Ga0495676_0171883 3300047321 Bacteria 1524
401 Ga0495676_0369534 3300047321 Bacteria 956
402 Ga0495680_0005232 3300047322 Bacteria 12250
403 Ga0495680_0104052 3300047322 Bacteria 2112
404 Ga0495683_0000003 3300047323 Bacteria 383992
405 Ga0495683_0000016 3300047323 Bacteria 191396
406 Ga0495683_0006255 3300047323 Bacteria 6514
407 Ga0495683_0036978 3300047323 Bacteria 2477
408 Ga0495687_001532 3300047443 Bacteria 21059
409 Ga0495687_021949 3300047443 Bacteria 3075
410 Ga0495675_0007871 3300047444 Bacteria 6585
411 Ga0495675_0035473 3300047444 Bacteria 3186
412 Ga0495675_0164434 3300047444 Bacteria 1365
413 Ga0495679_000066 3300047446 Bacteria 100641
414 Ga0495679_000847 3300047446 Bacteria 19430
415 Ga0495679_005253 3300047446 Bacteria 5775
416 Ga0495673_0000269 3300047469 Bacteria 71832
417 Ga0495673_0000282 3300047469 Bacteria 68654
418 Ga0495673_0002236 3300047469 Bacteria 13901
419 Ga0495673_0002846 3300047469 Bacteria 11775
420 Ga0495673_0005130 3300047469 Bacteria 7986
421 Ga0495673_0008343 3300047469 Bacteria 5837
422 Ga0495673_0008618 3300047469 Bacteria 5710
423 Ga0495673_0012430 3300047469 Bacteria 4515
424 Ga0495673_0018571 3300047469 Bacteria 3501
425 Ga0495673_0057001 3300047469 Bacteria 1688
426 Ga0495673_0075425 3300047469 Bacteria 1408
427 Ga0495673_0092837 3300047469 Bacteria 1231
428 Ga0495681_0002118 3300047470 Bacteria 14431
429 Ga0495681_0004288 3300047470 Bacteria 9767
430 Ga0495681_0015457 3300047470 Bacteria 4315
431 Ga0495681_0105835 3300047470 Bacteria 1224
432 Ga0495686_0037503 3300047472 Bacteria 3105
433 Ga0495686_0258215 3300047472 Bacteria 976
434 Ga0495593_0004607 3300047673 Bacteria 8196
435 Ga0495593_0013423 3300047673 Bacteria 4673
436 Ga0495602_0082036 3300048088 Bacteria 2708
437 Ga0495614_0016372 3300048089 Bacteria 3227
438 Ga0495626_0000080 3300048091 Bacteria 129112
439 Ga0495626_0000321 3300048091 Bacteria 50472
440 Ga0495626_0001238 3300048091 Bacteria 20977
441 Ga0495626_0011144 3300048091 Bacteria 4766
442 Ga0496100_0044395 3300048903 Bacteria 2847
443 Ga0496100_0213175 3300048903 Bacteria 1413
444 Ga0496101_0047321 3300048904 Bacteria 3087
445 Ga0496102_0151283 3300048905 Unclassified 2181
446 Ga0496102_0459142 3300048905 Bacteria 1195
447 Ga0496102_0720488 3300048905 Bacteria 920
448 Ga0496104_0207313 3300048907 Bacteria 1872
449 Ga0496104_0384813 3300048907 Bacteria 1315
450 Ga0496105_0345302 3300048908 Bacteria 1189
451 Ga0496106_0000079 3300048909 Bacteria 77180
452 Ga0496106_0016604 3300048909 Bacteria 5448
453 Ga0496108_0216103 3300048911 Bacteria 1665
454 Ga0496110_0012764 3300048913 Bacteria 6918
455 Ga0496111_0102875 3300048914 Bacteria 2100
456 Ga0496112_0297958 3300048915 Bacteria 1558
457 Ga0496113_0700001 3300048916 Bacteria 809
458 Ga0496116_0000427 3300048919 Bacteria 59167
459 Ga0496116_0008486 3300048919 Bacteria 8906
460 Ga0496116_0048492 3300048919 Bacteria 2850
461 Ga0496116_0063729 3300048919 Bacteria 2373
462 Ga0496117_0001069 3300048920 Bacteria 41544
463 Ga0496117_0018879 3300048920 Bacteria 5689
464 Ga0496117_0034027 3300048920 Bacteria 3846
465 Ga0496117_0062329 3300048920 Bacteria 2556
466 Ga0496118_0007488 3300048921 Bacteria 11553
467 Ga0496118_0014560 3300048921 Bacteria 7354
468 Ga0496118_0023235 3300048921 Bacteria 5391
469 Ga0496118_0068213 3300048921 Bacteria 2585
470 Ga0496121_0000437 3300048924 Bacteria 82376
471 Ga0496121_0000909 3300048924 Bacteria 53336
472 Ga0496121_0002139 3300048924 Bacteria 31028
473 Ga0496121_0004081 3300048924 Bacteria 20058
474 Ga0496121_0007211 3300048924 Bacteria 13462
475 Ga0496121_0013927 3300048924 Bacteria 8594
476 Ga0496121_0017872 3300048924 Bacteria 7197
477 Ga0496121_0115737 3300048924 Bacteria 2035
478 Ga0496121_0268705 3300048924 Bacteria 1173
479 Ga0496122_0000667 3300048925 Bacteria 69054
480 Ga0496122_0001640 3300048925 Bacteria 34724
481 Ga0496122_0001752 3300048925 Bacteria 33405
482 Ga0496122_0009386 3300048925 Bacteria 10323
483 Ga0496122_0042358 3300048925 Bacteria 3583
484 Ga0496122_0071850 3300048925 Bacteria 2463
485 Ga0496123_0000163 3300048926 Bacteria 133536
486 Ga0496123_0001351 3300048926 Bacteria 34576
487 Ga0496123_0014254 3300048926 Bacteria 6603
488 Ga0496123_0018290 3300048926 Bacteria 5581
489 Ga0496123_0045526 3300048926 Bacteria 2988
490 Ga0496123_0049874 3300048926 Bacteria 2802
491 Ga0496124_0000007 3300048927 Bacteria 883534
492 Ga0496124_0002066 3300048927 Bacteria 27210
493 Ga0496124_0002341 3300048927 Bacteria 25008
494 Ga0496124_0003850 3300048927 Bacteria 17960
495 Ga0496124_0012838 3300048927 Bacteria 8230
496 Ga0496124_0040202 3300048927 Bacteria 4048
497 Ga0496124_0085649 3300048927 Bacteria 2582
498 Ga0496126_0000242 3300048929 Bacteria 117707
499 Ga0496126_0000885 3300048929 Bacteria 52645
500 Ga0496126_0028428 3300048929 Bacteria 5329
501 Ga0496126_0077999 3300048929 Bacteria 2936
502 Ga0496126_0189789 3300048929 Bacteria 1741
503 Ga0495678_000007 3300049459 Bacteria 448039
504 Ga0495678_000303 3300049459 Bacteria 53487
505 Ga0495678_003456 3300049459 Bacteria 9788
506 Ga0495678_003892 3300049459 Bacteria 8957
507 Ga0495678_005361 3300049459 Bacteria 7103
508 Ga0495678_037520 3300049459 Bacteria 1968
509 Ga0495678_123001 3300049459 Bacteria 869
510 Ga0495682_0000051 3300049460 Bacteria 109996
511 Ga0495682_0003542 3300049460 Bacteria 6911
512 Ga0495682_0006536 3300049460 Bacteria 4711
513 Ga0495682_0012050 3300049460 Bacteria 3323
514 Ga0501319_000011 3300049535 Bacteria 7945
515 Ga0501235_014478 3300049669 Bacteria 1738
516 Ga0500618_002193 3300053125 Bacteria 7646
517 Ga0500573_0004057 3300053140 Bacteria 7660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047323 Ga0495683_0000016 Ga0495683_0000016_74127_74867 237
2 iso_pu_bacteria 2582581311 2585292821 241
3 iso_pu_bacteria 2501025504 2501414034 242
4 iso_pu_bacteria 2510917014 2511094706 242
5 iso_pu_bacteria 2511231016 2511324141 242
6 iso_pu_bacteria 2511231021 2511355821 242
7 iso_pu_bacteria 2599185317 2600027675 242
8 iso_pu_bacteria 2600254930 2600356616 242
9 iso_pu_bacteria 2600255067 2600810763 242
10 iso_pu_bacteria 2619619299 2621300976 242
11 iso_pu_bacteria 2623620443 2624481979 242
12 iso_pu_bacteria 2643221650 2644282504 242
13 iso_pu_bacteria 2713897148 2715750526 242
14 iso_pu_bacteria 2791355137 2792836471 242
15 iso_pu_bacteria 2816332298 2817489721 242
16 iso_pu_bacteria 2826581358 2826584666 242
17 iso_pu_bacteria 2842324504 2842331129 242
18 iso_pu_bacteria 2842348783 2842355468 242
19 iso_pu_bacteria 2842454564 2842457915 242
20 iso_pu_bacteria 2842815866 2842816510 242
21 iso_pu_bacteria 2842849001 2842850091 242
22 iso_pu_bacteria 2857542790 2857543885 242
23 iso_pu_bacteria 2860339153 2860340841 242
24 iso_pu_bacteria 2860339153 2860340851 242
25 iso_pu_bacteria 2883087390 2883093832 242
26 iso_pu_bacteria 2900634093 2900636083 242
27 iso_pu_bacteria 2902682994 2902683322 242
28 iso_pu_bacteria 2919385768 2919388530 242
29 iso_pu_bacteria 2919487758 2919490152 242
30 iso_pu_bacteria 2919697872 2919701968 242
31 iso_pu_bacteria 2931396565 2931396595 242
32 iso_pu_bacteria 2945934425 2945935681 242
33 iso_pu_bacteria 2974289157 2974289396 242
34 iso_pu_bacteria 3007614139 3007615606 242
35 iso_pu_bacteria 3007619802 3007624872 242
36 iso_pu_bacteria 641736151 642422939 242
37 iso_pu_bacteria 642555112 642594064 242
38 iso_pu_bacteria 642555113 642620457 242
39 iso_pu_bacteria 8019775933 8019782285 242
40 iso_pu_bacteria 2501025501 2501071117 243
41 iso_pu_bacteria 2501025502 2501078714 243
42 iso_pu_bacteria 2510917013 2511089360 243
43 iso_pu_bacteria 2510917015 2511104447 243
44 iso_pu_bacteria 2513237082 2513555926 243
45 iso_pu_bacteria 2515154189 2516017104 243
46 2124908027 MRS2a_Contig_7381 MRS2a_00272800 246
47 2124908027 MRS2a_Contig_8530 MRS2a_00410480 246
48 2124908027 MRS2a_Contig_9777 MRS2a_00634140 246
49 3300002067 JGI24735J21928_10010979 JGI24735J21928_100109795 246
50 3300002737 JGI25162J39368_1000216 JGI25162J39368_100021634 246
51 3300002771 JGI25163J39215_1000422 JGI25163J39215_10004226 246
52 3300002772 JGI25164J39214_1000176 JGI25164J39214_100017625 246
53 3300003214 JGI25165J46597_1000306 JGI25165J46597_100030634 246
54 3300003323 rootH1_10069774 rootH1_100697742 246
55 3300003354 JGI25160J50197_1029645 JGI25160J50197_10296453 246
56 3300003781 Ga0055536_1000202 Ga0055536_100020215 246
57 3300005288 Ga0065714_10091474 Ga0065714_100914741 246
58 3300005288 Ga0065714_10133796 Ga0065714_101337962 246
59 3300005290 Ga0065712_10068210 Ga0065712_100682107 246
60 3300005327 Ga0070658_10491252 Ga0070658_104912521 246
61 3300005328 Ga0070676_10058900 Ga0070676_100589002 246
62 3300005330 Ga0070690_100083460 Ga0070690_1000834602 246
63 3300005331 Ga0070670_100002657 Ga0070670_10000265712 246
64 3300005331 Ga0070670_100106293 Ga0070670_1001062932 246
65 3300005334 Ga0068869_100100353 Ga0068869_1001003532 246
66 3300005335 Ga0070666_10071070 Ga0070666_100710702 246
67 3300005339 Ga0070660_100044536 Ga0070660_1000445362 246
68 3300005354 Ga0070675_100089144 Ga0070675_1000891443 246
69 3300005367 Ga0070667_100138695 Ga0070667_1001386952 246
70 3300005457 Ga0070662_100059591 Ga0070662_1000595913 246
71 3300005457 Ga0070662_100295519 Ga0070662_1002955192 246
72 3300005458 Ga0070681_10749516 Ga0070681_107495162 246
73 3300005543 Ga0070672_100082651 Ga0070672_1000826512 246
74 3300005563 Ga0068855_100249332 Ga0068855_1002493322 246
75 3300005564 Ga0070664_100009019 Ga0070664_1000090195 246
76 3300005577 Ga0068857_100106154 Ga0068857_1001061542 246
77 3300005578 Ga0068854_100248003 Ga0068854_1002480032 246
78 3300005614 Ga0068856_100036828 Ga0068856_1000368282 246
79 3300005616 Ga0068852_100172943 Ga0068852_1001729432 246
80 3300005617 Ga0068859_100124974 Ga0068859_1001249742 246
81 3300005618 Ga0068864_100158645 Ga0068864_1001586453 246
82 3300005841 Ga0068863_100045354 Ga0068863_1000453542 246
83 3300005843 Ga0068860_100031611 Ga0068860_1000316112 246
84 3300005844 Ga0068862_100281479 Ga0068862_1002814792 246
85 3300006237 Ga0097621_100066710 Ga0097621_1000667102 246
86 3300006931 Ga0097620_100124973 Ga0097620_1001249732 246
87 3300006946 Ga0079104_1002868 Ga0079104_10028686 246
88 3300009011 Ga0105251_10005072 Ga0105251_100050729 246
89 3300009011 Ga0105251_10007371 Ga0105251_100073713 246
90 3300009036 Ga0105244_10000547 Ga0105244_1000054718 246
91 3300009036 Ga0105244_10002169 Ga0105244_100021695 246
92 3300009036 Ga0105244_10002784 Ga0105244_100027848 246
93 3300009036 Ga0105244_10005981 Ga0105244_100059813 246
94 3300009036 Ga0105244_10006623 Ga0105244_100066236 246
95 3300009036 Ga0105244_10100368 Ga0105244_101003682 246
96 3300009036 Ga0105244_10100380 Ga0105244_101003802 246
97 3300009092 Ga0105250_10000802 Ga0105250_1000080213 246
98 3300009093 Ga0105240_10423946 Ga0105240_104239461 246
99 3300009148 Ga0105243_10597356 Ga0105243_105973562 246
100 3300009174 Ga0105241_10046171 Ga0105241_100461713 246
101 3300010375 Ga0105239_10045370 Ga0105239_100453704 246
102 3300011119 Ga0105246_10091664 Ga0105246_100916642 246
103 3300013100 Ga0157373_10000705 Ga0157373_100007056 246
104 3300013100 Ga0157373_10004133 Ga0157373_100041332 246
105 3300013100 Ga0157373_10004773 Ga0157373_100047734 246
106 3300013100 Ga0157373_10011757 Ga0157373_100117573 246
107 3300013100 Ga0157373_10213034 Ga0157373_102130342 246
108 3300013100 Ga0157373_10416359 Ga0157373_104163592 246
109 3300013102 Ga0157371_10006831 Ga0157371_100068316 246
110 3300013102 Ga0157371_10041487 Ga0157371_100414873 246
111 3300013104 Ga0157370_10003320 Ga0157370_100033209 246
112 3300013104 Ga0157370_10012282 Ga0157370_100122824 246
113 3300013105 Ga0157369_10002104 Ga0157369_1000210414 246
114 3300013105 Ga0157369_10023692 Ga0157369_100236926 246
115 3300013105 Ga0157369_10486539 Ga0157369_104865392 246
116 3300013306 Ga0163162_10000188 Ga0163162_1000018810 246
117 3300013306 Ga0163162_10000307 Ga0163162_1000030710 246
118 3300013308 Ga0157375_10130021 Ga0157375_101300211 246
119 3300014497 Ga0182008_10004199 Ga0182008_100041993 246
120 3300014497 Ga0182008_10008909 Ga0182008_100089093 246
121 3300014497 Ga0182008_10034396 Ga0182008_100343962 246
122 3300014969 Ga0157376_10128188 Ga0157376_101281883 246
123 3300015261 Ga0182006_1033133 Ga0182006_10331332 246
124 3300015262 Ga0182007_10000633 Ga0182007_100006338 246
125 3300015262 Ga0182007_10001455 Ga0182007_100014558 246
126 3300015262 Ga0182007_10013951 Ga0182007_100139512 246
127 3300015262 Ga0182007_10029106 Ga0182007_100291062 246
128 3300015265 Ga0182005_1023061 Ga0182005_10230613 246
129 3300015265 Ga0182005_1023614 Ga0182005_10236142 246
130 3300017792 Ga0163161_10000482 Ga0163161_1000048212 246
131 3300017792 Ga0163161_10010145 Ga0163161_100101455 246
132 3300017792 Ga0163161_10213657 Ga0163161_102136571 246
133 3300017792 Ga0163161_10417132 Ga0163161_104171322 246
134 3300025206 Ga0209435_106156 Ga0209435_1061562 246
135 3300025207 Ga0209760_100011 Ga0209760_100011112 246
136 3300025231 Ga0207427_100008 Ga0207427_100008293 246
137 3300025233 Ga0209437_100014 Ga0209437_100014418 246
138 3300025256 Ga0209759_1000711 Ga0209759_10007115 246
139 3300025261 Ga0209233_1000008 Ga0209233_1000008418 246
140 3300025292 Ga0209676_1000270 Ga0209676_100027037 246
141 3300025302 Ga0207426_1001782 Ga0207426_100178216 246
142 3300025711 Ga0207696_1000097 Ga0207696_1000097121 246
143 3300025728 Ga0207655_1000706 Ga0207655_100070620 246
144 3300025728 Ga0207655_1000711 Ga0207655_100071125 246
145 3300025728 Ga0207655_1001196 Ga0207655_100119617 246
146 3300025728 Ga0207655_1002594 Ga0207655_100259410 246
147 3300025728 Ga0207655_1002966 Ga0207655_10029662 246
148 3300025728 Ga0207655_1005353 Ga0207655_10053533 246
149 3300025735 Ga0207713_1022484 Ga0207713_10224843 246
150 3300025735 Ga0207713_1032383 Ga0207713_10323832 246
151 3300025903 Ga0207680_10044008 Ga0207680_100440082 246
152 3300025904 Ga0207647_10057009 Ga0207647_100570092 246
153 3300025913 Ga0207695_10181236 Ga0207695_101812362 246
154 3300025914 Ga0207671_10242695 Ga0207671_102426952 246
155 3300025919 Ga0207657_10023926 Ga0207657_100239262 246
156 3300025920 Ga0207649_10086194 Ga0207649_100861941 246
157 3300025925 Ga0207650_10000186 Ga0207650_1000018632 246
158 3300025933 Ga0207706_10068107 Ga0207706_100681073 246
159 3300025940 Ga0207691_10101520 Ga0207691_101015202 246
160 3300025942 Ga0207689_10337191 Ga0207689_103371912 246
161 3300026116 Ga0207674_10030426 Ga0207674_100304264 246
162 3300027111 Ga0209281_1001531 Ga0209281_100153110 246
163 3300027614 Ga0209970_1000551 Ga0209970_10005513 246
164 3300027876 Ga0209974_10020176 Ga0209974_100201762 246
165 3300028380 Ga0268265_10808321 Ga0268265_108083212 246
166 3300028381 Ga0268264_10028245 Ga0268264_100282453 246
167 3300030735 Ga0316178_1100236 Ga0316178_11002369 246
168 3300031548 Ga0307408_100001237 Ga0307408_1000012377 246
169 3300031548 Ga0307408_100005313 Ga0307408_1000053136 246
170 3300031731 Ga0307405_10104871 Ga0307405_101048712 246
171 3300031731 Ga0307405_10343442 Ga0307405_103434422 246
172 3300031901 Ga0307406_10661634 Ga0307406_106616341 246
173 3300031911 Ga0307412_10043174 Ga0307412_100431743 246
174 3300032005 Ga0307411_10035891 Ga0307411_100358912 246
175 3300037471 Ga0395905_0006954 Ga0395905_0006954_2005_2745 246
176 3300041405 Ga0439438_000292 Ga0439438_000292_3296_4036 246
177 3300041405 Ga0439438_000826 Ga0439438_000826_8407_9147 246
178 3300041407 Ga0439447_005596 Ga0439447_005596_2075_2815 246
179 3300041411 Ga0439466_0000770 Ga0439466_0000770_2444_3184 246
180 3300041411 Ga0439466_0003280 Ga0439466_0003280_2195_2935 246
181 3300042006 Ga0439432_001340 Ga0439432_001340_7978_8718 246
182 3300042006 Ga0439432_003687 Ga0439432_003687_2016_2756 246
183 3300042009 Ga0439451_000014 Ga0439451_000014_20454_21194 246
184 3300042009 Ga0439451_001878 Ga0439451_001878_3052_3792 246
185 3300042009 Ga0439451_004135 Ga0439451_004135_1565_2305 246
186 3300042010 Ga0439452_000198 Ga0439452_000198_28620_29360 246
187 3300042010 Ga0439452_000355 Ga0439452_000355_3052_3792 246
188 3300042016 Ga0439463_000496 Ga0439463_000496_211_963 246
189 3300042016 Ga0439463_000546 Ga0439463_000546_5955_6695 246
190 3300042016 Ga0439463_002161 Ga0439463_002161_2190_2930 246
191 3300042016 Ga0439463_002372 Ga0439463_002372_1852_2592 246
192 3300042016 Ga0439463_005119 Ga0439463_005119_2293_3033 246
193 3300042115 Ga0450911_000155 Ga0450911_000155_23833_24573 246
194 3300042115 Ga0450911_006345 Ga0450911_006345_221_961 246
195 3300042136 Ga0450900_000072 Ga0450900_000072_1716_2456 246
196 3300042138 Ga0450903_015187 Ga0450903_015187_63_803 246
197 3300042139 Ga0450904_000887 Ga0450904_000887_1085_1825 246
198 3300042145 Ga0450906_000034 Ga0450906_000034_18325_19065 246
199 3300042184 Ga0450908_031229 Ga0450908_031229_49_789 246
200 3300042461 Ga0439460_0000080 Ga0439460_0000080_3863_4603 246
201 3300042461 Ga0439460_0003531 Ga0439460_0003531_2863_3603 246
202 3300042461 Ga0439460_0046645 Ga0439460_0046645_388_1128 246
203 3300042993 Ga0439440_0000005 Ga0439440_0000005_16456_17196 246
204 3300044671 Ga0466978_0312335 Ga0466978_0312335_25_765 246
205 3300044842 Ga0466957_0219247 Ga0466957_0219247_342_1082 246
206 3300045976 Ga0466967_0374407 Ga0466967_0374407_26_766 246
207 3300046452 Ga0495617_018191 Ga0495617_018191_662_1402 246
208 3300046452 Ga0495617_030973 Ga0495617_030973_539_1279 246
209 3300046453 Ga0495627_000058 Ga0495627_000058_47104_47844 246
210 3300046453 Ga0495627_000134 Ga0495627_000134_78516_79256 246
211 3300046453 Ga0495627_000169 Ga0495627_000169_52290_53033 246
212 3300046453 Ga0495627_006395 Ga0495627_006395_2211_2951 246
213 3300046457 Ga0495590_0010728 Ga0495590_0010728_719_1459 246
214 3300046457 Ga0495590_0108756 Ga0495590_0108756_93_845 246
215 3300046458 Ga0495591_000040 Ga0495591_000040_2671_3423 246
216 3300046458 Ga0495591_000078 Ga0495591_000078_65818_66558 246
217 3300046458 Ga0495591_000906 Ga0495591_000906_3615_4355 246
218 3300046458 Ga0495591_002439 Ga0495591_002439_4760_5506 246
219 3300046458 Ga0495591_002699 Ga0495591_002699_5595_6335 246
220 3300046459 Ga0495629_0021044 Ga0495629_0021044_1044_1784 246
221 3300046459 Ga0495629_0025925 Ga0495629_0025925_2886_3626 246
222 3300046459 Ga0495629_0075647 Ga0495629_0075647_1569_2309 246
223 3300046462 Ga0495651_0074929 Ga0495651_0074929_173_913 246
224 3300046463 Ga0495653_0355902 Ga0495653_0355902_154_894 246
225 3300046471 Ga0495650_0000388 Ga0495650_0000388_49597_50337 246
226 3300046471 Ga0495650_0004420 Ga0495650_0004420_2947_3687 246
227 3300046471 Ga0495650_0005056 Ga0495650_0005056_5213_5953 246
228 3300046471 Ga0495650_0007552 Ga0495650_0007552_726_1466 246
229 3300046471 Ga0495650_0014920 Ga0495650_0014920_2063_2803 246
230 3300046472 Ga0495580_0004548 Ga0495580_0004548_4952_5692 246
231 3300046472 Ga0495580_0005234 Ga0495580_0005234_5068_5808 246
232 3300046472 Ga0495580_0008357 Ga0495580_0008357_1909_2649 246
233 3300046472 Ga0495580_0052884 Ga0495580_0052884_1989_2729 246
234 3300046472 Ga0495580_0110658 Ga0495580_0110658_121_861 246
235 3300046473 Ga0495582_0086513 Ga0495582_0086513_384_1124 246
236 3300046474 Ga0495605_0000007 Ga0495605_0000007_97625_98365 246
237 3300046474 Ga0495605_0000017 Ga0495605_0000017_9908_10660 246
238 3300046474 Ga0495605_0001122 Ga0495605_0001122_1720_2460 246
239 3300046474 Ga0495605_0001446 Ga0495605_0001446_6634_7374 246
240 3300046474 Ga0495605_0001706 Ga0495605_0001706_4472_5212 246
241 3300046474 Ga0495605_0003690 Ga0495605_0003690_5617_6357 246
242 3300046474 Ga0495605_0014594 Ga0495605_0014594_2627_3367 246
243 3300046474 Ga0495605_0019100 Ga0495605_0019100_403_1143 246
244 3300046474 Ga0495605_0034876 Ga0495605_0034876_1770_2510 246
245 3300046474 Ga0495605_0091818 Ga0495605_0091818_128_868 246
246 3300046474 Ga0495605_0107856 Ga0495605_0107856_389_1129 246
247 3300046475 Ga0495639_0000020 Ga0495639_0000020_36859_37599 246
248 3300046475 Ga0495639_0002251 Ga0495639_0002251_6524_7264 246
249 3300046476 Ga0495662_0071705 Ga0495662_0071705_562_1302 246
250 3300046477 Ga0495664_0003274 Ga0495664_0003274_8052_8792 246
251 3300046477 Ga0495664_0012857 Ga0495664_0012857_75_815 246
252 3300046477 Ga0495664_0128498 Ga0495664_0128498_146_886 246
253 3300046491 Ga0495584_0001338 Ga0495584_0001338_6507_7247 246
254 3300046491 Ga0495584_0004876 Ga0495584_0004876_2893_3633 246
255 3300046491 Ga0495584_0131801 Ga0495584_0131801_39_779 246
256 3300046492 Ga0495585_0000900 Ga0495585_0000900_16421_17161 246
257 3300046492 Ga0495585_0062181 Ga0495585_0062181_252_992 246
258 3300046492 Ga0495585_0076862 Ga0495585_0076862_111_851 246
259 3300046492 Ga0495585_0209215 Ga0495585_0209215_50_790 246
260 3300046499 Ga0495594_0011357 Ga0495594_0011357_2010_2750 246
261 3300046499 Ga0495594_0052918 Ga0495594_0052918_1076_1816 246
262 3300046500 Ga0495596_0008778 Ga0495596_0008778_3504_4244 246
263 3300046501 Ga0495607_0000022 Ga0495607_0000022_8262_9014 246
264 3300046501 Ga0495607_0000171 Ga0495607_0000171_48085_48825 246
265 3300046501 Ga0495607_0000588 Ga0495607_0000588_29207_29962 246
266 3300046501 Ga0495607_0000882 Ga0495607_0000882_23169_23909 246
267 3300046501 Ga0495607_0002164 Ga0495607_0002164_7399_8139 246
268 3300046501 Ga0495607_0002976 Ga0495607_0002976_5054_5794 246
269 3300046501 Ga0495607_0004047 Ga0495607_0004047_4782_5522 246
270 3300046501 Ga0495607_0005383 Ga0495607_0005383_5701_6441 246
271 3300046501 Ga0495607_0007023 Ga0495607_0007023_2771_3511 246
272 3300046501 Ga0495607_0025425 Ga0495607_0025425_2842_3594 246
273 3300046501 Ga0495607_0044748 Ga0495607_0044748_950_1714 246
274 3300046501 Ga0495607_0058789 Ga0495607_0058789_1436_2176 246
275 3300046501 Ga0495607_0063128 Ga0495607_0063128_1290_2030 246
276 3300046501 Ga0495607_0139122 Ga0495607_0139122_220_960 246
277 3300046501 Ga0495607_0253261 Ga0495607_0253261_20_760 246
278 3300046506 Ga0495583_0000007 Ga0495583_0000007_56327_57067 246
279 3300046506 Ga0495583_0000499 Ga0495583_0000499_32602_33378 246
280 3300046506 Ga0495583_0000692 Ga0495583_0000692_21272_22012 246
281 3300046506 Ga0495583_0001320 Ga0495583_0001320_21728_22468 246
282 3300046506 Ga0495583_0002912 Ga0495583_0002912_2018_2770 246
283 3300046506 Ga0495583_0003049 Ga0495583_0003049_6425_7189 246
284 3300046506 Ga0495583_0003189 Ga0495583_0003189_4366_5106 246
285 3300046506 Ga0495583_0007816 Ga0495583_0007816_3889_4629 246
286 3300046507 Ga0495606_0000362 Ga0495606_0000362_73831_74583 246
287 3300046507 Ga0495606_0003398 Ga0495606_0003398_4985_5725 246
288 3300046507 Ga0495606_0003680 Ga0495606_0003680_10402_11142 246
289 3300046507 Ga0495606_0005555 Ga0495606_0005555_7615_8355 246
290 3300046507 Ga0495606_0023465 Ga0495606_0023465_948_1688 246
291 3300046507 Ga0495606_0024645 Ga0495606_0024645_369_1109 246
292 3300046512 Ga0495610_0012720 Ga0495610_0012720_2958_3734 246
293 3300046512 Ga0495610_0016838 Ga0495610_0016838_3283_4023 246
294 3300046512 Ga0495610_0041749 Ga0495610_0041749_31_771 246
295 3300046513 Ga0495616_0013026 Ga0495616_0013026_3640_4380 246
296 3300046513 Ga0495616_0092327 Ga0495616_0092327_482_1222 246
297 3300046514 Ga0495618_0242429 Ga0495618_0242429_61_801 246
298 3300046515 Ga0495620_0000129 Ga0495620_0000129_2638_3378 246
299 3300046515 Ga0495620_0002500 Ga0495620_0002500_2870_3622 246
300 3300046515 Ga0495620_0002804 Ga0495620_0002804_5281_6021 246
301 3300046515 Ga0495620_0004982 Ga0495620_0004982_3942_4682 246
302 3300046515 Ga0495620_0034599 Ga0495620_0034599_1435_2187 246
303 3300046515 Ga0495620_0049998 Ga0495620_0049998_630_1370 246
304 3300046516 Ga0495628_0011932 Ga0495628_0011932_2982_3722 246
305 3300046516 Ga0495628_0012253 Ga0495628_0012253_2477_3217 246
306 3300046517 Ga0495630_0001333 Ga0495630_0001333_5009_5749 246
307 3300046517 Ga0495630_0008836 Ga0495630_0008836_3355_4095 246
308 3300046518 Ga0495631_0001552 Ga0495631_0001552_5644_6384 246
309 3300046518 Ga0495631_0003595 Ga0495631_0003595_4970_5710 246
310 3300046518 Ga0495631_0006038 Ga0495631_0006038_2242_2994 246
311 3300046518 Ga0495631_0012025 Ga0495631_0012025_1706_2446 246
312 3300046518 Ga0495631_0042775 Ga0495631_0042775_949_1689 246
313 3300046519 Ga0495632_0000190 Ga0495632_0000190_23355_24131 246
314 3300046519 Ga0495632_0000744 Ga0495632_0000744_18403_19146 246
315 3300046519 Ga0495632_0014017 Ga0495632_0014017_1149_1889 246
316 3300046519 Ga0495632_0016640 Ga0495632_0016640_1324_2064 246
317 3300046519 Ga0495632_0020023 Ga0495632_0020023_1268_2008 246
318 3300046519 Ga0495632_0026074 Ga0495632_0026074_2163_2918 246
319 3300046519 Ga0495632_0027784 Ga0495632_0027784_1037_1777 246
320 3300046519 Ga0495632_0088530 Ga0495632_0088530_527_1279 246
321 3300046519 Ga0495632_0174059 Ga0495632_0174059_50_790 246
322 3300046520 Ga0495637_0000043 Ga0495637_0000043_58843_59583 246
323 3300046520 Ga0495637_0000094 Ga0495637_0000094_51094_51846 246
324 3300046520 Ga0495637_0000550 Ga0495637_0000550_22839_23579 246
325 3300046520 Ga0495637_0005142 Ga0495637_0005142_3188_3928 246
326 3300046520 Ga0495637_0005190 Ga0495637_0005190_2190_2966 246
327 3300046520 Ga0495637_0007587 Ga0495637_0007587_2887_3627 246
328 3300046520 Ga0495637_0018164 Ga0495637_0018164_397_1137 246
329 3300046520 Ga0495637_0038100 Ga0495637_0038100_988_1728 246
330 3300046520 Ga0495637_0061286 Ga0495637_0061286_313_1053 246
331 3300046522 Ga0495643_0001156 Ga0495643_0001156_3510_4250 246
332 3300046522 Ga0495643_0003060 Ga0495643_0003060_8973_9713 246
333 3300046522 Ga0495643_0014244 Ga0495643_0014244_1501_2253 246
334 3300046522 Ga0495643_0085379 Ga0495643_0085379_699_1439 246
335 3300046523 Ga0495644_0016796 Ga0495644_0016796_693_1433 246
336 3300046524 Ga0495648_0000218 Ga0495648_0000218_16643_17395 246
337 3300046524 Ga0495648_0002815 Ga0495648_0002815_11206_11946 246
338 3300046524 Ga0495648_0010286 Ga0495648_0010286_4248_4988 246
339 3300046524 Ga0495648_0015403 Ga0495648_0015403_3379_4119 246
340 3300046524 Ga0495648_0015431 Ga0495648_0015431_3374_4114 246
341 3300046524 Ga0495648_0064432 Ga0495648_0064432_64_804 246
342 3300046526 Ga0495666_0003235 Ga0495666_0003235_3848_4588 246
343 3300046526 Ga0495666_0008068 Ga0495666_0008068_464_1204 246
344 3300046526 Ga0495666_0057913 Ga0495666_0057913_621_1361 246
345 3300046526 Ga0495666_0076510 Ga0495666_0076510_206_946 246
346 3300046529 Ga0495652_0025653 Ga0495652_0025653_4251_4991 246
347 3300046529 Ga0495652_0237918 Ga0495652_0237918_139_879 246
348 3300046530 Ga0495654_0000445 Ga0495654_0000445_5475_6215 246
349 3300046530 Ga0495654_0001646 Ga0495654_0001646_3070_3810 246
350 3300046530 Ga0495654_0002906 Ga0495654_0002906_5965_6717 246
351 3300046530 Ga0495654_0004403 Ga0495654_0004403_4213_4953 246
352 3300046530 Ga0495654_0010769 Ga0495654_0010769_3714_4454 246
353 3300046530 Ga0495654_0045726 Ga0495654_0045726_856_1596 246
354 3300046531 Ga0495665_0067945 Ga0495665_0067945_736_1476 246
355 3300046531 Ga0495665_0183978 Ga0495665_0183978_226_966 246
356 3300046535 Ga0495586_0006087 Ga0495586_0006087_734_1474 246
357 3300046536 Ga0495587_0005780 Ga0495587_0005780_2696_3436 246
358 3300046536 Ga0495587_0107892 Ga0495587_0107892_175_915 246
359 3300046538 Ga0495609_0000004 Ga0495609_0000004_100102_100842 246
360 3300046538 Ga0495609_0000045 Ga0495609_0000045_76051_76791 246
361 3300046538 Ga0495609_0000623 Ga0495609_0000623_7400_8140 246
362 3300046538 Ga0495609_0003821 Ga0495609_0003821_4800_5540 246
363 3300046538 Ga0495609_0020622 Ga0495609_0020622_2286_3026 246
364 3300046542 Ga0495597_0000002 Ga0495597_0000002_399223_399963 246
365 3300046542 Ga0495597_0000460 Ga0495597_0000460_16631_17371 246
366 3300046542 Ga0495597_0003694 Ga0495597_0003694_2607_3347 246
367 3300046542 Ga0495597_0010727 Ga0495597_0010727_1492_2232 246
368 3300046543 Ga0495645_0066308 Ga0495645_0066308_22_762 246
369 3300046543 Ga0495645_0089661 Ga0495645_0089661_329_1069 246
370 3300046557 Ga0495622_0000240 Ga0495622_0000240_20540_21280 246
371 3300046557 Ga0495622_0021909 Ga0495622_0021909_1858_2598 246
372 3300046558 Ga0495633_0000020 Ga0495633_0000020_126626_127366 246
373 3300046615 Ga0495656_0002432 Ga0495656_0002432_3668_4408 246
374 3300046615 Ga0495656_0022651 Ga0495656_0022651_322_1062 246
375 3300046616 Ga0495668_0015011 Ga0495668_0015011_3667_4419 246
376 3300046616 Ga0495668_0078471 Ga0495668_0078471_448_1188 246
377 3300046648 Ga0495611_0000723 Ga0495611_0000723_8356_9096 246
378 3300046648 Ga0495611_0001882 Ga0495611_0001882_9208_9948 246
379 3300046648 Ga0495611_0008019 Ga0495611_0008019_3492_4244 246
380 3300046648 Ga0495611_0008600 Ga0495611_0008600_1388_2128 246
381 3300046648 Ga0495611_0013031 Ga0495611_0013031_1952_2692 246
382 3300046660 Ga0495625_0000070 Ga0495625_0000070_62258_62998 246
383 3300046660 Ga0495625_0003869 Ga0495625_0003869_4244_4984 246
384 3300046660 Ga0495625_0003869 Ga0495625_0003869_7008_7748 246
385 3300046660 Ga0495625_0049318 Ga0495625_0049318_2051_2791 246
386 3300046660 Ga0495625_0089323 Ga0495625_0089323_1339_2079 246
387 3300046663 Ga0495635_0000131 Ga0495635_0000131_32803_33543 246
388 3300046663 Ga0495635_0038080 Ga0495635_0038080_980_1720 246
389 3300046664 Ga0495659_0000094 Ga0495659_0000094_14917_15657 246
390 3300046665 Ga0495661_0000009 Ga0495661_0000009_56603_57343 246
391 3300046665 Ga0495661_0000042 Ga0495661_0000042_98086_98826 246
392 3300046665 Ga0495661_0000512 Ga0495661_0000512_10664_11440 246
393 3300046665 Ga0495661_0015509 Ga0495661_0015509_2696_3436 246
394 3300046665 Ga0495661_0020167 Ga0495661_0020167_3102_3842 246
395 3300046665 Ga0495661_0058635 Ga0495661_0058635_83_823 246
396 3300046665 Ga0495661_0087762 Ga0495661_0087762_634_1386 246
397 3300046665 Ga0495661_0126734 Ga0495661_0126734_294_1034 246
398 3300046674 Ga0495588_0017571 Ga0495588_0017571_1913_2653 246
399 3300046678 Ga0495599_0063073 Ga0495599_0063073_1238_1978 246
400 3300046678 Ga0495599_0210096 Ga0495599_0210096_227_967 246
401 3300046679 Ga0495623_0007224 Ga0495623_0007224_2705_3445 246
402 3300046680 Ga0495646_0000801 Ga0495646_0000801_6895_7635 246
403 3300046680 Ga0495646_0035542 Ga0495646_0035542_2080_2820 246
404 3300046684 Ga0495669_0001978 Ga0495669_0001978_2231_2971 246
405 3300046689 Ga0495613_0031286 Ga0495613_0031286_3116_3856 246
406 3300046690 Ga0495624_0007109 Ga0495624_0007109_4858_5598 246
407 3300046690 Ga0495624_0089898 Ga0495624_0089898_754_1494 246
408 3300046691 Ga0495670_0014681 Ga0495670_0014681_2763_3503 246
409 3300046691 Ga0495670_0023599 Ga0495670_0023599_72_812 246
410 3300046692 Ga0495671_0002141 Ga0495671_0002141_4473_5225 246
411 3300046692 Ga0495671_0005974 Ga0495671_0005974_3882_4622 246
412 3300046692 Ga0495671_0037565 Ga0495671_0037565_1470_2210 246
413 3300046694 Ga0495649_0000335 Ga0495649_0000335_27340_28080 246
414 3300046694 Ga0495649_0044856 Ga0495649_0044856_340_1080 246
415 3300046694 Ga0495649_0071000 Ga0495649_0071000_69_809 246
416 3300046794 Ga0495589_0001467 Ga0495589_0001467_7656_8396 246
417 3300046794 Ga0495589_0004997 Ga0495589_0004997_299_1039 246
418 3300046809 Ga0495600_0002930 Ga0495600_0002930_5616_6356 246
419 3300046809 Ga0495600_0005165 Ga0495600_0005165_3637_4377 246
420 3300046809 Ga0495600_0093849 Ga0495600_0093849_286_1026 246
421 3300046810 Ga0495660_0000111 Ga0495660_0000111_7365_8105 246
422 3300046810 Ga0495660_0000844 Ga0495660_0000844_11968_12708 246
423 3300046810 Ga0495660_0006406 Ga0495660_0006406_5601_6353 246
424 3300046810 Ga0495660_0018603 Ga0495660_0018603_2868_3608 246
425 3300046810 Ga0495660_0021744 Ga0495660_0021744_2446_3186 246
426 3300046810 Ga0495660_0036084 Ga0495660_0036084_1766_2506 246
427 3300047315 Ga0495581_0029843 Ga0495581_0029843_1304_2044 246
428 3300047317 Ga0495604_0016312 Ga0495604_0016312_3068_3808 246
429 3300047317 Ga0495604_0020609 Ga0495604_0020609_4211_4951 246
430 3300047317 Ga0495604_0138321 Ga0495604_0138321_172_912 246
431 3300047317 Ga0495604_0216898 Ga0495604_0216898_60_800 246
432 3300047318 Ga0495636_0000538 Ga0495636_0000538_2325_3065 246
433 3300047318 Ga0495636_0002277 Ga0495636_0002277_5024_5764 246
434 3300047319 Ga0495674_0000648 Ga0495674_0000648_15557_16297 246
435 3300047319 Ga0495674_0005119 Ga0495674_0005119_5680_6420 246
436 3300047319 Ga0495674_0013088 Ga0495674_0013088_3549_4289 246
437 3300047319 Ga0495674_0031010 Ga0495674_0031010_553_1293 246
438 3300047320 Ga0495672_0009661 Ga0495672_0009661_3387_4139 246
439 3300047320 Ga0495672_0010392 Ga0495672_0010392_1656_2396 246
440 3300047320 Ga0495672_0011470 Ga0495672_0011470_3516_4256 246
441 3300047320 Ga0495672_0087070 Ga0495672_0087070_838_1578 246
442 3300047320 Ga0495672_0115782 Ga0495672_0115782_265_1005 246
443 3300047320 Ga0495672_0125282 Ga0495672_0125282_306_1046 246
444 3300047321 Ga0495676_0000019 Ga0495676_0000019_52154_52894 246
445 3300047321 Ga0495676_0000378 Ga0495676_0000378_26775_27515 246
446 3300047321 Ga0495676_0171883 Ga0495676_0171883_717_1457 246
447 3300047321 Ga0495676_0369534 Ga0495676_0369534_108_848 246
448 3300047322 Ga0495680_0005232 Ga0495680_0005232_2696_3436 246
449 3300047322 Ga0495680_0104052 Ga0495680_0104052_194_934 246
450 3300047323 Ga0495683_0000003 Ga0495683_0000003_117574_118314 246
451 3300047323 Ga0495683_0006255 Ga0495683_0006255_5647_6387 246
452 3300047323 Ga0495683_0036978 Ga0495683_0036978_1413_2153 246
453 3300047443 Ga0495687_001532 Ga0495687_001532_4249_4989 246
454 3300047443 Ga0495687_021949 Ga0495687_021949_2180_2920 246
455 3300047444 Ga0495675_0007871 Ga0495675_0007871_2962_3702 246
456 3300047444 Ga0495675_0035473 Ga0495675_0035473_1721_2461 246
457 3300047444 Ga0495675_0164434 Ga0495675_0164434_389_1129 246
458 3300047446 Ga0495679_000066 Ga0495679_000066_36199_36939 246
459 3300047446 Ga0495679_000847 Ga0495679_000847_5012_5752 246
460 3300047446 Ga0495679_005253 Ga0495679_005253_60_800 246
461 3300047469 Ga0495673_0000269 Ga0495673_0000269_25546_26286 246
462 3300047469 Ga0495673_0000282 Ga0495673_0000282_60639_61379 246
463 3300047469 Ga0495673_0002236 Ga0495673_0002236_7702_8454 246
464 3300047469 Ga0495673_0002846 Ga0495673_0002846_7686_8426 246
465 3300047469 Ga0495673_0005130 Ga0495673_0005130_7127_7879 246
466 3300047469 Ga0495673_0008343 Ga0495673_0008343_108_860 246
467 3300047469 Ga0495673_0008618 Ga0495673_0008618_556_1296 246
468 3300047469 Ga0495673_0012430 Ga0495673_0012430_1754_2494 246
469 3300047469 Ga0495673_0018571 Ga0495673_0018571_95_835 246
470 3300047469 Ga0495673_0057001 Ga0495673_0057001_201_977 246
471 3300047469 Ga0495673_0075425 Ga0495673_0075425_95_835 246
472 3300047469 Ga0495673_0092837 Ga0495673_0092837_445_1200 246
473 3300047470 Ga0495681_0002118 Ga0495681_0002118_8337_9077 246
474 3300047470 Ga0495681_0004288 Ga0495681_0004288_94_834 246
475 3300047470 Ga0495681_0015457 Ga0495681_0015457_325_1065 246
476 3300047470 Ga0495681_0105835 Ga0495681_0105835_310_1050 246
477 3300047472 Ga0495686_0037503 Ga0495686_0037503_1004_1756 246
478 3300047472 Ga0495686_0258215 Ga0495686_0258215_54_794 246
479 3300047673 Ga0495593_0004607 Ga0495593_0004607_1410_2150 246
480 3300047673 Ga0495593_0013423 Ga0495593_0013423_49_789 246
481 3300048088 Ga0495602_0082036 Ga0495602_0082036_303_1043 246
482 3300048089 Ga0495614_0016372 Ga0495614_0016372_897_1637 246
483 3300048091 Ga0495626_0000080 Ga0495626_0000080_36712_37452 246
484 3300048091 Ga0495626_0000321 Ga0495626_0000321_22537_23277 246
485 3300048091 Ga0495626_0001238 Ga0495626_0001238_17049_17789 246
486 3300048091 Ga0495626_0011144 Ga0495626_0011144_1677_2417 246
487 3300048903 Ga0496100_0044395 Ga0496100_0044395_380_1120 246
488 3300048903 Ga0496100_0213175 Ga0496100_0213175_32_772 246
489 3300048904 Ga0496101_0047321 Ga0496101_0047321_645_1385 246
490 3300048905 Ga0496102_0151283 Ga0496102_0151283_1131_1871 246
491 3300048905 Ga0496102_0459142 Ga0496102_0459142_20_760 246
492 3300048905 Ga0496102_0720488 Ga0496102_0720488_90_842 246
493 3300048907 Ga0496104_0207313 Ga0496104_0207313_991_1731 246
494 3300048907 Ga0496104_0384813 Ga0496104_0384813_239_979 246
495 3300048908 Ga0496105_0345302 Ga0496105_0345302_340_1080 246
496 3300048909 Ga0496106_0000079 Ga0496106_0000079_72659_73399 246
497 3300048909 Ga0496106_0016604 Ga0496106_0016604_4619_5359 246
498 3300048911 Ga0496108_0216103 Ga0496108_0216103_408_1148 246
499 3300048913 Ga0496110_0012764 Ga0496110_0012764_1293_2045 246
500 3300048914 Ga0496111_0102875 Ga0496111_0102875_800_1540 246
501 3300048915 Ga0496112_0297958 Ga0496112_0297958_151_891 246
502 3300048916 Ga0496113_0700001 Ga0496113_0700001_17_763 246
503 3300048919 Ga0496116_0000427 Ga0496116_0000427_37669_38409 246
504 3300048919 Ga0496116_0008486 Ga0496116_0008486_5530_6270 246
505 3300048919 Ga0496116_0048492 Ga0496116_0048492_245_997 246
506 3300048919 Ga0496116_0063729 Ga0496116_0063729_460_1200 246
507 3300048920 Ga0496117_0001069 Ga0496117_0001069_26416_27156 246
508 3300048920 Ga0496117_0018879 Ga0496117_0018879_4858_5598 246
509 3300048920 Ga0496117_0034027 Ga0496117_0034027_548_1288 246
510 3300048920 Ga0496117_0062329 Ga0496117_0062329_1690_2436 246
511 3300048921 Ga0496118_0007488 Ga0496118_0007488_5603_6343 246
512 3300048921 Ga0496118_0014560 Ga0496118_0014560_5657_6403 246
513 3300048921 Ga0496118_0023235 Ga0496118_0023235_3526_4266 246
514 3300048921 Ga0496118_0068213 Ga0496118_0068213_591_1343 246
515 3300048924 Ga0496121_0000437 Ga0496121_0000437_15632_16372 246
516 3300048924 Ga0496121_0000909 Ga0496121_0000909_43792_44544 246
517 3300048924 Ga0496121_0002139 Ga0496121_0002139_28955_29695 246
518 3300048924 Ga0496121_0004081 Ga0496121_0004081_4866_5606 246
519 3300048924 Ga0496121_0007211 Ga0496121_0007211_11642_12388 246
520 3300048924 Ga0496121_0013927 Ga0496121_0013927_4073_4813 246
521 3300048924 Ga0496121_0017872 Ga0496121_0017872_3707_4447 246
522 3300048924 Ga0496121_0115737 Ga0496121_0115737_973_1713 246
523 3300048924 Ga0496121_0268705 Ga0496121_0268705_142_894 246
524 3300048925 Ga0496122_0000667 Ga0496122_0000667_51755_52501 246
525 3300048925 Ga0496122_0001640 Ga0496122_0001640_18016_18756 246
526 3300048925 Ga0496122_0001752 Ga0496122_0001752_19983_20723 246
527 3300048925 Ga0496122_0009386 Ga0496122_0009386_1982_2734 246
528 3300048925 Ga0496122_0042358 Ga0496122_0042358_32_772 246
529 3300048925 Ga0496122_0071850 Ga0496122_0071850_1252_1992 246
530 3300048926 Ga0496123_0000163 Ga0496123_0000163_116233_116979 246
531 3300048926 Ga0496123_0001351 Ga0496123_0001351_20954_21694 246
532 3300048926 Ga0496123_0014254 Ga0496123_0014254_1894_2634 246
533 3300048926 Ga0496123_0018290 Ga0496123_0018290_2806_3558 246
534 3300048926 Ga0496123_0045526 Ga0496123_0045526_1399_2139 246
535 3300048926 Ga0496123_0049874 Ga0496123_0049874_1420_2160 246
536 3300048927 Ga0496124_0000007 Ga0496124_0000007_206752_207492 246
537 3300048927 Ga0496124_0002066 Ga0496124_0002066_21026_21766 246
538 3300048927 Ga0496124_0002341 Ga0496124_0002341_16426_17178 246
539 3300048927 Ga0496124_0003850 Ga0496124_0003850_6362_7114 246
540 3300048927 Ga0496124_0012838 Ga0496124_0012838_2855_3607 246
541 3300048927 Ga0496124_0040202 Ga0496124_0040202_2232_2972 246
542 3300048927 Ga0496124_0085649 Ga0496124_0085649_1209_1949 246
543 3300048929 Ga0496126_0000242 Ga0496126_0000242_49609_50349 246
544 3300048929 Ga0496126_0000885 Ga0496126_0000885_47108_47848 246
545 3300048929 Ga0496126_0028428 Ga0496126_0028428_275_1015 246
546 3300048929 Ga0496126_0077999 Ga0496126_0077999_350_1090 246
547 3300048929 Ga0496126_0189789 Ga0496126_0189789_940_1680 246
548 3300049459 Ga0495678_000007 Ga0495678_000007_126300_127040 246
549 3300049459 Ga0495678_000303 Ga0495678_000303_41073_41825 246
550 3300049459 Ga0495678_003456 Ga0495678_003456_2514_3254 246
551 3300049459 Ga0495678_003892 Ga0495678_003892_904_1644 246
552 3300049459 Ga0495678_005361 Ga0495678_005361_3547_4287 246
553 3300049459 Ga0495678_037520 Ga0495678_037520_790_1530 246
554 3300049459 Ga0495678_123001 Ga0495678_123001_37_777 246
555 3300049460 Ga0495682_0000051 Ga0495682_0000051_77187_77939 246
556 3300049460 Ga0495682_0003542 Ga0495682_0003542_2123_2863 246
557 3300049460 Ga0495682_0006536 Ga0495682_0006536_2256_2996 246
558 3300049460 Ga0495682_0012050 Ga0495682_0012050_1329_2069 246
559 3300049535 Ga0501319_000011 Ga0501319_000011_3730_4470 246
560 3300049669 Ga0501235_014478 Ga0501235_014478_974_1714 246
561 3300053125 Ga0500618_002193 Ga0500618_002193_156_896 246
562 3300053140 Ga0500573_0004057 Ga0500573_0004057_343_1083 246
563 iso_pu_bacteria 2599185307 2599971316 246
564 iso_pu_bacteria 2600255283 2601624792 246
565 iso_pu_bacteria 2738541271 2738688818 246
566 iso_pu_bacteria 2738543016 2739264871 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

1

189

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

5

211

0.91

PF08659

KR

KR domain

1

175

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cdh-assembly1.cif.gz_G architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9199 1 224
8g93-assembly1.cif.gz_A crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9182 2 234
3d5q-assembly3.cif.gz_C crystal structure of 11b-hsd1 in complex with triazole inhibitor 0.9171 2 221
8g9v-assembly3.cif.gz_F crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.917 2 230
3dwf-assembly1.cif.gz_B crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e 0.9163 2 221
ID Description Score Start End Superfamily
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 4 243 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9521 4 243 3.40.50.720
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9472 2 243 3.40.50.720
af_Q8N3Y7_32_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9359 2 239 3.40.50.720
af_P9WGR7_3_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9344 2 240 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M4FVC3-F1-model_v4 deleted 0.9989 1 168
AF-A0A3M3WRQ3-F1-model_v4 Integral membrane protein 0.9986 1 183 GO:0005886
GO:0016491
AF-A0A535H5X8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9963 3 183 GO:0016020
GO:0016491
AF-A0A423L5U2-F1-model_v4 Short-chain dehydrogenase 0.9957 1 246 GO:0016020
GO:0016491
AF-A0A2R7T8Q7-F1-model_v4 deleted 0.994 1 155

Feature Viewer

pLDDT pTM Quality
94.28 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map