F464364

General Info

Members Datasets Scaffolds Average Seq Length
566 372 1132 96

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10165579|Ga0081538_101655792
Length 109
Sequence MTWKKLVIPLAIAPRRRAVATALIYGLSLAVRFTSAAGEETEIPAPAVQGFNPMTSIMINDGGQLLYRNWPAKPAQPIALNRGWPLGPRSCRTACESHVPISAMPSCPP

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
246 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
251 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
252 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
253 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
256 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
259 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
269 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
277 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
278 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
279 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
280 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
281 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
285 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
288 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
289 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
290 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
291 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
292 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
295 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
298 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
299 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
300 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
301 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
302 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
303 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
304 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
305 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
306 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
307 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
308 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
309 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
310 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
311 2791355199
312 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
313 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
314 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
315 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
316 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
317 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
318 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
319 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
320 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
321 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
322 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
323 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
324 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
325 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
326 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
327 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
328 2922368715
329 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
330 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
331 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
332 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
333 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
334 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
335 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
336 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
337 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
338 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
339 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
340 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
341 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
342 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
343 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
344 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
345 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
346 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
347 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
348 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
349 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
350 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
351 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
352 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
353 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
354 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
355 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
356 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
357 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
358 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
359 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
360 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
361 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
362 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
363 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
364 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
365 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
366 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
367 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
368 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
369 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
370 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
371 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
372 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.41
Metatranscriptomes 0
Isolates 12.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.2
Nodule 10.78
Rhizoplane 5.83
Rhizosphere 51.24
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10165579 3300005981 Bacteria 974
2 JGI24738J21930_10023504 3300002075 Bacteria 1269
3 JGI24742J22300_10046256 3300002244 Bacteria 782
4 JGI25406J46586_10000004 3300003203 Bacteria 149772
5 JGI25165J46597_1003750 3300003214 Bacteria 3589
6 JGI25153J46596_10004056 3300003215 Bacteria 7977
7 JGI25153J46596_10109263 3300003215 Bacteria 638
8 rootH2_10023784 3300003320 Bacteria 4433
9 rootH2_10085077 3300003320 Bacteria 1832
10 rootH1_10131935 3300003323 Bacteria 4107
11 JGI25160J50197_1000497 3300003354 Bacteria 23466
12 JGI25160J50197_1020730 3300003354 Bacteria 1974
13 JGI25404J52841_10010027 3300003659 Bacteria 2033
14 JGI25404J52841_10058768 3300003659 Bacteria 806
15 Ga0055526_1029257 3300003771 Bacteria 1640
16 Ga0055543_1000952 3300004625 Bacteria 13249
17 Ga0065165_1000853 3300005262 Bacteria 39889
18 Ga0065165_1002106 3300005262 Bacteria 18195
19 Ga0065715_10199971 3300005293 Bacteria 1367
20 Ga0070658_11224434 3300005327 Bacteria 652
21 Ga0070690_101281403 3300005330 Bacteria 587
22 Ga0070670_100457334 3300005331 Bacteria 1132
23 Ga0070666_10152791 3300005335 Bacteria 1611
24 Ga0068868_100866687 3300005338 Bacteria 819
25 Ga0070660_101347811 3300005339 Bacteria 606
26 Ga0070689_100454835 3300005340 Bacteria 1090
27 Ga0070661_100935194 3300005344 Bacteria 717
28 Ga0070668_100048206 3300005347 Bacteria 3276
29 Ga0070668_100659899 3300005347 Bacteria 920
30 Ga0070668_102154999 3300005347 Bacteria 515
31 Ga0070669_100676320 3300005353 Bacteria 870
32 Ga0070675_100783518 3300005354 Bacteria 871
33 Ga0070671_100458838 3300005355 Bacteria 1093
34 Ga0070671_100722776 3300005355 Bacteria 865
35 Ga0070671_101309621 3300005355 Bacteria 639
36 Ga0070674_101005421 3300005356 Bacteria 732
37 Ga0070673_101871295 3300005364 Bacteria 569
38 Ga0070659_100752803 3300005366 Bacteria 845
39 Ga0070667_100377116 3300005367 Bacteria 1288
40 Ga0070667_100526552 3300005367 Bacteria 1085
41 Ga0070709_10001058 3300005434 Bacteria 15188
42 Ga0070709_10028436 3300005434 Bacteria 3334
43 Ga0070709_10880584 3300005434 Bacteria 707
44 Ga0070714_100010925 3300005435 Bacteria 7190
45 Ga0070714_100012268 3300005435 Bacteria 6836
46 Ga0070714_100660245 3300005435 Bacteria 1007
47 Ga0070713_100015089 3300005436 Bacteria 5757
48 Ga0070713_100180196 3300005436 Bacteria 1898
49 Ga0070710_10000144 3300005437 Bacteria 32895
50 Ga0070710_11008763 3300005437 Bacteria 607
51 Ga0070710_11501284 3300005437 Bacteria 506
52 Ga0070711_100325374 3300005439 Bacteria 1229
53 Ga0070711_100498283 3300005439 Bacteria 1004
54 Ga0070700_100081316 3300005441 Bacteria 2093
55 Ga0070663_100060813 3300005455 Bacteria 2718
56 Ga0070663_100530178 3300005455 Bacteria 982
57 Ga0070678_100829809 3300005456 Bacteria 841
58 Ga0070662_100087564 3300005457 Bacteria 2332
59 Ga0068867_101408345 3300005459 Bacteria 647
60 Ga0070706_100099900 3300005467 Bacteria 2696
61 Ga0070698_100252964 3300005471 Bacteria 1694
62 Ga0070699_100300884 3300005518 Bacteria 1439
63 Ga0070684_100776386 3300005535 Bacteria 895
64 Ga0068853_100251854 3300005539 Bacteria 1621
65 Ga0068853_100388200 3300005539 Bacteria 1305
66 Ga0068853_100448592 3300005539 Bacteria 1213
67 Ga0068853_101141306 3300005539 Bacteria 752
68 Ga0068853_101155949 3300005539 Bacteria 747
69 Ga0070672_100351916 3300005543 Bacteria 1256
70 Ga0070696_100423816 3300005546 Bacteria 1045
71 Ga0070665_100020048 3300005548 Bacteria 6713
72 Ga0070665_100104656 3300005548 Bacteria 2832
73 Ga0070665_101159466 3300005548 Bacteria 784
74 Ga0070704_101097792 3300005549 Bacteria 722
75 Ga0068855_100039754 3300005563 Bacteria 5584
76 Ga0070664_100135526 3300005564 Bacteria 2165
77 Ga0070664_101745762 3300005564 Bacteria 590
78 Ga0068857_100154847 3300005577 Bacteria 2078
79 Ga0068857_101168157 3300005577 Bacteria 745
80 Ga0068854_100849975 3300005578 Bacteria 799
81 Ga0068856_100346661 3300005614 Bacteria 1504
82 Ga0068856_100589213 3300005614 Bacteria 1133
83 Ga0068856_101388257 3300005614 Bacteria 717
84 Ga0068856_102366330 3300005614 Bacteria 539
85 Ga0070702_101503112 3300005615 Bacteria 554
86 Ga0068852_100225597 3300005616 Bacteria 1784
87 Ga0068859_101788199 3300005617 Bacteria 679
88 Ga0068864_101082676 3300005618 Bacteria 797
89 Ga0068864_101483204 3300005618 Bacteria 681
90 Ga0068861_100717085 3300005719 Bacteria 931
91 Ga0068863_100138368 3300005841 Bacteria 2327
92 Ga0068863_100397299 3300005841 Bacteria 1348
93 Ga0068858_100158006 3300005842 Bacteria 2134
94 Ga0068858_100158770 3300005842 Bacteria 2129
95 Ga0068858_100214569 3300005842 Bacteria 1822
96 Ga0068858_100571818 3300005842 Bacteria 1095
97 Ga0068860_101026466 3300005843 Bacteria 843
98 Ga0068862_100386925 3300005844 Bacteria 1306
99 Ga0068862_100850989 3300005844 Bacteria 894
100 Ga0081455_10010170 3300005937 Bacteria 9580
101 Ga0081455_10773464 3300005937 Bacteria 605
102 Ga0081540_1000466 3300005983 Bacteria 40082
103 Ga0081540_1001170 3300005983 Bacteria 23013
104 Ga0081540_1004977 3300005983 Bacteria 9991
105 Ga0081540_1018579 3300005983 Bacteria 4258
106 Ga0081539_10000080 3300005985 Bacteria 222745
107 Ga0070717_10009089 3300006028 Bacteria 7461
108 Ga0075365_10011767 3300006038 Bacteria 5161
109 Ga0075365_10023148 3300006038 Bacteria 3903
110 Ga0075365_10082249 3300006038 Bacteria 2183
111 Ga0075365_10362876 3300006038 Bacteria 1021
112 Ga0075368_10049808 3300006042 Bacteria 1663
113 Ga0075368_10183003 3300006042 Bacteria 883
114 Ga0075368_10204740 3300006042 Bacteria 835
115 Ga0075363_100095845 3300006048 Bacteria 1638
116 Ga0075363_101001481 3300006048 Bacteria 515
117 Ga0075364_10010669 3300006051 Bacteria 5556
118 Ga0075364_10350006 3300006051 Bacteria 1007
119 Ga0075364_10617728 3300006051 Bacteria 740
120 Ga0070715_10114149 3300006163 Bacteria 1279
121 Ga0070716_100025095 3300006173 Bacteria 3177
122 Ga0070716_100196511 3300006173 Bacteria 1337
123 Ga0070712_100004935 3300006175 Bacteria 8253
124 Ga0075367_10055596 3300006178 Bacteria 2349
125 Ga0075367_10101853 3300006178 Bacteria 1756
126 Ga0075367_10129244 3300006178 Bacteria 1561
127 Ga0075367_10330957 3300006178 Bacteria 960
128 Ga0075367_10781618 3300006178 Bacteria 608
129 Ga0075369_10063093 3300006186 Bacteria 1620
130 Ga0075369_10398259 3300006186 Bacteria 649
131 Ga0075366_10003061 3300006195 Bacteria 8732
132 Ga0097621_100204658 3300006237 Bacteria 1715
133 Ga0097621_101888128 3300006237 Bacteria 570
134 Ga0075370_10004952 3300006353 Bacteria 6546
135 Ga0075370_10205730 3300006353 Bacteria 1161
136 Ga0075370_10270952 3300006353 Bacteria 1008
137 Ga0075370_10870393 3300006353 Bacteria 550
138 Ga0068871_100166758 3300006358 Bacteria 1886
139 Ga0068871_101270419 3300006358 Bacteria 692
140 Ga0068865_100760034 3300006881 Bacteria 833
141 Ga0097620_100302441 3300006931 Bacteria 1693
142 Ga0097620_101788265 3300006931 Bacteria 679
143 Ga0105250_10322296 3300009092 Bacteria 672
144 Ga0105240_12145828 3300009093 Bacteria 580
145 Ga0105245_11290281 3300009098 Bacteria 779
146 Ga0105247_10003530 3300009101 Bacteria 10170
147 Ga0105247_10047009 3300009101 Bacteria 2650
148 Ga0105247_10060832 3300009101 Bacteria 2341
149 Ga0105247_10100137 3300009101 Bacteria 1852
150 Ga0105243_10573783 3300009148 Bacteria 1082
151 Ga0105241_10578183 3300009174 Bacteria 1012
152 Ga0105241_11615873 3300009174 Bacteria 627
153 Ga0105242_10394415 3300009176 Bacteria 1290
154 Ga0105242_10581245 3300009176 Bacteria 1079
155 Ga0105248_10022937 3300009177 Bacteria 6931
156 Ga0105248_10059805 3300009177 Bacteria 4280
157 Ga0105248_10878519 3300009177 Bacteria 1012
158 Ga0105237_10096969 3300009545 Bacteria 2939
159 Ga0105237_10099133 3300009545 Bacteria 2905
160 Ga0105237_10119331 3300009545 Bacteria 2631
161 Ga0105237_10162500 3300009545 Bacteria 2232
162 Ga0105237_10282564 3300009545 Bacteria 1662
163 Ga0105238_10107002 3300009551 Bacteria 2778
164 Ga0105238_10583855 3300009551 Bacteria 1124
165 Ga0105238_10769556 3300009551 Bacteria 977
166 Ga0105238_10998047 3300009551 Bacteria 858
167 Ga0105249_11163529 3300009553 Bacteria 842
168 Ga0105249_12002213 3300009553 Bacteria 652
169 Ga0105239_10049987 3300010375 Bacteria 4585
170 Ga0105239_10183665 3300010375 Bacteria 2340
171 Ga0105239_10258116 3300010375 Bacteria 1958
172 Ga0105239_10359566 3300010375 Bacteria 1644
173 Ga0105239_10799798 3300010375 Bacteria 1080
174 Ga0105239_13602396 3300010375 Bacteria 503
175 Ga0105246_10034812 3300011119 Bacteria 3359
176 Ga0157374_10318383 3300013296 Bacteria 1541
177 Ga0157374_12016206 3300013296 Bacteria 603
178 Ga0157378_10008804 3300013297 Bacteria 8785
179 Ga0157378_12460020 3300013297 Bacteria 573
180 Ga0163162_10079922 3300013306 Bacteria 3336
181 Ga0163162_10226873 3300013306 Bacteria 1998
182 Ga0157375_10028075 3300013308 Bacteria 5270
183 Ga0157375_11825851 3300013308 Bacteria 721
184 Ga0163163_10160549 3300014325 Bacteria 2293
185 Ga0157379_10163102 3300014968 Bacteria 2012
186 Ga0157376_10269163 3300014969 Bacteria 1600
187 Ga0163161_10988871 3300017792 Bacteria 718
188 Ga0209233_1001474 3300025261 Bacteria 9278
189 Ga0209673_1040922 3300025273 Bacteria 1321
190 Ga0209564_1001604 3300025295 Bacteria 22024
191 Ga0209758_1001198 3300025297 Bacteria 32768
192 Ga0209758_1068984 3300025297 Bacteria 1123
193 Ga0209256_1026700 3300025299 Bacteria 1658
194 Ga0209256_1091607 3300025299 Bacteria 645
195 Ga0207426_1000519 3300025302 Bacteria 56155
196 Ga0207426_1002935 3300025302 Bacteria 10037
197 Ga0207426_1015784 3300025302 Bacteria 2733
198 Ga0207426_1075331 3300025302 Bacteria 929
199 Ga0209257_1010891 3300025304 Bacteria 4496
200 Ga0209257_1018646 3300025304 Bacteria 2655
201 Ga0207697_10326339 3300025315 Bacteria 681
202 Ga0207697_10429150 3300025315 Bacteria 586
203 Ga0207692_10000215 3300025898 Bacteria 19463
204 Ga0207692_10280932 3300025898 Bacteria 1007
205 Ga0207692_11039268 3300025898 Unclassified 542
206 Ga0207710_10042633 3300025900 Bacteria 2016
207 Ga0207710_10079510 3300025900 Bacteria 1519
208 Ga0207710_10191835 3300025900 Bacteria 1006
209 Ga0207710_10273814 3300025900 Bacteria 848
210 Ga0207688_10360990 3300025901 Bacteria 896
211 Ga0207680_10093245 3300025903 Bacteria 1920
212 Ga0207647_10011728 3300025904 Bacteria 6134
213 Ga0207685_10043823 3300025905 Bacteria 1688
214 Ga0207699_10001468 3300025906 Bacteria 11197
215 Ga0207699_10024067 3300025906 Bacteria 3324
216 Ga0207699_10213143 3300025906 Bacteria 1314
217 Ga0207684_10078176 3300025910 Bacteria 2814
218 Ga0207695_11078010 3300025913 Bacteria 683
219 Ga0207671_10068143 3300025914 Bacteria 2651
220 Ga0207671_10156701 3300025914 Bacteria 1762
221 Ga0207671_10256251 3300025914 Bacteria 1376
222 Ga0207671_10684477 3300025914 Bacteria 816
223 Ga0207693_10009787 3300025915 Bacteria 7805
224 Ga0207663_10051004 3300025916 Bacteria 2574
225 Ga0207663_10767706 3300025916 Bacteria 766
226 Ga0207681_10092172 3300025923 Bacteria 2166
227 Ga0207694_10069814 3300025924 Bacteria 2745
228 Ga0207694_10374331 3300025924 Bacteria 1181
229 Ga0207694_10491009 3300025924 Bacteria 1028
230 Ga0207650_10794214 3300025925 Bacteria 802
231 Ga0207687_10822424 3300025927 Bacteria 793
232 Ga0207700_10010501 3300025928 Bacteria 5847
233 Ga0207700_10030499 3300025928 Bacteria 3820
234 Ga0207700_10140211 3300025928 Bacteria 1986
235 Ga0207664_10044625 3300025929 Bacteria 3472
236 Ga0207664_10128193 3300025929 Bacteria 2132
237 Ga0207644_10221245 3300025931 Bacteria 1501
238 Ga0207644_10820692 3300025931 Bacteria 778
239 Ga0207706_10115110 3300025933 Bacteria 2365
240 Ga0207686_11463448 3300025934 Bacteria 563
241 Ga0207669_10738171 3300025937 Bacteria 812
242 Ga0207665_10007952 3300025939 Bacteria 7001
243 Ga0207665_10259805 3300025939 Bacteria 1286
244 Ga0207711_10911304 3300025941 Bacteria 817
245 Ga0207679_10246408 3300025945 Bacteria 1517
246 Ga0207679_11255621 3300025945 Bacteria 680
247 Ga0207667_10116721 3300025949 Bacteria 2750
248 Ga0207667_11038354 3300025949 Bacteria 805
249 Ga0207668_10128944 3300025972 Bacteria 1928
250 Ga0207640_11163139 3300025981 Bacteria 685
251 Ga0207658_10159723 3300025986 Bacteria 1846
252 Ga0207658_10579650 3300025986 Bacteria 1006
253 Ga0207703_10080104 3300026035 Bacteria 2719
254 Ga0207703_10141432 3300026035 Bacteria 2089
255 Ga0207639_10243446 3300026041 Bacteria 1565
256 Ga0207639_11011254 3300026041 Bacteria 779
257 Ga0207639_11955676 3300026041 Bacteria 547
258 Ga0207678_10020242 3300026067 Bacteria 5841
259 Ga0207702_10098816 3300026078 Bacteria 2572
260 Ga0207702_11002261 3300026078 Bacteria 829
261 Ga0207641_10149885 3300026088 Bacteria 2112
262 Ga0207641_10272083 3300026088 Bacteria 1590
263 Ga0207641_10285467 3300026088 Bacteria 1554
264 Ga0207676_10235312 3300026095 Bacteria 1640
265 Ga0207674_10118143 3300026116 Bacteria 2622
266 Ga0207674_10795163 3300026116 Bacteria 913
267 Ga0207675_100367634 3300026118 Bacteria 1412
268 Ga0207698_11086490 3300026142 Bacteria 812
269 Ga0207698_11145400 3300026142 Bacteria 791
270 Ga0209813_10192609 3300027866 Bacteria 751
271 Ga0209813_10292310 3300027866 Bacteria 631
272 Ga0268266_10013214 3300028379 Bacteria 7118
273 Ga0268266_11210667 3300028379 Bacteria 730
274 Ga0268265_11035968 3300028380 Bacteria 812
275 Ga0268264_10294131 3300028381 Bacteria 1526
276 Ga0268264_11488423 3300028381 Bacteria 688
277 Ga0307517_10224844 3300028786 Bacteria 1135
278 Ga0307511_10208848 3300030521 Bacteria 1000
279 Ga0307509_10038625 3300031507 Bacteria 5206
280 Ga0307509_10841190 3300031507 Bacteria 582
281 Ga0307508_10005936 3300031616 Bacteria 11519
282 Ga0307516_10430361 3300031730 Bacteria 977
283 Ga0307507_10008397 3300033179 Bacteria 14309
284 Ga0307510_10003194 3300033180 Bacteria 19031
285 Ga0307510_10069266 3300033180 Bacteria 3535
286 Ga0373938_0027597 3300034957 Bacteria 1195
287 Ga0373928_0107217 3300035084 Bacteria 735
288 Ga0373952_0045704 3300035092 Bacteria 1027
289 Ga0373941_0228689 3300035115 Bacteria 718
290 Ga0373943_0660631 3300035170 Bacteria 618
291 Ga0373962_0007930 3300035242 Bacteria 2607
292 Ga0373931_0012569 3300035691 Bacteria 4104
293 Ga0373935_0136607 3300035692 Bacteria 1652
294 Ga0373927_0026597 3300035695 Bacteria 3782
295 Ga0373927_0028736 3300035695 Bacteria 3627
296 Ga0373927_0791382 3300035695 Bacteria 626
297 Ga0373947_0565060 3300035725 Bacteria 775
298 Ga0373937_0230852 3300036401 Bacteria 1743
299 Ga0373925_0146267 3300037068 Bacteria 1853
300 Ga0466963_0089949 3300044694 Bacteria 2089
301 Ga0495592_0147824 3300046454 Bacteria 1628
302 Ga0495603_0093449 3300046455 Bacteria 1758
303 Ga0495603_0400021 3300046455 Bacteria 787
304 Ga0495638_0105386 3300046460 Bacteria 1680
305 Ga0495641_0536681 3300046461 Bacteria 534
306 Ga0495650_0058165 3300046471 Bacteria 1562
307 Ga0495583_0346254 3300046506 Bacteria 587
308 Ga0495606_0131549 3300046507 Bacteria 1487
309 Ga0495606_0285172 3300046507 Bacteria 901
310 Ga0495608_0434841 3300046511 Bacteria 800
311 Ga0495610_0244674 3300046512 Bacteria 713
312 Ga0495616_0031875 3300046513 Bacteria 2757
313 Ga0495616_0185925 3300046513 Bacteria 921
314 Ga0495628_0495524 3300046516 Bacteria 883
315 Ga0495631_0186319 3300046518 Bacteria 889
316 Ga0495632_0380928 3300046519 Bacteria 618
317 Ga0495648_0027362 3300046524 Bacteria 3819
318 Ga0495652_0089451 3300046529 Bacteria 2521
319 Ga0495640_0582973 3300046533 Bacteria 676
320 Ga0495609_0137462 3300046538 Bacteria 1044
321 Ga0495597_0157861 3300046542 Bacteria 927
322 Ga0495622_0048031 3300046557 Bacteria 1983
323 Ga0495667_0331396 3300046559 Bacteria 963
324 Ga0495668_0228168 3300046616 Bacteria 1020
325 Ga0495668_0690630 3300046616 Bacteria 564
326 Ga0495611_0143261 3300046648 Bacteria 1116
327 Ga0495625_0140724 3300046660 Bacteria 1628
328 Ga0495661_0230992 3300046665 Bacteria 954
329 Ga0495661_0605293 3300046665 Bacteria 515
330 Ga0495588_0002625 3300046674 Bacteria 7697
331 Ga0495624_0376084 3300046690 Bacteria 854
332 Ga0495624_0552051 3300046690 Bacteria 688
333 Ga0495649_0065386 3300046694 Bacteria 1952
334 Ga0495649_0254140 3300046694 Bacteria 902
335 Ga0495589_0126485 3300046794 Bacteria 1229
336 Ga0495660_0396753 3300046810 Bacteria 605
337 Ga0495581_0378633 3300047315 Bacteria 826
338 Ga0495674_0589420 3300047319 Bacteria 882
339 Ga0495674_0907679 3300047319 Bacteria 680
340 Ga0495676_0146480 3300047321 Bacteria 1686
341 Ga0495687_009248 3300047443 Bacteria 5532
342 Ga0495675_0175136 3300047444 Bacteria 1316
343 Ga0495673_0119027 3300047469 Bacteria 1047
344 Ga0495673_0363017 3300047469 Bacteria 509
345 Ga0495686_0086394 3300047472 Bacteria 1909
346 Ga0495602_0411395 3300048088 Bacteria 962
347 Ga0495626_0107036 3300048091 Bacteria 1214
348 Ga0496100_0014569 3300048903 Bacteria 4568
349 Ga0496100_0044166 3300048903 Bacteria 2853
350 Ga0496101_0020397 3300048904 Bacteria 4536
351 Ga0496101_0267410 3300048904 Bacteria 1334
352 Ga0496102_0690876 3300048905 Bacteria 943
353 Ga0496103_0020726 3300048906 Bacteria 3952
354 Ga0496104_0030896 3300048907 Bacteria 4980
355 Ga0496104_0046967 3300048907 Bacteria 4068
356 Ga0496104_0081626 3300048907 Bacteria 3084
357 Ga0496105_0012970 3300048908 Bacteria 6604
358 Ga0496105_0065362 3300048908 Bacteria 3002
359 Ga0496105_0200395 3300048908 Bacteria 1629
360 Ga0496105_0296493 3300048908 Bacteria 1301
361 Ga0496106_0004534 3300048909 Bacteria 10292
362 Ga0496106_0141867 3300048909 Bacteria 1890
363 Ga0496107_0144683 3300048910 Bacteria 1757
364 Ga0496107_0303816 3300048910 Bacteria 1188
365 Ga0496108_0087191 3300048911 Bacteria 2651
366 Ga0496108_1368010 3300048911 Bacteria 593
367 Ga0496109_0062679 3300048912 Bacteria 3401
368 Ga0496109_0092336 3300048912 Bacteria 2800
369 Ga0496110_0024708 3300048913 Bacteria 5124
370 Ga0496110_0033602 3300048913 Bacteria 4438
371 Ga0496110_0062931 3300048913 Bacteria 3278
372 Ga0496111_0025520 3300048914 Bacteria 4170
373 Ga0496112_0038861 3300048915 Bacteria 4649
374 Ga0496112_0050666 3300048915 Bacteria 4072
375 Ga0496112_0116520 3300048915 Bacteria 2642
376 Ga0496113_0024311 3300048916 Bacteria 4304
377 Ga0496114_0037980 3300048917 Bacteria 3983
378 Ga0496114_0222181 3300048917 Bacteria 1658
379 Ga0496115_0053067 3300048918 Bacteria 3253
380 Ga0496115_0774736 3300048918 Bacteria 748
381 Ga0496116_0095196 3300048919 Bacteria 1798
382 Ga0496116_0457427 3300048919 Bacteria 544
383 Ga0496117_0099484 3300048920 Bacteria 1845
384 Ga0496118_0067040 3300048921 Bacteria 2617
385 Ga0496118_0127637 3300048921 Bacteria 1640
386 Ga0496120_0065197 3300048923 Bacteria 2019
387 Ga0496121_0002853 3300048924 Bacteria 25499
388 Ga0496121_0145810 3300048924 Bacteria 1749
389 Ga0496121_0570843 3300048924 Bacteria 704
390 Ga0496122_0160631 3300048925 Bacteria 1370
391 Ga0496124_0162827 3300048927 Bacteria 1737
392 Ga0496124_0302364 3300048927 Bacteria 1155
393 Ga0496124_0768836 3300048927 Bacteria 601
394 Ga0496125_0017531 3300048928 Bacteria 6822
395 Ga0496125_0231691 3300048928 Bacteria 1180
396 Ga0496125_0489413 3300048928 Bacteria 695
397 Ga0496126_0040859 3300048929 Bacteria 4297
398 Ga0496126_0104386 3300048929 Bacteria 2476
399 Ga0496126_0112464 3300048929 Bacteria 2371
400 Ga0496126_0220236 3300048929 Bacteria 1594
401 Ga0496126_0268169 3300048929 Bacteria 1417
402 Ga0496126_0773633 3300048929 Bacteria 739
403 Ga0501079_1651707 3300049741 Bacteria 504
404 nmdc:mga00v17_223185_c1 3300050491 Bacteria 1220
405 nmdc:mga00v17_57227_c1 3300050491 Bacteria 2385
406 nmdc:mga00v17_678898_c1 3300050491 Bacteria 661
407 nmdc:mga00v17_764377_c1 3300050491 Bacteria 617
408 nmdc:mga0yw44_5033_c1 3300050492 Bacteria 6175
409 nmdc:mga0yw44_59778_c1 3300050492 Bacteria 2333
410 nmdc:mga0yw44_871915_c1 3300050492 Bacteria 611
411 nmdc:mga0k408_117845_c1 3300050493 Bacteria 1572
412 nmdc:mga0k408_138729_c1 3300050493 Bacteria 1445
413 nmdc:mga06z11_280562_c1 3300050494 Bacteria 987
414 nmdc:mga06z11_446326_c1 3300050494 Bacteria 781
415 nmdc:mga06z11_9068_c1 3300050494 Bacteria 865
416 nmdc:mga04h51_145654_c1 3300050495 Bacteria 902
417 nmdc:mga04h51_337668_c1 3300050495 Bacteria 621
418 nmdc:mga07m45_151686_c1 3300050496 Bacteria 559
419 nmdc:mga07m45_327106_c1 3300050496 Bacteria 891
420 nmdc:mga07m45_771586_c1 3300050496 Bacteria 552
421 nmdc:mga0sz30_298594_c1 3300050516 Bacteria 718
422 Ga0500610_0262338 3300053079 Bacteria 788
423 Ga0500635_0039245 3300053080 Bacteria 1574
424 Ga0495595_0681515 3300053084 Bacteria 527
425 Ga0500578_0636897 3300053086 Bacteria 581
426 Ga0500643_000218 3300053087 Bacteria 53579
427 Ga0500644_0167023 3300053088 Bacteria 893
428 Ga0500646_0143689 3300053090 Bacteria 785
429 Ga0500647_0386107 3300053091 Bacteria 572
430 Ga0500583_0442046 3300053092 Bacteria 618
431 Ga0500651_0242981 3300053093 Bacteria 1049
432 Ga0500651_0403119 3300053093 Bacteria 768
433 Ga0500651_0610610 3300053093 Bacteria 591
434 Ga0500566_0000074 3300053094 Bacteria 48359
435 Ga0500566_0000304 3300053094 Bacteria 26386
436 Ga0500566_0038944 3300053094 Bacteria 2750
437 Ga0500566_0122373 3300053094 Bacteria 1401
438 Ga0500640_074462 3300053095 Bacteria 1451
439 Ga0500641_0057685 3300053096 Bacteria 1611
440 Ga0500650_0238503 3300053098 Bacteria 819
441 Ga0500554_253472 3300053102 Bacteria 579
442 Ga0500556_0159338 3300053104 Bacteria 890
443 Ga0500562_020986 3300053108 Bacteria 1696
444 Ga0500569_015644 3300053109 Bacteria 1904
445 Ga0500569_167470 3300053109 Bacteria 745
446 Ga0500572_000414 3300053111 Bacteria 15011
447 Ga0500572_029632 3300053111 Bacteria 1515
448 Ga0500592_007208 3300053116 Bacteria 1770
449 Ga0500595_070825 3300053119 Bacteria 1035
450 Ga0500607_139628 3300053121 Bacteria 1141
451 Ga0500608_012102 3300053122 Bacteria 3770
452 Ga0500608_198522 3300053122 Bacteria 831
453 Ga0500614_000628 3300053123 Bacteria 8989
454 Ga0500614_006156 3300053123 Bacteria 2521
455 Ga0500621_217500 3300053126 Bacteria 664
456 Ga0500642_0014331 3300053130 Bacteria 2946
457 Ga0500655_102004 3300053133 Bacteria 602
458 Ga0500658_0254249 3300053134 Bacteria 807
459 Ga0500559_0002664 3300053136 Bacteria 9085
460 Ga0500559_0007895 3300053136 Bacteria 4693
461 Ga0500564_051868 3300053138 Bacteria 1875
462 Ga0500568_0089457 3300053139 Bacteria 1162
463 Ga0500577_0449986 3300053142 Bacteria 563
464 Ga0500585_108621 3300053144 Bacteria 996
465 Ga0500588_0230432 3300053146 Bacteria 692
466 Ga0500589_108319 3300053147 Bacteria 1195
467 Ga0500590_093279 3300053148 Bacteria 1458
468 Ga0500603_001659 3300053150 Bacteria 5010
469 Ga0500604_0212478 3300053151 Bacteria 666
470 Ga0500616_0013281 3300053153 Bacteria 4789
471 Ga0500619_098567 3300053154 Bacteria 990
472 Ga0500620_043626 3300053155 Bacteria 1481
473 Ga0500622_0011073 3300053156 Bacteria 4923
474 Ga0500624_125456 3300053157 Bacteria 541
475 Ga0500627_0188412 3300053158 Bacteria 927
476 Ga0500630_002865 3300053159 Bacteria 8311
477 Ga0500633_0051599 3300053160 Bacteria 1421
478 Ga0500638_160672 3300053162 Bacteria 989
479 Ga0500639_000047 3300053163 Bacteria 57835
480 Ga0500636_0001248 3300053177 Bacteria 13780
481 Ga0500636_0085274 3300053177 Bacteria 1814
482 Ga0500636_0462598 3300053177 Bacteria 570
483 Ga0500637_0094826 3300053178 Bacteria 1728
484 Ga0500637_0271657 3300053178 Bacteria 937
485 Ga0500567_065237 3300053723 Bacteria 1616
486 Ga0500645_088600 3300053730 Bacteria 879
487 Ga0500656_068238 3300053732 Bacteria 544
488 Ga0500596_006315 3300053735 Bacteria 2017
489 Ga0500596_064844 3300053735 Bacteria 616
490 Ga0500599_001039 3300053736 Bacteria 3129
491 Ga0500601_000272 3300053737 Bacteria 9780
492 Ga0500661_036561 3300055283 Bacteria 869
493 Ga0500661_042770 3300055283 Bacteria 803
494 2511398146 2511231028 Bacteria 8046582
495 2513680211 2513237098 Bacteria 9902361
496 2513692222 2513237101 Bacteria 7952346
497 2513721671 2513237104 Bacteria 10034502
498 2513873235 2513237139 Bacteria 8737671
499 2517104321 2517093001 Bacteria 9002274
500 2528849890 2528768022 Bacteria 10457665
501 2723845407 2721755755 Bacteria 8322773
502 2793061024 2791355196 Bacteria 7323613
503 2793077765
504 2805914776 2802429603 Bacteria 8777136
505 2818236709 2816332527 Bacteria 8933356
506 2824667499 2824661429 Bacteria 9877870
507 2824700317 2824696289 Bacteria 8335049
508 2824763952 2824763712 Bacteria 9792355
509 2841962763 2841957949 Bacteria 8652217
510 2842043036 2842038055 Bacteria 8002051
511 2842051077 2842045827 Bacteria 8006841
512 2847947137 2847939898 Bacteria 8606328
513 2874607703 2874604998 Bacteria 7834745
514 2874630174 2874628541 Bacteria 8630250
515 2879102038 2879099564 Bacteria 10442239
516 2885383742 2885383462 Bacteria 9473874
517 2888385611 2888378607 Bacteria 9652610
518 2903776274 2903768456 Bacteria 9749579
519 2904720464 2904711408 Bacteria 9771557
520 2922371265
521 2922390692 2922386360 Bacteria 7017218
522 2929619647 2929615660 Bacteria 9193770
523 2929627882 2929624759 Bacteria 9339455
524 2932817075 2932809354 Bacteria 9135765
525 2932822434 2932818245 Bacteria 9955613
526 2932831022 2932828146 Bacteria 9745859
527 2933581566 2933577622 Bacteria 9116884
528 2935624190 2935616580 Bacteria 9032984
529 2935640164 2935638405 Bacteria 10015038
530 2935666998 2935665750 Bacteria 9571747
531 2935680358 2935675223 Bacteria 9928132
532 2935690129 2935684952 Bacteria 9590419
533 2935698798 2935694250 Bacteria 9291695
534 2935699786 2935694250 Bacteria 9291695
535 2935704753 2935703347 Bacteria 10242284
536 2935722158 2935713505 Bacteria 9608509
537 2935731468 2935722832 Bacteria 9608746
538 2935735444 2935732158 Bacteria 9706831
539 2935745285 2935741537 Bacteria 9707219
540 2935755140 2935750917 Bacteria 9590372
541 2935762343 2935760218 Bacteria 9817913
542 2935803844 2935801545 Bacteria 9301974
543 2935811760 2935810662 Bacteria 9401221
544 2935829647 2935827899 Bacteria 10038562
545 2935843021 2935837841 Bacteria 9454360
546 2935862310 2935855204 Bacteria 9035059
547 2935870445 2935864058 Bacteria 9784707
548 2935881027 2935873716 Bacteria 9632195
549 2936004420 2936002035 Bacteria 9362176
550 2936038343 2936037263 Bacteria 9446081
551 2940561580 2940556831 Bacteria 9590747
552 2941544245 2941538514 Bacteria 9402094
553 8006969145 8006964411 Bacteria 8966052
554 8006969873 8006964411 Bacteria 8966052
555 8007002455 8006994254 Bacteria 8309700
556 8016516362 8016511872 Bacteria 9921665
557 8017060174 8017057580 Bacteria 10023680
558 8019558074 8019555841 Bacteria 9642137
559 8019567215 8019565922 Bacteria 9639779
560 8019579691 8019576017 Bacteria 10049540
561 8019587404 8019586578 Bacteria 10212056
562 8019603940 8019597564 Bacteria 10041141
563 8019614592 8019608314 Bacteria 10042931
564 8019679900 8019678201 Bacteria 8863603
565 8055749097 8055742211 Bacteria 9226248
566 8056684454 8056681323 Bacteria 8472857
567 Ga0081538_10165579
568 JGI24738J21930_10023504
569 JGI24742J22300_10046256
570 JGI25406J46586_10000004
571 JGI25165J46597_1003750
572 JGI25153J46596_10004056
573 JGI25153J46596_10109263
574 rootH2_10023784
575 rootH2_10085077
576 rootH1_10131935
577 JGI25160J50197_1000497
578 JGI25160J50197_1020730
579 JGI25404J52841_10010027
580 JGI25404J52841_10058768
581 Ga0055526_1029257
582 Ga0055543_1000952
583 Ga0065165_1000853
584 Ga0065165_1002106
585 Ga0065715_10199971
586 Ga0070658_11224434
587 Ga0070690_101281403
588 Ga0070670_100457334
589 Ga0070666_10152791
590 Ga0068868_100866687
591 Ga0070660_101347811
592 Ga0070689_100454835
593 Ga0070661_100935194
594 Ga0070668_100048206
595 Ga0070668_100659899
596 Ga0070668_102154999
597 Ga0070669_100676320
598 Ga0070675_100783518
599 Ga0070671_100458838
600 Ga0070671_100722776
601 Ga0070671_101309621
602 Ga0070674_101005421
603 Ga0070673_101871295
604 Ga0070659_100752803
605 Ga0070667_100377116
606 Ga0070667_100526552
607 Ga0070709_10001058
608 Ga0070709_10028436
609 Ga0070709_10880584
610 Ga0070714_100010925
611 Ga0070714_100012268
612 Ga0070714_100660245
613 Ga0070713_100015089
614 Ga0070713_100180196
615 Ga0070710_10000144
616 Ga0070710_11008763
617 Ga0070710_11501284
618 Ga0070711_100325374
619 Ga0070711_100498283
620 Ga0070700_100081316
621 Ga0070663_100060813
622 Ga0070663_100530178
623 Ga0070678_100829809
624 Ga0070662_100087564
625 Ga0068867_101408345
626 Ga0070706_100099900
627 Ga0070698_100252964
628 Ga0070699_100300884
629 Ga0070684_100776386
630 Ga0068853_100251854
631 Ga0068853_100388200
632 Ga0068853_100448592
633 Ga0068853_101141306
634 Ga0068853_101155949
635 Ga0070672_100351916
636 Ga0070696_100423816
637 Ga0070665_100020048
638 Ga0070665_100104656
639 Ga0070665_101159466
640 Ga0070704_101097792
641 Ga0068855_100039754
642 Ga0070664_100135526
643 Ga0070664_101745762
644 Ga0068857_100154847
645 Ga0068857_101168157
646 Ga0068854_100849975
647 Ga0068856_100346661
648 Ga0068856_100589213
649 Ga0068856_101388257
650 Ga0068856_102366330
651 Ga0070702_101503112
652 Ga0068852_100225597
653 Ga0068859_101788199
654 Ga0068864_101082676
655 Ga0068864_101483204
656 Ga0068861_100717085
657 Ga0068863_100138368
658 Ga0068863_100397299
659 Ga0068858_100158006
660 Ga0068858_100158770
661 Ga0068858_100214569
662 Ga0068858_100571818
663 Ga0068860_101026466
664 Ga0068862_100386925
665 Ga0068862_100850989
666 Ga0081455_10010170
667 Ga0081455_10773464
668 Ga0081540_1000466
669 Ga0081540_1001170
670 Ga0081540_1004977
671 Ga0081540_1018579
672 Ga0081539_10000080
673 Ga0070717_10009089
674 Ga0075365_10011767
675 Ga0075365_10023148
676 Ga0075365_10082249
677 Ga0075365_10362876
678 Ga0075368_10049808
679 Ga0075368_10183003
680 Ga0075368_10204740
681 Ga0075363_100095845
682 Ga0075363_101001481
683 Ga0075364_10010669
684 Ga0075364_10350006
685 Ga0075364_10617728
686 Ga0070715_10114149
687 Ga0070716_100025095
688 Ga0070716_100196511
689 Ga0070712_100004935
690 Ga0075367_10055596
691 Ga0075367_10101853
692 Ga0075367_10129244
693 Ga0075367_10330957
694 Ga0075367_10781618
695 Ga0075369_10063093
696 Ga0075369_10398259
697 Ga0075366_10003061
698 Ga0097621_100204658
699 Ga0097621_101888128
700 Ga0075370_10004952
701 Ga0075370_10205730
702 Ga0075370_10270952
703 Ga0075370_10870393
704 Ga0068871_100166758
705 Ga0068871_101270419
706 Ga0068865_100760034
707 Ga0097620_100302441
708 Ga0097620_101788265
709 Ga0105250_10322296
710 Ga0105240_12145828
711 Ga0105245_11290281
712 Ga0105247_10003530
713 Ga0105247_10047009
714 Ga0105247_10060832
715 Ga0105247_10100137
716 Ga0105243_10573783
717 Ga0105241_10578183
718 Ga0105241_11615873
719 Ga0105242_10394415
720 Ga0105242_10581245
721 Ga0105248_10022937
722 Ga0105248_10059805
723 Ga0105248_10878519
724 Ga0105237_10096969
725 Ga0105237_10099133
726 Ga0105237_10119331
727 Ga0105237_10162500
728 Ga0105237_10282564
729 Ga0105238_10107002
730 Ga0105238_10583855
731 Ga0105238_10769556
732 Ga0105238_10998047
733 Ga0105249_11163529
734 Ga0105249_12002213
735 Ga0105239_10049987
736 Ga0105239_10183665
737 Ga0105239_10258116
738 Ga0105239_10359566
739 Ga0105239_10799798
740 Ga0105239_13602396
741 Ga0105246_10034812
742 Ga0157374_10318383
743 Ga0157374_12016206
744 Ga0157378_10008804
745 Ga0157378_12460020
746 Ga0163162_10079922
747 Ga0163162_10226873
748 Ga0157375_10028075
749 Ga0157375_11825851
750 Ga0163163_10160549
751 Ga0157379_10163102
752 Ga0157376_10269163
753 Ga0163161_10988871
754 Ga0209233_1001474
755 Ga0209673_1040922
756 Ga0209564_1001604
757 Ga0209758_1001198
758 Ga0209758_1068984
759 Ga0209256_1026700
760 Ga0209256_1091607
761 Ga0207426_1000519
762 Ga0207426_1002935
763 Ga0207426_1015784
764 Ga0207426_1075331
765 Ga0209257_1010891
766 Ga0209257_1018646
767 Ga0207697_10326339
768 Ga0207697_10429150
769 Ga0207692_10000215
770 Ga0207692_10280932
771 Ga0207692_11039268
772 Ga0207710_10042633
773 Ga0207710_10079510
774 Ga0207710_10191835
775 Ga0207710_10273814
776 Ga0207688_10360990
777 Ga0207680_10093245
778 Ga0207647_10011728
779 Ga0207685_10043823
780 Ga0207699_10001468
781 Ga0207699_10024067
782 Ga0207699_10213143
783 Ga0207684_10078176
784 Ga0207695_11078010
785 Ga0207671_10068143
786 Ga0207671_10156701
787 Ga0207671_10256251
788 Ga0207671_10684477
789 Ga0207693_10009787
790 Ga0207663_10051004
791 Ga0207663_10767706
792 Ga0207681_10092172
793 Ga0207694_10069814
794 Ga0207694_10374331
795 Ga0207694_10491009
796 Ga0207650_10794214
797 Ga0207687_10822424
798 Ga0207700_10010501
799 Ga0207700_10030499
800 Ga0207700_10140211
801 Ga0207664_10044625
802 Ga0207664_10128193
803 Ga0207644_10221245
804 Ga0207644_10820692
805 Ga0207706_10115110
806 Ga0207686_11463448
807 Ga0207669_10738171
808 Ga0207665_10007952
809 Ga0207665_10259805
810 Ga0207711_10911304
811 Ga0207679_10246408
812 Ga0207679_11255621
813 Ga0207667_10116721
814 Ga0207667_11038354
815 Ga0207668_10128944
816 Ga0207640_11163139
817 Ga0207658_10159723
818 Ga0207658_10579650
819 Ga0207703_10080104
820 Ga0207703_10141432
821 Ga0207639_10243446
822 Ga0207639_11011254
823 Ga0207639_11955676
824 Ga0207678_10020242
825 Ga0207702_10098816
826 Ga0207702_11002261
827 Ga0207641_10149885
828 Ga0207641_10272083
829 Ga0207641_10285467
830 Ga0207676_10235312
831 Ga0207674_10118143
832 Ga0207674_10795163
833 Ga0207675_100367634
834 Ga0207698_11086490
835 Ga0207698_11145400
836 Ga0209813_10192609
837 Ga0209813_10292310
838 Ga0268266_10013214
839 Ga0268266_11210667
840 Ga0268265_11035968
841 Ga0268264_10294131
842 Ga0268264_11488423
843 Ga0307517_10224844
844 Ga0307511_10208848
845 Ga0307509_10038625
846 Ga0307509_10841190
847 Ga0307508_10005936
848 Ga0307516_10430361
849 Ga0307507_10008397
850 Ga0307510_10003194
851 Ga0307510_10069266
852 Ga0373938_0027597
853 Ga0373928_0107217
854 Ga0373952_0045704
855 Ga0373941_0228689
856 Ga0373943_0660631
857 Ga0373962_0007930
858 Ga0373931_0012569
859 Ga0373935_0136607
860 Ga0373927_0026597
861 Ga0373927_0028736
862 Ga0373927_0791382
863 Ga0373947_0565060
864 Ga0373937_0230852
865 Ga0373925_0146267
866 Ga0466963_0089949
867 Ga0495592_0147824
868 Ga0495603_0093449
869 Ga0495603_0400021
870 Ga0495638_0105386
871 Ga0495641_0536681
872 Ga0495650_0058165
873 Ga0495583_0346254
874 Ga0495606_0131549
875 Ga0495606_0285172
876 Ga0495608_0434841
877 Ga0495610_0244674
878 Ga0495616_0031875
879 Ga0495616_0185925
880 Ga0495628_0495524
881 Ga0495631_0186319
882 Ga0495632_0380928
883 Ga0495648_0027362
884 Ga0495652_0089451
885 Ga0495640_0582973
886 Ga0495609_0137462
887 Ga0495597_0157861
888 Ga0495622_0048031
889 Ga0495667_0331396
890 Ga0495668_0228168
891 Ga0495668_0690630
892 Ga0495611_0143261
893 Ga0495625_0140724
894 Ga0495661_0230992
895 Ga0495661_0605293
896 Ga0495588_0002625
897 Ga0495624_0376084
898 Ga0495624_0552051
899 Ga0495649_0065386
900 Ga0495649_0254140
901 Ga0495589_0126485
902 Ga0495660_0396753
903 Ga0495581_0378633
904 Ga0495674_0589420
905 Ga0495674_0907679
906 Ga0495676_0146480
907 Ga0495687_009248
908 Ga0495675_0175136
909 Ga0495673_0119027
910 Ga0495673_0363017
911 Ga0495686_0086394
912 Ga0495602_0411395
913 Ga0495626_0107036
914 Ga0496100_0014569
915 Ga0496100_0044166
916 Ga0496101_0020397
917 Ga0496101_0267410
918 Ga0496102_0690876
919 Ga0496103_0020726
920 Ga0496104_0030896
921 Ga0496104_0046967
922 Ga0496104_0081626
923 Ga0496105_0012970
924 Ga0496105_0065362
925 Ga0496105_0200395
926 Ga0496105_0296493
927 Ga0496106_0004534
928 Ga0496106_0141867
929 Ga0496107_0144683
930 Ga0496107_0303816
931 Ga0496108_0087191
932 Ga0496108_1368010
933 Ga0496109_0062679
934 Ga0496109_0092336
935 Ga0496110_0024708
936 Ga0496110_0033602
937 Ga0496110_0062931
938 Ga0496111_0025520
939 Ga0496112_0038861
940 Ga0496112_0050666
941 Ga0496112_0116520
942 Ga0496113_0024311
943 Ga0496114_0037980
944 Ga0496114_0222181
945 Ga0496115_0053067
946 Ga0496115_0774736
947 Ga0496116_0095196
948 Ga0496116_0457427
949 Ga0496117_0099484
950 Ga0496118_0067040
951 Ga0496118_0127637
952 Ga0496120_0065197
953 Ga0496121_0002853
954 Ga0496121_0145810
955 Ga0496121_0570843
956 Ga0496122_0160631
957 Ga0496124_0162827
958 Ga0496124_0302364
959 Ga0496124_0768836
960 Ga0496125_0017531
961 Ga0496125_0231691
962 Ga0496125_0489413
963 Ga0496126_0040859
964 Ga0496126_0104386
965 Ga0496126_0112464
966 Ga0496126_0220236
967 Ga0496126_0268169
968 Ga0496126_0773633
969 Ga0501079_1651707
970 nmdc:mga00v17_223185_c1
971 nmdc:mga00v17_57227_c1
972 nmdc:mga00v17_678898_c1
973 nmdc:mga00v17_764377_c1
974 nmdc:mga0yw44_5033_c1
975 nmdc:mga0yw44_59778_c1
976 nmdc:mga0yw44_871915_c1
977 nmdc:mga0k408_117845_c1
978 nmdc:mga0k408_138729_c1
979 nmdc:mga06z11_280562_c1
980 nmdc:mga06z11_446326_c1
981 nmdc:mga06z11_9068_c1
982 nmdc:mga04h51_145654_c1
983 nmdc:mga04h51_337668_c1
984 nmdc:mga07m45_151686_c1
985 nmdc:mga07m45_327106_c1
986 nmdc:mga07m45_771586_c1
987 nmdc:mga0sz30_298594_c1
988 Ga0500610_0262338
989 Ga0500635_0039245
990 Ga0495595_0681515
991 Ga0500578_0636897
992 Ga0500643_000218
993 Ga0500644_0167023
994 Ga0500646_0143689
995 Ga0500647_0386107
996 Ga0500583_0442046
997 Ga0500651_0242981
998 Ga0500651_0403119
999 Ga0500651_0610610
1000 Ga0500566_0000074
1001 Ga0500566_0000304
1002 Ga0500566_0038944
1003 Ga0500566_0122373
1004 Ga0500640_074462
1005 Ga0500641_0057685
1006 Ga0500650_0238503
1007 Ga0500554_253472
1008 Ga0500556_0159338
1009 Ga0500562_020986
1010 Ga0500569_015644
1011 Ga0500569_167470
1012 Ga0500572_000414
1013 Ga0500572_029632
1014 Ga0500592_007208
1015 Ga0500595_070825
1016 Ga0500607_139628
1017 Ga0500608_012102
1018 Ga0500608_198522
1019 Ga0500614_000628
1020 Ga0500614_006156
1021 Ga0500621_217500
1022 Ga0500642_0014331
1023 Ga0500655_102004
1024 Ga0500658_0254249
1025 Ga0500559_0002664
1026 Ga0500559_0007895
1027 Ga0500564_051868
1028 Ga0500568_0089457
1029 Ga0500577_0449986
1030 Ga0500585_108621
1031 Ga0500588_0230432
1032 Ga0500589_108319
1033 Ga0500590_093279
1034 Ga0500603_001659
1035 Ga0500604_0212478
1036 Ga0500616_0013281
1037 Ga0500619_098567
1038 Ga0500620_043626
1039 Ga0500622_0011073
1040 Ga0500624_125456
1041 Ga0500627_0188412
1042 Ga0500630_002865
1043 Ga0500633_0051599
1044 Ga0500638_160672
1045 Ga0500639_000047
1046 Ga0500636_0001248
1047 Ga0500636_0085274
1048 Ga0500636_0462598
1049 Ga0500637_0094826
1050 Ga0500637_0271657
1051 Ga0500567_065237
1052 Ga0500645_088600
1053 Ga0500656_068238
1054 Ga0500596_006315
1055 Ga0500596_064844
1056 Ga0500599_001039
1057 Ga0500601_000272
1058 Ga0500661_036561
1059 Ga0500661_042770
1060 2511398146
1061 2513680211
1062 2513692222
1063 2513721671
1064 2513873235
1065 2517104321
1066 2528849890
1067 2723845407
1068 2793061024
1069 2793077765
1070 2805914776
1071 2818236709
1072 2824667499
1073 2824700317
1074 2824763952
1075 2841962763
1076 2842043036
1077 2842051077
1078 2847947137
1079 2874607703
1080 2874630174
1081 2879102038
1082 2885383742
1083 2888385611
1084 2903776274
1085 2904720464
1086 2922371265
1087 2922390692
1088 2929619647
1089 2929627882
1090 2932817075
1091 2932822434
1092 2932831022
1093 2933581566
1094 2935624190
1095 2935640164
1096 2935666998
1097 2935680358
1098 2935690129
1099 2935698798
1100 2935699786
1101 2935704753
1102 2935722158
1103 2935731468
1104 2935735444
1105 2935745285
1106 2935755140
1107 2935762343
1108 2935803844
1109 2935811760
1110 2935829647
1111 2935843021
1112 2935862310
1113 2935870445
1114 2935881027
1115 2936004420
1116 2936038343
1117 2940561580
1118 2941544245
1119 8006969145
1120 8006969873
1121 8007002455
1122 8016516362
1123 8017060174
1124 8019558074
1125 8019567215
1126 8019579691
1127 8019587404
1128 8019603940
1129 8019614592
1130 8019679900
1131 8055749097
1132 8056684454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map