F464114

General Info

Members Datasets Scaffolds Average Seq Length
563 402 328 398

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581866|2585397322
Length 422
Sequence SQRYGETVGRNVAPGPILAVLEWLAGDECHSIDEAGLVAELGLRLRQIGLPVDRLTLHLMTLHPEILGRTVAWAPSEPVEIHDRDHGIKLEFASSALVKVMETREPIIVDAGDRETPWQHIDVFAGRKLAQLVIAPLCNVDGPVSAAGFGTKRPGGFTLSEVRVIERILPSLRNTCEMRVMRHAELSLLDTYIGPMTAQRILAGKIRQGEIETMQAALLLCDMKGFTEISNRLPEDKVLELLNSYFDVVIPAITRHGGEVLKFMGDAALAFFPTSDALVACQRALASAAEIIANLGVLQQDGTRVDATVALHYGKVSYGNIGSGRRMDFTVIGSDVNLLSRIQTTCSALGASVLMSDTFRRSSGADNVVSTDFHQLKGFADPFELFTIEAKPALKRSPGACGQADCAACFSLNTQGCGASFG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
15 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
16 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
17 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
18 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
19 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
20 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
21 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
22 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
23 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
24 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
25 2519899620 Rhizobium sp. Pop5 Isolate Nodule
26 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
27 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
28 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
29 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
30 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
31 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
32 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
33 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
34 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
35 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
36 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
37 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
38 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
39 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
40 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
41 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
42 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
43 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
44 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
45 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
46 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
47 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
48 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
49 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
50 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
51 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
52 2643221599 Rhizobium sp. Root708 Isolate Unclassified
53 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
54 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
55 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
56 2718217882 Rhizobium sp. N741 Isolate Nodule
57 2718217927 Rhizobium sp. N324 Isolate Nodule
58 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
59 2718218009 Rhizobium sp. N561 Isolate Nodule
60 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
61 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
62 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
63 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
64 2718218363 Rhizobium sp. N113 Isolate Nodule
65 2718218365 Rhizobium sp. N731 Isolate Nodule
66 2718218366 Rhizobium sp. N621 Isolate Nodule
67 2718218423 Rhizobium sp. N941 Isolate Nodule
68 2721755514 Rhizobium sp. N6212 Isolate Nodule
69 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
70 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
71 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
72 2721755809 Rhizobium sp. N541 Isolate Nodule
73 2721755810 Rhizobium sp. N871 Isolate Nodule
74 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
75 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
76 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
77 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
78 2728369365 Rhizobium sp. N1341 Isolate Nodule
79 2728369397 Rhizobium sp. N1314 Isolate Nodule
80 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
81 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
82 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
83 2791355256 Rhizobium sp. M10 Isolate Nodule
84 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
85 2791355261 Rhizobium sp. J15 Isolate Nodule
86 2791355262 Rhizobium sp. M1 Isolate Nodule
87 2791355263 Rhizobium chutanense C5 Isolate Nodule
88 2791355264 Rhizobium sp. S9 Isolate Nodule
89 2791355265 Rhizobium sp. H4 Isolate Nodule
90 2791355266 Rhizobium sp. L43 Isolate Nodule
91 2791355267 Rhizobium sp. L18 Isolate Nodule
92 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
93 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
94 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
95 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
96 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
97 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
98 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
99 2802429633 Rhizobium anhuiense J3 Isolate Nodule
100 2802429634 Rhizobium anhuiense S10 Isolate Nodule
101 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
102 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
103 2802429637 Rhizobium anhuiense C15 Isolate Nodule
104 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
105 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
106 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
107 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
108 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
109 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
110 2838048938 Rhizobium pisi 27/80 Isolate Nodule
111 2838061910 Rhizobium phaseoli L15 Isolate Nodule
112 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
113 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
114 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
115 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
116 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
117 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
118 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
119 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
120 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
121 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
122 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
123 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
124 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
125 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
126 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
127 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
128 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
129 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
130 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
131 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
132 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
133 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
134 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
135 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
136 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
137 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
138 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
139 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
140 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
141 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
142 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
143 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
144 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
145 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
146 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
147 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
148 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
149 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
150 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
151 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
152 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
153 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
154 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
155 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
156 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
157 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
158 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
159 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
160 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
161 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
162 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
163 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
164 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
165 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
166 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
167 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
168 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
169 2933599457 Rhizobium phaseoli M3 Isolate Nodule
170 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
171 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
172 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
173 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
174 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
175 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
176 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
177 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
178 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
179 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
180 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
181 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
182 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
183 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
184 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
185 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
186 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
187 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
188 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
189 2996887358 Rhizobium sp. R711 Isolate Nodule
190 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
191 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
192 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
193 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
194 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
195 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
196 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
197 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
198 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
199 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
200 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
201 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
202 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
203 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
204 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
205 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
206 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
207 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
208 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
209 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
210 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
211 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
212 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
213 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
214 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
215 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
216 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
217 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
218 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
219 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
220 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
221 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
222 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
225 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
226 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
227 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
228 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
229 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
230 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
231 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
232 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
233 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
234 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
235 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
236 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
237 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
238 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
239 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
240 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
241 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
242 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
243 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
245 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
246 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
247 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
248 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
250 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
251 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
252 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
255 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
257 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
258 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
259 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
261 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
269 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
271 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
273 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
274 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
275 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
276 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
277 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
278 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
279 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
280 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
281 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
354 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
357 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
358 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
359 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
367 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
368 8005258706 Rhizobium sp. R693 Isolate Nodule
369 8005275841 Rhizobium sp. N4311 Isolate Nodule
370 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
371 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
372 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
373 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
374 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
375 8005321885 Rhizobium sp. R72 Isolate Nodule
376 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
377 8005382845 Rhizobium sp. R634 Isolate Nodule
378 8005395548 Rhizobium sp. R339 Isolate Nodule
379 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
380 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
381 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
382 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
383 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
384 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
385 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
386 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
387 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
388 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
389 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
390 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
391 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
392 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
393 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
394 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
395 8018176218 Rhizobium sp. N122 Isolate Nodule
396 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
397 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
398 8024501048 Rhizobium sp. H4 Isolate Nodule
399 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
400 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
401 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
402 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.26
Metatranscriptomes 0
Isolates 41.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.69
Nodule 33.39
Rhizoplane 3.2
Rhizosphere 23.98
Stem 0
Stem Tuber 0
Unclassified 14.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002031 3300001979 Bacteria 9251
2 JGI25155J39150_1000027 3300002704 Bacteria 123955
3 JGI25156J39149_1000008 3300002705 Bacteria 229035
4 JGI25162J39368_1000109 3300002737 Bacteria 89947
5 JGI25162J39368_1000196 3300002737 Bacteria 63573
6 JGI25154J39366_1000050 3300002738 Bacteria 124480
7 JGI25157J39369_1000028 3300002741 Bacteria 147384
8 JGI25152J39213_1000083 3300002773 Bacteria 64754
9 JGI25152J39213_1000150 3300002773 Bacteria 47719
10 JGI25152J39213_1001599 3300002773 Bacteria 9501
11 JGI25152J39213_1003793 3300002773 Bacteria 5018
12 JGI25152J39213_1010796 3300002773 Bacteria 2062
13 JGI25150J39212_1000060 3300002774 Bacteria 64750
14 JGI25150J39212_1000115 3300002774 Bacteria 45489
15 JGI25150J39212_1003297 3300002774 Bacteria 3800
16 JGI25159J45721_1000116 3300002987 Bacteria 38094
17 JGI25159J45721_1000659 3300002987 Bacteria 15296
18 JGI25151J46595_10000239 3300003187 Bacteria 64754
19 JGI25151J46595_10000391 3300003187 Bacteria 45489
20 JGI25151J46595_10000642 3300003187 Bacteria 30065
21 JGI25151J46595_10001595 3300003187 Bacteria 15062
22 JGI25165J46597_1000292 3300003214 Bacteria 63577
23 JGI25165J46597_1000597 3300003214 Bacteria 30973
24 JGI25153J46596_10000631 3300003215 Bacteria 21528
25 JGI25153J46596_10001069 3300003215 Bacteria 16708
26 JGI25153J46596_10003031 3300003215 Bacteria 9501
27 JGI25153J46596_10007581 3300003215 Bacteria 5311
28 JGI25153J46596_10013260 3300003215 Bacteria 3495
29 rootH2_10072445 3300003320 Bacteria 4711
30 rootL2_10022068 3300003322 Bacteria 32667
31 rootH1_10039608 3300003323 Bacteria 7069
32 JGI25160J50197_1000006 3300003354 Bacteria 316247
33 JGI25160J50197_1001157 3300003354 Bacteria 13474
34 JGI25160J50197_1009015 3300003354 Bacteria 3740
35 JGI25161J50226_1000004 3300003374 Bacteria 316212
36 JGI25161J50226_1000121 3300003374 Bacteria 56946
37 JGI25161J50226_1007430 3300003374 Bacteria 1835
38 Ga0055526_1007039 3300003771 Bacteria 5949
39 Ga0055526_1008904 3300003771 Bacteria 4924
40 Ga0055526_1013169 3300003771 Bacteria 3525
41 Ga0055526_1017320 3300003771 Bacteria 2758
42 Ga0055524_1000504 3300003775 Bacteria 30479
43 Ga0055524_1003640 3300003775 Bacteria 7403
44 Ga0055528_1000035 3300003790 Bacteria 117498
45 Ga0055528_1000092 3300003790 Bacteria 71565
46 Ga0055528_1006921 3300003790 Bacteria 5084
47 Ga0055528_1008146 3300003790 Bacteria 4536
48 Ga0055528_1008814 3300003790 Bacteria 4274
49 Ga0055528_1014570 3300003790 Bacteria 2901
50 Ga0055540_1000417 3300003792 Bacteria 34258
51 Ga0055540_1005653 3300003792 Bacteria 5187
52 Ga0055543_1000002 3300004625 Bacteria 390020
53 Ga0055543_1000176 3300004625 Bacteria 53419
54 Ga0065165_1000341 3300005262 Bacteria 76483
55 Ga0065165_1015093 3300005262 Bacteria 2962
56 Ga0070671_100002420 3300005355 Bacteria 14422
57 Ga0070667_100155821 3300005367 Bacteria 2009
58 Ga0070698_100010397 3300005471 Bacteria 9939
59 Ga0070699_100300998 3300005518 Bacteria 1439
60 Ga0070665_100116282 3300005548 Bacteria 2677
61 Ga0068855_100285811 3300005563 Bacteria 1830
62 Ga0068854_100138949 3300005578 Bacteria 1862
63 Ga0068856_100019970 3300005614 Bacteria 6504
64 Ga0068856_100185443 3300005614 Bacteria 2094
65 Ga0075365_10000603 3300006038 Bacteria 14115
66 Ga0075365_10001266 3300006038 Bacteria 11211
67 Ga0075365_10002047 3300006038 Bacteria 9605
68 Ga0075363_100034792 3300006048 Bacteria 2632
69 Ga0075363_100039771 3300006048 Bacteria 2476
70 Ga0075364_10124722 3300006051 Bacteria 1726
71 Ga0075362_10000723 3300006177 Bacteria 9756
72 Ga0075367_10000619 3300006178 Bacteria 13586
73 Ga0075369_10000419 3300006186 Bacteria 12857
74 Ga0075370_10004645 3300006353 Bacteria 6696
75 Ga0075370_10010193 3300006353 Bacteria 4902
76 Ga0079104_1006341 3300006946 Bacteria 4499
77 Ga0105240_10001068 3300009093 Bacteria 48443
78 Ga0105237_10000776 3300009545 Bacteria 43701
79 Ga0123341_1000006 3300009765 Bacteria 149197
80 Ga0105239_10009820 3300010375 Bacteria 10755
81 Ga0157370_10003782 3300013104 Bacteria 17665
82 Ga0182007_10000873 3300015262 Bacteria 16695
83 Ga0228710_1000011 3300022740 Bacteria 154551
84 Ga0209435_100020 3300025206 Bacteria 229105
85 Ga0209436_100002 3300025208 Bacteria 222172
86 Ga0209672_107728 3300025228 Bacteria 1634
87 Ga0209437_100064 3300025233 Bacteria 334360
88 Ga0209437_100312 3300025233 Bacteria 65593
89 Ga0207425_1000137 3300025245 Bacteria 65554
90 Ga0207425_1000217 3300025245 Bacteria 45693
91 Ga0207425_1001809 3300025245 Bacteria 8284
92 Ga0207425_1005036 3300025245 Bacteria 3835
93 Ga0209646_1000070 3300025246 Bacteria 229105
94 Ga0209646_1006015 3300025246 Bacteria 2065
95 Ga0209026_1000057 3300025250 Bacteria 229105
96 Ga0209677_100197 3300025253 Bacteria 48200
97 Ga0209759_1000047 3300025256 Bacteria 229105
98 Ga0209129_1000098 3300025258 Bacteria 163406
99 Ga0209129_1000165 3300025258 Bacteria 98917
100 Ga0209129_1000250 3300025258 Bacteria 56427
101 Ga0209129_1000496 3300025258 Bacteria 28663
102 Ga0209129_1000646 3300025258 Bacteria 23368
103 Ga0209129_1000801 3300025258 Bacteria 19850
104 Ga0209129_1002262 3300025258 Bacteria 9610
105 Ga0209233_1000081 3300025261 Bacteria 336832
106 Ga0209233_1000230 3300025261 Bacteria 97941
107 Ga0209233_1000333 3300025261 Bacteria 48175
108 Ga0209455_1007125 3300025272 Bacteria 3198
109 Ga0209673_1000169 3300025273 Bacteria 134216
110 Ga0209673_1000220 3300025273 Bacteria 113086
111 Ga0209673_1001626 3300025273 Bacteria 19511
112 Ga0209673_1001962 3300025273 Bacteria 16089
113 Ga0209673_1002528 3300025273 Bacteria 12532
114 Ga0209673_1009368 3300025273 Bacteria 4250
115 Ga0209673_1010002 3300025273 Bacteria 4041
116 Ga0209673_1016335 3300025273 Bacteria 2781
117 Ga0209130_1000015 3300025284 Bacteria 409631
118 Ga0209130_1000032 3300025284 Bacteria 316240
119 Ga0209676_1011661 3300025292 Bacteria 3522
120 Ga0209676_1024204 3300025292 Bacteria 1973
121 Ga0209025_1000142 3300025294 Bacteria 183903
122 Ga0209025_1000172 3300025294 Bacteria 160407
123 Ga0209025_1000362 3300025294 Bacteria 96826
124 Ga0209025_1000412 3300025294 Bacteria 86006
125 Ga0209025_1020871 3300025294 Bacteria 3555
126 Ga0209564_1000286 3300025295 Bacteria 102405
127 Ga0209564_1000955 3300025295 Bacteria 36777
128 Ga0209564_1001200 3300025295 Bacteria 29600
129 Ga0209564_1002762 3300025295 Bacteria 13184
130 Ga0209564_1007982 3300025295 Bacteria 5322
131 Ga0209564_1009751 3300025295 Bacteria 4518
132 Ga0209564_1010873 3300025295 Bacteria 4142
133 Ga0209758_1000148 3300025297 Bacteria 166232
134 Ga0209758_1000486 3300025297 Bacteria 65083
135 Ga0209758_1000488 3300025297 Bacteria 64778
136 Ga0209758_1000738 3300025297 Bacteria 47745
137 Ga0209758_1001353 3300025297 Bacteria 29454
138 Ga0209758_1015282 3300025297 Bacteria 3992
139 Ga0209256_1000341 3300025299 Bacteria 76526
140 Ga0209256_1001311 3300025299 Bacteria 26695
141 Ga0209256_1001353 3300025299 Bacteria 25946
142 Ga0209256_1007660 3300025299 Bacteria 5251
143 Ga0209256_1009835 3300025299 Bacteria 4115
144 Ga0209256_1014111 3300025299 Bacteria 2907
145 Ga0207426_1000077 3300025302 Bacteria 316246
146 Ga0207426_1000122 3300025302 Bacteria 218307
147 Ga0207426_1000146 3300025302 Bacteria 190683
148 Ga0207426_1000447 3300025302 Bacteria 66140
149 Ga0209051_1000127 3300025303 Bacteria 142254
150 Ga0209051_1002512 3300025303 Bacteria 13024
151 Ga0209051_1005822 3300025303 Bacteria 7094
152 Ga0209051_1048375 3300025303 Bacteria 1442
153 Ga0209257_1010147 3300025304 Bacteria 4850
154 Ga0207695_10000508 3300025913 Bacteria 82867
155 Ga0207671_10000553 3300025914 Bacteria 50396
156 Ga0207667_10214024 3300025949 Bacteria 1975
157 Ga0207640_10095603 3300025981 Bacteria 2069
158 Ga0207702_10130976 3300026078 Bacteria 2257
159 Ga0207702_10157875 3300026078 Bacteria 2069
160 Ga0209281_1000132 3300027111 Bacteria 188464
161 Ga0209371_1007621 3300027312 Bacteria 3736
162 Ga0209282_1000018 3300027666 Bacteria 188472
163 Ga0268266_10368409 3300028379 Bacteria 1353
164 Ga0268256_1002850 3300030500 Bacteria 8330
165 Ga0315914_1000362 3300031967 Bacteria 53477
166 Ga0315913_1000078 3300033430 Bacteria 53476
167 Ga0315915_1000006 3300033464 Bacteria 330709
168 Ga0451787_050345 3300041441 Bacteria 4422
169 Ga0451798_0052508 3300041458 Bacteria 1431
170 Ga0451837_0187911 3300041494 Bacteria 2761
171 Ga0451839_0999647 3300041496 Bacteria 2268
172 Ga0451845_0337346 3300041501 Bacteria 2035
173 Ga0451847_0179748 3300041503 Bacteria 2120
174 Ga0495638_0000300 3300046460 Bacteria 63643
175 Ga0495650_0044828 3300046471 Bacteria 1866
176 Ga0495605_0000920 3300046474 Bacteria 20193
177 Ga0495605_0026863 3300046474 Bacteria 2987
178 Ga0495605_0059425 3300046474 Bacteria 1836
179 Ga0495605_0113483 3300046474 Bacteria 1234
180 Ga0495664_0133302 3300046477 Bacteria 1505
181 Ga0495584_0039148 3300046491 Bacteria 2396
182 Ga0495585_0002348 3300046492 Bacteria 13595
183 Ga0495585_0033363 3300046492 Bacteria 2914
184 Ga0495585_0045709 3300046492 Bacteria 2443
185 Ga0495607_0039276 3300046501 Bacteria 2827
186 Ga0495583_0001126 3300046506 Bacteria 29374
187 Ga0495583_0006759 3300046506 Bacteria 7415
188 Ga0495583_0008665 3300046506 Bacteria 6188
189 Ga0495583_0018002 3300046506 Bacteria 3734
190 Ga0495583_0028464 3300046506 Bacteria 2747
191 Ga0495606_0002214 3300046507 Bacteria 23254
192 Ga0495606_0021347 3300046507 Bacteria 4744
193 Ga0495606_0082802 3300046507 Bacteria 1991
194 Ga0495610_0105177 3300046512 Bacteria 1258
195 Ga0495616_0054392 3300046513 Bacteria 1986
196 Ga0495620_0039877 3300046515 Bacteria 2072
197 Ga0495631_0000464 3300046518 Bacteria 27556
198 Ga0495631_0001149 3300046518 Bacteria 16392
199 Ga0495632_0013555 3300046519 Bacteria 4647
200 Ga0495643_0016720 3300046522 Bacteria 4306
201 Ga0495643_0127623 3300046522 Bacteria 1279
202 Ga0495648_0021127 3300046524 Bacteria 4518
203 Ga0495648_0047196 3300046524 Bacteria 2664
204 Ga0495609_0024000 3300046538 Bacteria 2799
205 Ga0495668_0001243 3300046616 Bacteria 25547
206 Ga0495668_0047054 3300046616 Bacteria 2395
207 Ga0495634_0089491 3300046642 Bacteria 2001
208 Ga0495611_0002171 3300046648 Bacteria 9153
209 Ga0495611_0019167 3300046648 Bacteria 2938
210 Ga0495611_0109227 3300046648 Unclassified 1287
211 Ga0495625_0000919 3300046660 Bacteria 39575
212 Ga0495625_0001420 3300046660 Bacteria 29255
213 Ga0495625_0008610 3300046660 Bacteria 8683
214 Ga0495625_0037045 3300046660 Bacteria 3581
215 Ga0495625_0056103 3300046660 Bacteria 2806
216 Ga0495625_0106599 3300046660 Bacteria 1919
217 Ga0495625_0133056 3300046660 Bacteria 1683
218 Ga0495661_0045820 3300046665 Bacteria 2672
219 Ga0495670_0086923 3300046691 Bacteria 1597
220 Ga0495660_0013468 3300046810 Bacteria 4738
221 Ga0495660_0022878 3300046810 Bacteria 3566
222 Ga0495604_0017910 3300047317 Bacteria 5667
223 Ga0495604_0047834 3300047317 Bacteria 3329
224 Ga0495687_043972 3300047443 Bacteria 1944
225 Ga0495686_0000877 3300047472 Bacteria 38321
226 Ga0495686_0168709 3300047472 Bacteria 1274
227 Ga0495615_0011738 3300048090 Bacteria 1790
228 Ga0496101_0120789 3300048904 Bacteria 1981
229 Ga0496101_0182960 3300048904 Bacteria 1614
230 Ga0496102_0007048 3300048905 Bacteria 9595
231 Ga0496102_0013654 3300048905 Bacteria 7039
232 Ga0496103_0003184 3300048906 Bacteria 10084
233 Ga0496103_0021712 3300048906 Bacteria 3863
234 Ga0496104_0063580 3300048907 Bacteria 3500
235 Ga0496105_0009972 3300048908 Bacteria 7453
236 Ga0496106_0000185 3300048909 Bacteria 44385
237 Ga0496106_0074758 3300048909 Bacteria 2594
238 Ga0496107_0049769 3300048910 Bacteria 3020
239 Ga0496110_0032066 3300048913 Bacteria 4535
240 Ga0496111_0059746 3300048914 Bacteria 2762
241 Ga0496112_0445654 3300048915 Bacteria 1233
242 Ga0496113_0053028 3300048916 Bacteria 3031
243 Ga0496116_0000554 3300048919 Bacteria 50097
244 Ga0496116_0000952 3300048919 Bacteria 35680
245 Ga0496116_0003551 3300048919 Bacteria 15343
246 Ga0496116_0013470 3300048919 Bacteria 6591
247 Ga0496117_0000657 3300048920 Bacteria 55296
248 Ga0496117_0004552 3300048920 Bacteria 15202
249 Ga0496117_0045397 3300048920 Bacteria 3173
250 Ga0496118_0002221 3300048921 Bacteria 26813
251 Ga0496118_0009804 3300048921 Bacteria 9601
252 Ga0496118_0011880 3300048921 Bacteria 8436
253 Ga0496119_0009006 3300048922 Bacteria 8659
254 Ga0496119_0013992 3300048922 Bacteria 6323
255 Ga0496119_0107374 3300048922 Bacteria 1556
256 Ga0496120_0007316 3300048923 Bacteria 8239
257 Ga0496120_0007847 3300048923 Bacteria 7864
258 Ga0496121_0000516 3300048924 Bacteria 73572
259 Ga0496121_0003663 3300048924 Bacteria 21595
260 Ga0496121_0006311 3300048924 Bacteria 14811
261 Ga0496121_0007683 3300048924 Bacteria 12951
262 Ga0496121_0014851 3300048924 Bacteria 8217
263 Ga0496121_0043572 3300048924 Bacteria 3885
264 Ga0496121_0080483 3300048924 Bacteria 2582
265 Ga0496121_0133398 3300048924 Bacteria 1854
266 Ga0496121_0191006 3300048924 Bacteria 1468
267 Ga0496122_0006158 3300048925 Bacteria 13949
268 Ga0496122_0009768 3300048925 Bacteria 10023
269 Ga0496122_0019929 3300048925 Bacteria 6098
270 Ga0496122_0025131 3300048925 Bacteria 5187
271 Ga0496122_0101630 3300048925 Bacteria 1920
272 Ga0496122_0121625 3300048925 Bacteria 1682
273 Ga0496123_0013733 3300048926 Bacteria 6770
274 Ga0496123_0015981 3300048926 Bacteria 6121
275 Ga0496123_0016572 3300048926 Bacteria 5974
276 Ga0496123_0019063 3300048926 Bacteria 5417
277 Ga0496123_0040608 3300048926 Bacteria 3237
278 Ga0496124_0019529 3300048927 Bacteria 6301
279 Ga0496124_0057870 3300048927 Bacteria 3264
280 Ga0496124_0112012 3300048927 Bacteria 2195
281 Ga0496125_0012960 3300048928 Bacteria 8231
282 Ga0496125_0020916 3300048928 Bacteria 6122
283 Ga0496125_0022589 3300048928 Bacteria 5836
284 Ga0496125_0025746 3300048928 Bacteria 5380
285 Ga0496125_0029109 3300048928 Bacteria 4971
286 Ga0496126_0174791 3300048929 Bacteria 1827
287 Ga0495678_017303 3300049459 Bacteria 3271
288 Ga0495678_019061 3300049459 Bacteria 3071
289 Ga0501034_0168850 3300049571 Bacteria 2156
290 Ga0501036_0035292 3300049572 Bacteria 4231
291 Ga0501037_0042157 3300049573 Bacteria 3354
292 Ga0501038_0027269 3300049574 Bacteria 5084
293 Ga0501043_0024131 3300049579 Bacteria 4772
294 Ga0501043_0024991 3300049579 Bacteria 4687
295 Ga0501046_0003627 3300049580 Bacteria 14138
296 Ga0501047_0018650 3300049581 Bacteria 6653
297 Ga0501047_0116545 3300049581 Bacteria 2553
298 Ga0501067_0052075 3300049583 Bacteria 2268
299 Ga0501070_0027820 3300049586 Bacteria 4742
300 Ga0501073_0018585 3300049589 Bacteria 5024
301 Ga0501073_0073825 3300049589 Bacteria 2375
302 Ga0501074_0049095 3300049590 Bacteria 3047
303 Ga0501080_0018117 3300049742 Bacteria 6519
304 Ga0501080_0110541 3300049742 Bacteria 2547
305 Ga0501083_0016311 3300049744 Bacteria 5202
306 Ga0501035_0038178 3300049822 Bacteria 4348
307 Ga0501044_0056361 3300049823 Bacteria 4035
308 Ga0501044_0091828 3300049823 Bacteria 3062
309 nmdc:mga03n38_88634_c1 3300050490 Bacteria 1468
310 nmdc:mga0yw44_9325_c1 3300050492 Bacteria 4953
311 nmdc:mga07m45_6419_c1 3300050496 Bacteria 5941
312 Ga0500610_0000146 3300053079 Bacteria 21158
313 Ga0495619_0062347 3300053085 Bacteria 2482
314 Ga0500643_048673 3300053087 Bacteria 1218
315 Ga0500557_000231 3300053105 Bacteria 8431
316 Ga0500562_010150 3300053108 Bacteria 2385
317 Ga0500569_005772 3300053109 Bacteria 2677
318 Ga0500594_0000758 3300053118 Bacteria 6884
319 Ga0500618_000405 3300053125 Bacteria 29227
320 Ga0500658_0000937 3300053134 Bacteria 11901
321 Ga0500568_0000123 3300053139 Bacteria 69417
322 Ga0500568_0015073 3300053139 Bacteria 3467
323 Ga0500616_0001036 3300053153 Bacteria 29408
324 Ga0500622_0000335 3300053156 Bacteria 46130
325 Ga0500633_0009978 3300053160 Bacteria 2520
326 Ga0501084_0051457 3300054114 Bacteria 3447
327 Ga0501082_0002008 3300060353 Bacteria 17888
328 Ga0501082_0019332 3300060353 Bacteria 5871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0026863 Ga0495605_0026863_37_1050 331
2 3300046507 Ga0495606_0082802 Ga0495606_0082802_162_1175 331
3 3300046648 Ga0495611_0109227 Ga0495611_0109227_27_1040 331
4 3300046660 Ga0495625_0106599 Ga0495625_0106599_13_1014 331
5 3300048922 Ga0496119_0013992 Ga0496119_0013992_30_1028 332
6 3300048915 Ga0496112_0445654 Ga0496112_0445654_148_1200 336
7 3300025292 Ga0209676_1011661 Ga0209676_10116613 362
8 3300053087 Ga0500643_048673 Ga0500643_048673_29_1150 367
9 iso_pu_bacteria 2513237156 2513985659 371
10 3300003323 rootH1_10039608 rootH1_100396082 373
11 iso_pu_bacteria 2512875026 2512970093 373
12 iso_pu_bacteria 2513237089 2513602696 373
13 iso_pu_bacteria 2513237160 2514005547 373
14 iso_pu_bacteria 2802428858 2802716517 373
15 iso_pu_bacteria 2802428859 2802722445 373
16 iso_pu_bacteria 2802428860 2802734279 373
17 iso_pu_bacteria 2802428861 2802735806 373
18 iso_pu_bacteria 2802428862 2802741620 373
19 iso_pu_bacteria 2915980308 2915983495 373
20 iso_pu_bacteria 2916061851 2916064667 373
21 iso_pu_bacteria 2937029754 2937032749 373
22 iso_pu_bacteria 2937036028 2937041046 373
23 iso_pu_bacteria 2937078374 2937082187 373
24 iso_pu_bacteria 2937084907 2937090284 373
25 iso_pu_bacteria 2957375807 2957378725 373
26 iso_pu_bacteria 2957437181 2957442835 373
27 iso_pu_bacteria 2960591022 2960594867 373
28 iso_pu_bacteria 2960631154 2960631199 373
29 iso_pu_bacteria 2960680706 2960684656 373
30 iso_pu_bacteria 2960693952 2960699535 373
31 iso_pu_bacteria 2967686174 2967688693 373
32 iso_pu_bacteria 2967728569 2967731277 373
33 iso_pu_bacteria 2970122695 2970125425 373
34 iso_pu_bacteria 2970143518 2970146662 373
35 iso_pu_bacteria 2977530762 2977533994 373
36 iso_pu_bacteria 2977544691 2977546732 373
37 iso_pu_bacteria 8003999396 8004004980 373
38 3300006946 Ga0079104_1006341 Ga0079104_10063414 377
39 3300022740 Ga0228710_1000011 Ga0228710_1000011124 377
40 3300027111 Ga0209281_1000132 Ga0209281_100013249 377
41 3300027666 Ga0209282_1000018 Ga0209282_100001849 377
42 3300031967 Ga0315914_1000362 Ga0315914_100036249 377
43 3300033430 Ga0315913_1000078 Ga0315913_100007847 377
44 3300033464 Ga0315915_1000006 Ga0315915_1000006254 377
45 3300046507 Ga0495606_0002214 Ga0495606_0002214_17132_18379 378
46 3300048924 Ga0496121_0043572 Ga0496121_0043572_1092_2339 378
47 3300046512 Ga0495610_0105177 Ga0495610_0105177_45_1187 379
48 3300046471 Ga0495650_0044828 Ga0495650_0044828_26_1183 380
49 3300005614 Ga0068856_100019970 Ga0068856_1000199703 383
50 3300048090 Ga0495615_0011738 Ga0495615_0011738_346_1503 385
51 3300047472 Ga0495686_0000877 Ga0495686_0000877_31377_32612 387
52 iso_pu_bacteria 2582581306 2585268693 387
53 iso_pu_bacteria 2582581865 2585389333 387
54 iso_pu_bacteria 2842489311 2842495829 387
55 iso_pu_bacteria 2842509118 2842510906 387
56 iso_pu_bacteria 8046767195 8046769255 387
57 3300048919 Ga0496116_0003551 Ga0496116_0003551_9268_10440 388
58 3300048920 Ga0496117_0000657 Ga0496117_0000657_4768_5940 388
59 3300048924 Ga0496121_0006311 Ga0496121_0006311_5206_6378 388
60 3300048925 Ga0496122_0121625 Ga0496122_0121625_287_1459 388
61 3300049572 Ga0501036_0035292 Ga0501036_0035292_291_1496 388
62 3300049573 Ga0501037_0042157 Ga0501037_0042157_10_1209 388
63 3300049574 Ga0501038_0027269 Ga0501038_0027269_1336_2541 388
64 3300049579 Ga0501043_0024131 Ga0501043_0024131_813_2018 388
65 3300049580 Ga0501046_0003627 Ga0501046_0003627_3501_4706 388
66 3300049581 Ga0501047_0018650 Ga0501047_0018650_3490_4695 388
67 3300049583 Ga0501067_0052075 Ga0501067_0052075_460_1659 388
68 3300049586 Ga0501070_0027820 Ga0501070_0027820_2097_3302 388
69 3300049589 Ga0501073_0018585 Ga0501073_0018585_2332_3537 388
70 3300049590 Ga0501074_0049095 Ga0501074_0049095_1645_2850 388
71 3300049742 Ga0501080_0018117 Ga0501080_0018117_2267_3472 388
72 3300049744 Ga0501083_0016311 Ga0501083_0016311_1674_2879 388
73 3300049822 Ga0501035_0038178 Ga0501035_0038178_2968_4173 388
74 3300049823 Ga0501044_0056361 Ga0501044_0056361_2602_3801 388
75 3300054114 Ga0501084_0051457 Ga0501084_0051457_16_1221 388
76 3300060353 Ga0501082_0002008 Ga0501082_0002008_301_1500 388
77 3300002773 JGI25152J39213_1000083 JGI25152J39213_100008349 390
78 3300002774 JGI25150J39212_1000060 JGI25150J39212_100006049 390
79 3300003187 JGI25151J46595_10000239 JGI25151J46595_1000023916 390
80 3300003215 JGI25153J46596_10000631 JGI25153J46596_1000063116 390
81 3300025245 Ga0207425_1000137 Ga0207425_100013717 390
82 3300025258 Ga0209129_1000098 Ga0209129_100009817 390
83 3300025273 Ga0209673_1016335 Ga0209673_10163352 390
84 3300025294 Ga0209025_1000142 Ga0209025_100014217 390
85 3300025297 Ga0209758_1000488 Ga0209758_100048817 390
86 3300046477 Ga0495664_0133302 Ga0495664_0133302_160_1386 390
87 3300046524 Ga0495648_0047196 Ga0495648_0047196_718_1944 390
88 3300046642 Ga0495634_0089491 Ga0495634_0089491_18_1244 390
89 3300047317 Ga0495604_0047834 Ga0495604_0047834_2064_3290 390
90 3300048919 Ga0496116_0000554 Ga0496116_0000554_37665_38843 390
91 3300048919 Ga0496116_0013470 Ga0496116_0013470_5281_6456 390
92 3300048920 Ga0496117_0045397 Ga0496117_0045397_591_1766 390
93 3300048924 Ga0496121_0000516 Ga0496121_0000516_70188_71363 390
94 3300048925 Ga0496122_0009768 Ga0496122_0009768_2005_3180 390
95 3300048926 Ga0496123_0013733 Ga0496123_0013733_3651_4826 390
96 3300048928 Ga0496125_0025746 Ga0496125_0025746_3552_4727 390
97 3300053085 Ga0495619_0062347 Ga0495619_0062347_924_2150 390
98 iso_pu_bacteria 2582581866 2585397322 390
99 3300002773 JGI25152J39213_1003793 JGI25152J39213_10037932 391
100 3300002987 JGI25159J45721_1000659 JGI25159J45721_100065910 391
101 3300003187 JGI25151J46595_10001595 JGI25151J46595_1000159512 391
102 3300003354 JGI25160J50197_1000006 JGI25160J50197_1000006304 391
103 3300003374 JGI25161J50226_1000004 JGI25161J50226_1000004304 391
104 3300004625 Ga0055543_1000002 Ga0055543_100000231 391
105 3300005262 Ga0065165_1000341 Ga0065165_100034144 391
106 3300025258 Ga0209129_1000250 Ga0209129_100025031 391
107 3300025284 Ga0209130_1000032 Ga0209130_1000032295 391
108 3300025294 Ga0209025_1000172 Ga0209025_100017229 391
109 3300025295 Ga0209564_1007982 Ga0209564_10079822 391
110 3300025302 Ga0207426_1000077 Ga0207426_1000077295 391
111 3300046507 Ga0495606_0021347 Ga0495606_0021347_726_1955 391
112 3300046522 Ga0495643_0127623 Ga0495643_0127623_26_1255 391
113 3300048928 Ga0496125_0022589 Ga0496125_0022589_3476_4705 391
114 3300005518 Ga0070699_100300998 Ga0070699_1003009981 392
115 iso_pu_bacteria 2524023209 2524460976 392
116 iso_pu_bacteria 2718217882 2719180045 392
117 iso_pu_bacteria 2718217927 2719384644 392
118 iso_pu_bacteria 2718217997 2719664396 392
119 iso_pu_bacteria 2718218009 2719730794 392
120 iso_pu_bacteria 2718218199 2720490816 392
121 iso_pu_bacteria 2718218233 2720619014 392
122 iso_pu_bacteria 2718218235 2720630417 392
123 iso_pu_bacteria 2718218269 2720774111 392
124 iso_pu_bacteria 2718218363 2721146138 392
125 iso_pu_bacteria 2718218365 2721157658 392
126 iso_pu_bacteria 2718218366 2721163018 392
127 iso_pu_bacteria 2718218423 2721398354 392
128 iso_pu_bacteria 2721755514 2722839188 392
129 iso_pu_bacteria 2721755556 2723025839 392
130 iso_pu_bacteria 2721755684 2723559383 392
131 iso_pu_bacteria 2721755685 2723565999 392
132 iso_pu_bacteria 2721755809 2724037167 392
133 iso_pu_bacteria 2721755810 2724043550 392
134 iso_pu_bacteria 2721755819 2724088718 392
135 iso_pu_bacteria 2721755822 2724103264 392
136 iso_pu_bacteria 2721755823 2724109096 392
137 iso_pu_bacteria 2728369352 2730106775 392
138 iso_pu_bacteria 2728369365 2730163282 392
139 iso_pu_bacteria 2728369397 2730297290 392
140 iso_pu_bacteria 2791355264 2793349197 392
141 iso_pu_bacteria 2802429605 2805930289 392
142 iso_pu_bacteria 2802429606 2805935880 392
143 iso_pu_bacteria 2838016132 2838017062 392
144 iso_pu_bacteria 2838048938 2838049453 392
145 iso_pu_bacteria 2838061910 2838067825 392
146 iso_pu_bacteria 2838068647 2838073109 392
147 iso_pu_bacteria 2838668709 2838674469 392
148 iso_pu_bacteria 2838701080 2838706810 392
149 iso_pu_bacteria 2842146304 2842151544 392
150 iso_pu_bacteria 2842250916 2842256663 392
151 iso_pu_bacteria 2842264693 2842269782 392
152 iso_pu_bacteria 2842298080 2842298889 392
153 iso_pu_bacteria 2842317721 2842318882 392
154 iso_pu_bacteria 2842357229 2842359243 392
155 iso_pu_bacteria 2842422224 2842426718 392
156 iso_pu_bacteria 2842428310 2842433667 392
157 iso_pu_bacteria 2842434925 2842439995 392
158 iso_pu_bacteria 2842441272 2842446650 392
159 iso_pu_bacteria 2842447887 2842452132 392
160 iso_pu_bacteria 2842462802 2842468104 392
161 iso_pu_bacteria 2842469257 2842474630 392
162 iso_pu_bacteria 2842495871 2842501182 392
163 iso_pu_bacteria 2852387548 2852391420 392
164 iso_pu_bacteria 2933599457 2933603301 392
165 iso_pu_bacteria 8005275841 8005279360 392
166 iso_pu_bacteria 8005282627 8005283972 392
167 iso_pu_bacteria 8005430974 8005432455 392
168 iso_pu_bacteria 8005497431 8005499111 392
169 iso_pu_bacteria 8005619151 8005620299 392
170 iso_pu_bacteria 8005626139 8005626727 392
171 iso_pu_bacteria 8005668836 8005670526 392
172 iso_pu_bacteria 8018176218 8018178129 392
173 iso_pu_bacteria 8024501048 8024503492 392
174 iso_pu_bacteria 8057575449 8057578564 392
175 iso_pu_bacteria 2510917022 2511131531 394
176 iso_pu_bacteria 2510917028 2511181786 394
177 iso_pu_bacteria 2513237138 2513871715 394
178 iso_pu_bacteria 2519899620 2520379893 394
179 iso_pu_bacteria 2582581299 2585233433 394
180 iso_pu_bacteria 2582581307 2585274998 394
181 iso_pu_bacteria 2582581867 2585404527 394
182 iso_pu_bacteria 2585427531 2585561288 394
183 iso_pu_bacteria 2585427590 2585824229 394
184 iso_pu_bacteria 2585427609 2585908118 394
185 iso_pu_bacteria 2585428125 2587983847 394
186 iso_pu_bacteria 2923556063 2923559420 394
187 iso_pu_bacteria 3005445848 3005446495 394
188 iso_pu_bacteria 2510917030 2511196543 395
189 iso_pu_bacteria 2513237088 2513596987 395
190 iso_pu_bacteria 2529292951 2530644131 395
191 iso_pu_bacteria 2582581298 2585225532 395
192 iso_pu_bacteria 2582581299 2585233590 395
193 iso_pu_bacteria 2585427529 2585548193 395
194 iso_pu_bacteria 2643221599 2644006925 395
195 iso_pu_bacteria 2643221634 2644195155 395
196 iso_pu_bacteria 2643221643 2644238505 395
197 iso_pu_bacteria 2643221643 2644240652 395
198 iso_pu_bacteria 2919100787 2919100932 395
199 iso_pu_bacteria 2996887358 2996892647 395
200 iso_pu_bacteria 3005452660 3005456754 395
201 iso_pu_bacteria 8005258706 8005264726 395
202 iso_pu_bacteria 8005321885 8005327174 395
203 3300005471 Ga0070698_100010397 Ga0070698_1000103972 396
204 iso_pu_bacteria 2510917028 2511183083 396
205 iso_pu_bacteria 2534681796 2535517357 396
206 iso_pu_bacteria 2585427590 2585823514 396
207 iso_pu_bacteria 8005542996 8005546172 396
208 iso_pu_bacteria 2509276021 2509387934 397
209 iso_pu_bacteria 2509276033 2509443550 397
210 iso_pu_bacteria 2510461076 2510898402 397
211 iso_pu_bacteria 2513237085 2513579931 397
212 iso_pu_bacteria 2513237093 2513634511 397
213 iso_pu_bacteria 2513237103 2513709442 397
214 iso_pu_bacteria 2513237162 2514024810 397
215 iso_pu_bacteria 2515075009 2515111036 397
216 iso_pu_bacteria 2515154113 2515637740 397
217 iso_pu_bacteria 2515154114 2515642814 397
218 iso_pu_bacteria 2515154116 2515658669 397
219 iso_pu_bacteria 2515154134 2515744020 397
220 iso_pu_bacteria 2516653077 2517039690 397
221 iso_pu_bacteria 2516653085 2517075215 397
222 iso_pu_bacteria 2517093000 2517093815 397
223 iso_pu_bacteria 2582581308 2585280783 397
224 iso_pu_bacteria 2582581315 2585324220 397
225 iso_pu_bacteria 2582581316 2585334382 397
226 iso_pu_bacteria 2585427526 2585525408 397
227 iso_pu_bacteria 2585427527 2585530488 397
228 iso_pu_bacteria 2585427528 2585542543 397
229 iso_pu_bacteria 2585427530 2585554663 397
230 iso_pu_bacteria 2585427593 2585838146 397
231 iso_pu_bacteria 2615840626 2616312529 397
232 iso_pu_bacteria 2615840698 2616557414 397
233 iso_pu_bacteria 2617270742 2617382099 397
234 iso_pu_bacteria 2667528174 2671116573 397
235 iso_pu_bacteria 2738541333 2739035035 397
236 iso_pu_bacteria 2765235942 2766067845 397
237 iso_pu_bacteria 2775507266 2778173548 397
238 iso_pu_bacteria 2791355256 2793298878 397
239 iso_pu_bacteria 2791355259 2793318409 397
240 iso_pu_bacteria 2791355261 2793330322 397
241 iso_pu_bacteria 2791355262 2793336019 397
242 iso_pu_bacteria 2791355263 2793340008 397
243 iso_pu_bacteria 2791355265 2793353335 397
244 iso_pu_bacteria 2791355266 2793363322 397
245 iso_pu_bacteria 2791355267 2793368238 397
246 iso_pu_bacteria 2802429633 2806044322 397
247 iso_pu_bacteria 2802429634 2806051879 397
248 iso_pu_bacteria 2802429635 2806058182 397
249 iso_pu_bacteria 2802429636 2806069063 397
250 iso_pu_bacteria 2802429637 2806075849 397
251 iso_pu_bacteria 2818991448 2819613452 397
252 iso_pu_bacteria 2818991453 2819641211 397
253 iso_pu_bacteria 2838022645 2838027024 397
254 iso_pu_bacteria 2838029111 2838034887 397
255 iso_pu_bacteria 2838042994 2838047145 397
256 iso_pu_bacteria 2838686498 2838688867 397
257 iso_pu_bacteria 2838729681 2838731162 397
258 iso_pu_bacteria 2838742623 2838743944 397
259 iso_pu_bacteria 2841851746 2841857090 397
260 iso_pu_bacteria 2841864319 2841870508 397
261 iso_pu_bacteria 2842110456 2842115869 397
262 iso_pu_bacteria 2842156927 2842159795 397
263 iso_pu_bacteria 2842163707 2842168037 397
264 iso_pu_bacteria 2842180545 2842183588 397
265 iso_pu_bacteria 2842198810 2842202628 397
266 iso_pu_bacteria 2842205361 2842207920 397
267 iso_pu_bacteria 2842217011 2842220823 397
268 iso_pu_bacteria 2842229732 2842233932 397
269 iso_pu_bacteria 2842243621 2842245408 397
270 iso_pu_bacteria 2842257432 2842259942 397
271 iso_pu_bacteria 2842271015 2842274781 397
272 iso_pu_bacteria 2842278818 2842281285 397
273 iso_pu_bacteria 2842285085 2842290501 397
274 iso_pu_bacteria 2842304105 2842307027 397
275 iso_pu_bacteria 2842341865 2842343822 397
276 iso_pu_bacteria 2842363717 2842364951 397
277 iso_pu_bacteria 2842395702 2842400956 397
278 iso_pu_bacteria 2842402390 2842408339 397
279 iso_pu_bacteria 2842409023 2842415076 397
280 iso_pu_bacteria 2842415677 2842421643 397
281 iso_pu_bacteria 2842475841 2842481619 397
282 iso_pu_bacteria 2842482326 2842484405 397
283 iso_pu_bacteria 2842502639 2842507978 397
284 iso_pu_bacteria 2844454524 2844455392 397
285 iso_pu_bacteria 2857516855 2857520536 397
286 iso_pu_bacteria 2919408235 2919413848 397
287 iso_pu_bacteria 2933570622 2933572858 397
288 iso_pu_bacteria 2933586486 2933592171 397
289 iso_pu_bacteria 2935901341 2935904390 397
290 iso_pu_bacteria 2936367885 2936368371 397
291 iso_pu_bacteria 2936375103 2936376203 397
292 iso_pu_bacteria 3005416602 3005422273 397
293 iso_pu_bacteria 639633055 639647209 397
294 iso_pu_bacteria 8005289223 8005292572 397
295 iso_pu_bacteria 8005301065 8005304347 397
296 iso_pu_bacteria 8005307578 8005308914 397
297 iso_pu_bacteria 8005314921 8005316340 397
298 iso_pu_bacteria 8005376324 8005376859 397
299 iso_pu_bacteria 8005382845 8005386213 397
300 iso_pu_bacteria 8005395548 8005397390 397
301 iso_pu_bacteria 8005460587 8005461677 397
302 iso_pu_bacteria 8005484373 8005488100 397
303 iso_pu_bacteria 8005556819 8005562896 397
304 iso_pu_bacteria 8005563573 8005570196 397
305 iso_pu_bacteria 8005570704 8005577439 397
306 iso_pu_bacteria 8005645114 8005651688 397
307 iso_pu_bacteria 8005682033 8005687226 397
308 iso_pu_bacteria 8005688590 8005690770 397
309 iso_pu_bacteria 8005695170 8005698353 397
310 iso_pu_bacteria 8018163183 8018168421 397
311 iso_pu_bacteria 8023680758 8023687236 397
312 iso_pu_bacteria 8024479707 8024480859 397
313 iso_pu_bacteria 8056375014 8056379346 397
314 iso_pu_bacteria 8057874678 8057881744 397
315 3300002773 JGI25152J39213_1010796 JGI25152J39213_10107961 398
316 3300002987 JGI25159J45721_1000116 JGI25159J45721_100011618 398
317 3300003374 JGI25161J50226_1000121 JGI25161J50226_100012130 398
318 3300003771 Ga0055526_1013169 Ga0055526_10131692 398
319 3300003775 Ga0055524_1000504 Ga0055524_100050416 398
320 3300003790 Ga0055528_1000035 Ga0055528_100003517 398
321 3300003790 Ga0055528_1008814 Ga0055528_10088143 398
322 3300003792 Ga0055540_1005653 Ga0055540_10056534 398
323 3300004625 Ga0055543_1000176 Ga0055543_100017625 398
324 3300005262 Ga0065165_1015093 Ga0065165_10150932 398
325 3300006038 Ga0075365_10000603 Ga0075365_100006035 398
326 3300006048 Ga0075363_100039771 Ga0075363_1000397712 398
327 3300006186 Ga0075369_10000419 Ga0075369_100004197 398
328 3300006353 Ga0075370_10010193 Ga0075370_100101932 398
329 3300025208 Ga0209436_100002 Ga0209436_100002186 398
330 3300025258 Ga0209129_1000496 Ga0209129_10004965 398
331 3300025273 Ga0209673_1000220 Ga0209673_100022099 398
332 3300025273 Ga0209673_1009368 Ga0209673_10093682 398
333 3300025284 Ga0209130_1000015 Ga0209130_1000015141 398
334 3300025295 Ga0209564_1000955 Ga0209564_100095517 398
335 3300025295 Ga0209564_1002762 Ga0209564_10027626 398
336 3300025297 Ga0209758_1000148 Ga0209758_1000148108 398
337 3300025299 Ga0209256_1000341 Ga0209256_100034168 398
338 3300025299 Ga0209256_1014111 Ga0209256_10141112 398
339 3300025302 Ga0207426_1000122 Ga0207426_100012291 398
340 3300025303 Ga0209051_1002512 Ga0209051_10025127 398
341 3300028379 Ga0268266_10368409 Ga0268266_103684092 398
342 3300046506 Ga0495583_0008665 Ga0495583_0008665_4154_5353 398
343 3300048909 Ga0496106_0000185 Ga0496106_0000185_10552_11748 398
344 3300048927 Ga0496124_0112012 Ga0496124_0112012_51_1247 398
345 3300053139 Ga0500568_0015073 Ga0500568_0015073_1905_3101 398
346 3300053160 Ga0500633_0009978 Ga0500633_0009978_1194_2390 398
347 iso_pu_bacteria 3003930520 3003933184 398
348 iso_pu_bacteria 3005409236 3005413009 398
349 3300002773 JGI25152J39213_1000150 JGI25152J39213_100015043 399
350 3300002773 JGI25152J39213_1001599 JGI25152J39213_10015997 399
351 3300002774 JGI25150J39212_1000115 JGI25150J39212_10001155 399
352 3300002774 JGI25150J39212_1003297 JGI25150J39212_10032972 399
353 3300003187 JGI25151J46595_10000391 JGI25151J46595_1000039143 399
354 3300003215 JGI25153J46596_10001069 JGI25153J46596_100010692 399
355 3300003215 JGI25153J46596_10003031 JGI25153J46596_100030317 399
356 3300003354 JGI25160J50197_1009015 JGI25160J50197_10090153 399
357 3300003771 Ga0055526_1017320 Ga0055526_10173201 399
358 3300003775 Ga0055524_1003640 Ga0055524_10036406 399
359 3300003790 Ga0055528_1008146 Ga0055528_10081463 399
360 3300003790 Ga0055528_1014570 Ga0055528_10145702 399
361 3300005355 Ga0070671_100002420 Ga0070671_1000024203 399
362 3300025245 Ga0207425_1000217 Ga0207425_10002176 399
363 3300025245 Ga0207425_1001809 Ga0207425_10018097 399
364 3300025258 Ga0209129_1000165 Ga0209129_100016591 399
365 3300025258 Ga0209129_1000646 Ga0209129_100064611 399
366 3300025258 Ga0209129_1002262 Ga0209129_10022627 399
367 3300025273 Ga0209673_1002528 Ga0209673_10025288 399
368 3300025273 Ga0209673_1010002 Ga0209673_10100023 399
369 3300025294 Ga0209025_1000362 Ga0209025_10003626 399
370 3300025294 Ga0209025_1020871 Ga0209025_10208713 399
371 3300025295 Ga0209564_1009751 Ga0209564_10097513 399
372 3300025295 Ga0209564_1010873 Ga0209564_10108733 399
373 3300025297 Ga0209758_1000486 Ga0209758_100048611 399
374 3300025297 Ga0209758_1000738 Ga0209758_100073842 399
375 3300025297 Ga0209758_1015282 Ga0209758_10152821 399
376 3300025299 Ga0209256_1007660 Ga0209256_10076603 399
377 3300025299 Ga0209256_1009835 Ga0209256_10098353 399
378 3300025302 Ga0207426_1000447 Ga0207426_100044731 399
379 3300046492 Ga0495585_0033363 Ga0495585_0033363_834_2051 399
380 3300046492 Ga0495585_0045709 Ga0495585_0045709_66_1283 399
381 3300046506 Ga0495583_0001126 Ga0495583_0001126_19902_21119 399
382 3300046506 Ga0495583_0006759 Ga0495583_0006759_5811_7028 399
383 3300046506 Ga0495583_0028464 Ga0495583_0028464_1099_2298 399
384 3300046515 Ga0495620_0039877 Ga0495620_0039877_233_1450 399
385 3300046518 Ga0495631_0001149 Ga0495631_0001149_4749_5966 399
386 3300046519 Ga0495632_0013555 Ga0495632_0013555_2246_3463 399
387 3300046538 Ga0495609_0024000 Ga0495609_0024000_1170_2387 399
388 3300046616 Ga0495668_0047054 Ga0495668_0047054_546_1763 399
389 3300046648 Ga0495611_0019167 Ga0495611_0019167_853_2070 399
390 3300046660 Ga0495625_0001420 Ga0495625_0001420_14650_15867 399
391 3300046660 Ga0495625_0037045 Ga0495625_0037045_690_1907 399
392 3300046660 Ga0495625_0056103 Ga0495625_0056103_897_2114 399
393 3300046665 Ga0495661_0045820 Ga0495661_0045820_319_1536 399
394 3300046691 Ga0495670_0086923 Ga0495670_0086923_338_1555 399
395 3300047317 Ga0495604_0017910 Ga0495604_0017910_3398_4615 399
396 3300047443 Ga0495687_043972 Ga0495687_043972_467_1684 399
397 3300048904 Ga0496101_0182960 Ga0496101_0182960_162_1403 399
398 3300048905 Ga0496102_0013654 Ga0496102_0013654_2729_3970 399
399 3300048906 Ga0496103_0021712 Ga0496103_0021712_805_2046 399
400 3300048907 Ga0496104_0063580 Ga0496104_0063580_378_1619 399
401 3300048908 Ga0496105_0009972 Ga0496105_0009972_3412_4653 399
402 3300048909 Ga0496106_0074758 Ga0496106_0074758_437_1678 399
403 3300048910 Ga0496107_0049769 Ga0496107_0049769_348_1589 399
404 3300048913 Ga0496110_0032066 Ga0496110_0032066_1255_2496 399
405 3300048914 Ga0496111_0059746 Ga0496111_0059746_1326_2567 399
406 3300048916 Ga0496113_0053028 Ga0496113_0053028_37_1278 399
407 3300048919 Ga0496116_0000952 Ga0496116_0000952_8738_9961 399
408 3300048921 Ga0496118_0009804 Ga0496118_0009804_4771_5970 399
409 3300048924 Ga0496121_0007683 Ga0496121_0007683_7768_8967 399
410 3300048924 Ga0496121_0014851 Ga0496121_0014851_2329_3570 399
411 3300048924 Ga0496121_0080483 Ga0496121_0080483_885_2108 399
412 3300048925 Ga0496122_0019929 Ga0496122_0019929_1939_3138 399
413 3300048925 Ga0496122_0025131 Ga0496122_0025131_1199_2440 399
414 3300048925 Ga0496122_0101630 Ga0496122_0101630_204_1427 399
415 3300048926 Ga0496123_0015981 Ga0496123_0015981_2278_3519 399
416 3300048926 Ga0496123_0016572 Ga0496123_0016572_1033_2232 399
417 3300048928 Ga0496125_0012960 Ga0496125_0012960_4589_5830 399
418 3300048928 Ga0496125_0029109 Ga0496125_0029109_2812_4011 399
419 3300048929 Ga0496126_0174791 Ga0496126_0174791_403_1644 399
420 3300049459 Ga0495678_017303 Ga0495678_017303_1540_2757 399
421 3300049571 Ga0501034_0168850 Ga0501034_0168850_412_1638 399
422 3300049579 Ga0501043_0024991 Ga0501043_0024991_1501_2727 399
423 3300049589 Ga0501073_0073825 Ga0501073_0073825_584_1810 399
424 3300053156 Ga0500622_0000335 Ga0500622_0000335_22224_23423 399
425 3300060353 Ga0501082_0019332 Ga0501082_0019332_3091_4317 399
426 3300006038 Ga0075365_10001266 Ga0075365_100012667 400
427 3300006178 Ga0075367_10000619 Ga0075367_100006195 400
428 3300025303 Ga0209051_1005822 Ga0209051_10058225 400
429 3300046460 Ga0495638_0000300 Ga0495638_0000300_23786_24991 400
430 3300046474 Ga0495605_0000920 Ga0495605_0000920_5372_6577 400
431 3300046474 Ga0495605_0113483 Ga0495605_0113483_10_1221 400
432 3300046491 Ga0495584_0039148 Ga0495584_0039148_342_1547 400
433 3300046492 Ga0495585_0002348 Ga0495585_0002348_11413_12618 400
434 3300046506 Ga0495583_0018002 Ga0495583_0018002_849_2054 400
435 3300046518 Ga0495631_0000464 Ga0495631_0000464_8237_9442 400
436 3300046522 Ga0495643_0016720 Ga0495643_0016720_72_1283 400
437 3300046616 Ga0495668_0001243 Ga0495668_0001243_22457_23662 400
438 3300046648 Ga0495611_0002171 Ga0495611_0002171_7015_8220 400
439 3300046660 Ga0495625_0000919 Ga0495625_0000919_28045_29250 400
440 3300046810 Ga0495660_0013468 Ga0495660_0013468_3318_4523 400
441 3300047472 Ga0495686_0168709 Ga0495686_0168709_11_1216 400
442 3300049459 Ga0495678_019061 Ga0495678_019061_1645_2850 400
443 3300050492 nmdc:mga0yw44_9325_c1 nmdc:mga0yw44_9325_c1_148_1353 400
444 3300053079 Ga0500610_0000146 Ga0500610_0000146_11220_12425 400
445 3300053105 Ga0500557_000231 Ga0500557_000231_6002_7207 400
446 3300053108 Ga0500562_010150 Ga0500562_010150_388_1593 400
447 3300053109 Ga0500569_005772 Ga0500569_005772_418_1623 400
448 3300053118 Ga0500594_0000758 Ga0500594_0000758_222_1427 400
449 3300053139 Ga0500568_0000123 Ga0500568_0000123_27430_28635 400
450 3300053153 Ga0500616_0001036 Ga0500616_0001036_17689_18894 400
451 3300001979 JGI24740J21852_10002031 JGI24740J21852_100020312 401
452 3300002704 JGI25155J39150_1000027 JGI25155J39150_10000273 401
453 3300002705 JGI25156J39149_1000008 JGI25156J39149_1000008122 401
454 3300002737 JGI25162J39368_1000109 JGI25162J39368_100010911 401
455 3300002737 JGI25162J39368_1000196 JGI25162J39368_100019665 401
456 3300002738 JGI25154J39366_1000050 JGI25154J39366_10000503 401
457 3300002741 JGI25157J39369_1000028 JGI25157J39369_1000028124 401
458 3300003187 JGI25151J46595_10000642 JGI25151J46595_1000064212 401
459 3300003214 JGI25165J46597_1000292 JGI25165J46597_100029265 401
460 3300003214 JGI25165J46597_1000597 JGI25165J46597_100059713 401
461 3300003215 JGI25153J46596_10007581 JGI25153J46596_100075812 401
462 3300003215 JGI25153J46596_10013260 JGI25153J46596_100132602 401
463 3300003320 rootH2_10072445 rootH2_100724452 401
464 3300003322 rootL2_10022068 rootL2_1002206827 401
465 3300003354 JGI25160J50197_1001157 JGI25160J50197_10011576 401
466 3300003374 JGI25161J50226_1007430 JGI25161J50226_10074301 401
467 3300003771 Ga0055526_1007039 Ga0055526_10070395 401
468 3300003771 Ga0055526_1008904 Ga0055526_10089042 401
469 3300003790 Ga0055528_1000092 Ga0055528_100009270 401
470 3300003790 Ga0055528_1006921 Ga0055528_10069215 401
471 3300003792 Ga0055540_1000417 Ga0055540_10004177 401
472 3300005367 Ga0070667_100155821 Ga0070667_1001558212 401
473 3300005548 Ga0070665_100116282 Ga0070665_1001162822 401
474 3300005563 Ga0068855_100285811 Ga0068855_1002858112 401
475 3300005578 Ga0068854_100138949 Ga0068854_1001389492 401
476 3300005614 Ga0068856_100185443 Ga0068856_1001854432 401
477 3300006038 Ga0075365_10002047 Ga0075365_100020474 401
478 3300006048 Ga0075363_100034792 Ga0075363_1000347922 401
479 3300006051 Ga0075364_10124722 Ga0075364_101247222 401
480 3300006177 Ga0075362_10000723 Ga0075362_100007239 401
481 3300006353 Ga0075370_10004645 Ga0075370_100046458 401
482 3300009093 Ga0105240_10001068 Ga0105240_1000106823 401
483 3300009545 Ga0105237_10000776 Ga0105237_1000077617 401
484 3300009765 Ga0123341_1000006 Ga0123341_100000616 401
485 3300010375 Ga0105239_10009820 Ga0105239_100098206 401
486 3300013104 Ga0157370_10003782 Ga0157370_1000378214 401
487 3300015262 Ga0182007_10000873 Ga0182007_100008736 401
488 3300025206 Ga0209435_100020 Ga0209435_100020117 401
489 3300025228 Ga0209672_107728 Ga0209672_1077281 401
490 3300025233 Ga0209437_100064 Ga0209437_100064258 401
491 3300025233 Ga0209437_100312 Ga0209437_1003122 401
492 3300025245 Ga0207425_1005036 Ga0207425_10050363 401
493 3300025246 Ga0209646_1000070 Ga0209646_1000070117 401
494 3300025246 Ga0209646_1006015 Ga0209646_10060152 401
495 3300025250 Ga0209026_1000057 Ga0209026_1000057105 401
496 3300025253 Ga0209677_100197 Ga0209677_10019724 401
497 3300025256 Ga0209759_1000047 Ga0209759_1000047105 401
498 3300025258 Ga0209129_1000801 Ga0209129_10008013 401
499 3300025261 Ga0209233_1000081 Ga0209233_100008143 401
500 3300025261 Ga0209233_1000230 Ga0209233_100023066 401
501 3300025261 Ga0209233_1000333 Ga0209233_100033324 401
502 3300025272 Ga0209455_1007125 Ga0209455_10071252 401
503 3300025273 Ga0209673_1000169 Ga0209673_1000169130 401
504 3300025273 Ga0209673_1001626 Ga0209673_100162612 401
505 3300025273 Ga0209673_1001962 Ga0209673_100196220 401
506 3300025292 Ga0209676_1024204 Ga0209676_10242042 401
507 3300025294 Ga0209025_1000412 Ga0209025_100041279 401
508 3300025295 Ga0209564_1000286 Ga0209564_100028617 401
509 3300025295 Ga0209564_1001200 Ga0209564_100120025 401
510 3300025297 Ga0209758_1001353 Ga0209758_100135315 401
511 3300025299 Ga0209256_1001311 Ga0209256_100131118 401
512 3300025299 Ga0209256_1001353 Ga0209256_100135318 401
513 3300025302 Ga0207426_1000146 Ga0207426_1000146111 401
514 3300025303 Ga0209051_1000127 Ga0209051_100012794 401
515 3300025303 Ga0209051_1048375 Ga0209051_10483751 401
516 3300025304 Ga0209257_1010147 Ga0209257_10101474 401
517 3300025913 Ga0207695_10000508 Ga0207695_1000050826 401
518 3300025914 Ga0207671_10000553 Ga0207671_1000055325 401
519 3300025949 Ga0207667_10214024 Ga0207667_102140242 401
520 3300025981 Ga0207640_10095603 Ga0207640_100956031 401
521 3300026078 Ga0207702_10130976 Ga0207702_101309762 401
522 3300026078 Ga0207702_10157875 Ga0207702_101578752 401
523 3300027312 Ga0209371_1007621 Ga0209371_10076213 401
524 3300030500 Ga0268256_1002850 Ga0268256_10028507 401
525 3300041441 Ga0451787_050345 Ga0451787_050345_2491_3696 401
526 3300041458 Ga0451798_0052508 Ga0451798_0052508_105_1310 401
527 3300041494 Ga0451837_0187911 Ga0451837_0187911_1405_2610 401
528 3300041496 Ga0451839_0999647 Ga0451839_0999647_192_1397 401
529 3300041501 Ga0451845_0337346 Ga0451845_0337346_701_1906 401
530 3300041503 Ga0451847_0179748 Ga0451847_0179748_194_1399 401
531 3300046474 Ga0495605_0059425 Ga0495605_0059425_326_1531 401
532 3300046501 Ga0495607_0039276 Ga0495607_0039276_65_1270 401
533 3300046513 Ga0495616_0054392 Ga0495616_0054392_616_1821 401
534 3300046524 Ga0495648_0021127 Ga0495648_0021127_3161_4366 401
535 3300046660 Ga0495625_0008610 Ga0495625_0008610_2163_3368 401
536 3300046660 Ga0495625_0133056 Ga0495625_0133056_171_1376 401
537 3300046810 Ga0495660_0022878 Ga0495660_0022878_1147_2352 401
538 3300048904 Ga0496101_0120789 Ga0496101_0120789_96_1301 401
539 3300048905 Ga0496102_0007048 Ga0496102_0007048_4239_5444 401
540 3300048906 Ga0496103_0003184 Ga0496103_0003184_4531_5736 401
541 3300048920 Ga0496117_0004552 Ga0496117_0004552_11722_12927 401
542 3300048921 Ga0496118_0002221 Ga0496118_0002221_6677_7882 401
543 3300048921 Ga0496118_0011880 Ga0496118_0011880_1450_2655 401
544 3300048922 Ga0496119_0009006 Ga0496119_0009006_6798_8003 401
545 3300048922 Ga0496119_0107374 Ga0496119_0107374_121_1356 401
546 3300048923 Ga0496120_0007316 Ga0496120_0007316_199_1404 401
547 3300048923 Ga0496120_0007847 Ga0496120_0007847_2309_3514 401
548 3300048924 Ga0496121_0003663 Ga0496121_0003663_15913_17118 401
549 3300048924 Ga0496121_0133398 Ga0496121_0133398_408_1628 401
550 3300048924 Ga0496121_0191006 Ga0496121_0191006_148_1353 401
551 3300048925 Ga0496122_0006158 Ga0496122_0006158_1190_2425 401
552 3300048926 Ga0496123_0019063 Ga0496123_0019063_886_2091 401
553 3300048926 Ga0496123_0040608 Ga0496123_0040608_1502_2737 401
554 3300048927 Ga0496124_0019529 Ga0496124_0019529_398_1603 401
555 3300048927 Ga0496124_0057870 Ga0496124_0057870_1349_2584 401
556 3300048928 Ga0496125_0020916 Ga0496125_0020916_2687_3892 401
557 3300049581 Ga0501047_0116545 Ga0501047_0116545_135_1340 401
558 3300049742 Ga0501080_0110541 Ga0501080_0110541_1143_2348 401
559 3300049823 Ga0501044_0091828 Ga0501044_0091828_281_1486 401
560 3300050490 nmdc:mga03n38_88634_c1 nmdc:mga03n38_88634_c1_135_1340 401
561 3300050496 nmdc:mga07m45_6419_c1 nmdc:mga07m45_6419_c1_4399_5604 401
562 3300053125 Ga0500618_000405 Ga0500618_000405_9943_11148 401
563 3300053134 Ga0500658_0000937 Ga0500658_0000937_4912_6117 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

210

387

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wc1-assembly2.cif.gz_B soluble adenylyl cyclase cyac from s. platensis in complex with rp- atpalphas 0.8876 222 399
5mbg-assembly1.cif.gz_A-2 structure of a bacterial light-regulated adenylyl cyclase 0.8701 223 399
1ybu-assembly2.cif.gz_C mycobacterium tuberculosis adenylyl cyclase rv1900c chd, in complex with a substrate analog. 0.8677 223 397
3r5g-assembly2.cif.gz_B crystal structure of the adenylyl cyclase cyab from p. aeruginosa 0.8646 221 401
2bw7-assembly1.cif.gz_B a novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen 0.8617 223 399
ID Description Score Start End Superfamily
af_Q55F68_1579_1775_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9042 225 399 3.30.70.1230
af_P90895_428_625_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8785 222 397 3.30.70.1230
af_A0A144A236_312_553_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8739 223 401 3.30.70.1230
1ybuC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8677 223 397 3.30.70.1230
3r5gA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8635 221 401 3.30.70.1230
ID Description Score Start End GO Terms
AF-A0A3D3WHF7-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9245 223 399 GO:0004016
GO:0005886
GO:0006171
GO:0035556
GO:0051536
AF-A0A4P2VHS9-F1-model_v4 Guanylate cyclase domain-containing protein 0.9193 222 400 GO:0004016
GO:0009190
GO:0035556
AF-J3CHR1-F1-model_v4 Family 3 adenylate cyclase 0.9116 223 400 GO:0004016
GO:0005886
GO:0006171
GO:0035556
GO:0051536
AF-A0A2V6LNJ3-F1-model_v4 Guanylate cyclase domain-containing protein 0.9099 217 400 GO:0004016
GO:0009190
GO:0035556
AF-A0A0Q6BQL9-F1-model_v4 Adenylate cyclase 0.9074 222 401 GO:0004016
GO:0005886
GO:0006171
GO:0035556
GO:0051536

Feature Viewer

pLDDT pTM Quality
83.21 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map