metagRoot

F463526

General Info

Members	Datasets	Scaffolds	Average Seq Length
559	358	405	405

Family's Representative Sequence

Representative Sequence	3300003775\|Ga0055524_1007129\|Ga0055524_10071294
Length	452
Sequence	LSETDGSGPFDQQDLNVGDLVRVGANQQFALPPVDKPVMRTAQRPYKNLINGSAGCAGLDVQMDTVQVLPGSVLRHPGYLNFAASRVLSSLSFQCIAIAMGWMIYDQTHSAFALALVGLCQFLPMVVLTFIVGHVADRYDRRRIGLVCQLIEAATSLSLAIATWQQWLTPAGILVAVTILGATAAFERPTMAALLPNIVPELMLQRAVATTTSMQQTAFIVGPSLGGLLYGVDPVAPFAVAAVFFAVASVNVISIRMQWRPAKREPVTLTSIFAGVSFIRSRPVVLGTISLDLFAVLLGGATALLPMFARDILHAGPWGLGLLRAAPAIGALAMSIVLARRPLRSSVGIKMLAAVAVFGAATVVFSLSTNIALSVCALLVVGASDTVSVVVRSSLVQLLTPDEMRGRVNAVNSLFIGTSNQLGEFEGVGTIAIVLMWTRLFPELAKVRTLKG

Samples

	Sample ID	Description	Type	Environment
1	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
2	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
3	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
4	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
5	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
6	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
7	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
8	2513237087	Azorhizobium doebereinerae UFLA1-100	Isolate	Nodule
9	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
10	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
11	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
12	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
13	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
14	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
15	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
16	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
17	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
18	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
19	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
20	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
21	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
22	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
23	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
24	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
25	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
26	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
27	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
28	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
29	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
30	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
31	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
32	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
33	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
34	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
35	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
36	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
37	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
38	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
39	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
40	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
41	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
42	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
43	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
44	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
45	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
46	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
47	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
48	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
49	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
50	2643221629	Devosia sp. Root105	Isolate	Unclassified
51	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
52	2643221662	Devosia sp. Root413D1	Isolate	Unclassified
53	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
54	2718217927	Rhizobium sp. N324	Isolate	Nodule
55	2718218423	Rhizobium sp. N941	Isolate	Nodule
56	2721755809	Rhizobium sp. N541	Isolate	Nodule
57	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
58	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
59	2738541307	Variovorax sp. GV008	Isolate	Unclassified
60	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
61	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
62	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
63	2791355261	Rhizobium sp. J15	Isolate	Nodule
64	2791355266	Rhizobium sp. L43	Isolate	Nodule
65	2791355267	Rhizobium sp. L18	Isolate	Nodule
66	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
67	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
68	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
69	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
70	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
71	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
72	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
73	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
74	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
75	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
76	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
77	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
78	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
79	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
80	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
81	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
82	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
83	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
84	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
85	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
86	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
87	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
88	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
89	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
90	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
91	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
92	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
93	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
94	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
95	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
96	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
97	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
98	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
99	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
100	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
101	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
102	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
103	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
104	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
105	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
106	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
107	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
108	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
109	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
110	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
111	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
112	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
113	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
114	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
115	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
116	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
117	2858950400	Achromobacter sp. K91	Isolate	Unclassified
118	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
119	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
120	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
121	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
122	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
123	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
124	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
125	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
126	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
127	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
128	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
129	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
130	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
131	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
132	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
133	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
134	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
135	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
136	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
137	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
138	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
139	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
140	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
141	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
142	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
143	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
144	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
145	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
146	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
147	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
148	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
149	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
150	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
151	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
152	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
153	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
154	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
155	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
156	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
157	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
158	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
159	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
160	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
161	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
162	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
163	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
164	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
165	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
166	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
167	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
168	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
169	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
170	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
171	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
172	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
173	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
174	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
175	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
176	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
177	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
178	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
179	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
180	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
181	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
182	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
183	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
184	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
185	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
186	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
187	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
188	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
189	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
190	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
191	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
192	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
193	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
194	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
195	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
196	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
197	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
198	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
199	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
200	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
201	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
202	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
203	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
204	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
205	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
206	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
207	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
208	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
209	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
210	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
211	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
212	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
213	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
214	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
215	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
237	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
238	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
239	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
240	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
241	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
242	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
243	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
244	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
245	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
246	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
247	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
248	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
249	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
250	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
251	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
252	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
253	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
254	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
255	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
256	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
257	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
258	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
259	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
260	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
261	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
262	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
263	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
264	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
265	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
266	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
267	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
268	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
269	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
270	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
271	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
272	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
273	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
274	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
275	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
276	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
277	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
278	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
279	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
280	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
281	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
282	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
283	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
284	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
285	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
286	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
287	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
288	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
289	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
290	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
291	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
292	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
293	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
294	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
295	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
296	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
297	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
298	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
299	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
300	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
301	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
302	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
303	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
304	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
305	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
306	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
307	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
308	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
309	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
310	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
311	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
312	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
313	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
314	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
315	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
316	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
317	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
318	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
319	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
320	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
321	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
322	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
323	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
324	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
325	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
326	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
327	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
328	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
329	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
330	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
331	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
332	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
333	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
334	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
335	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
336	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
337	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
338	8005275841	Rhizobium sp. N4311	Isolate	Nodule
339	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
340	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
341	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
342	8005382845	Rhizobium sp. R634	Isolate	Nodule
343	8005395548	Rhizobium sp. R339	Isolate	Nodule
344	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
345	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
346	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
347	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
348	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
349	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
350	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
351	8018176218	Rhizobium sp. N122	Isolate	Nodule
352	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
353	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
354	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
355	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
356	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
357	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
358	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	72.45
Metatranscriptomes	0
Isolates	27.55

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	27.37
Nodule	16.99
Rhizoplane	2.33
Rhizosphere	33.27
Stem	0
Stem Tuber	0
Unclassified	20.04

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000010	3300001979	Bacteria	72485
2	JGI25155J39150_1000044	3300002704	Bacteria	86149
3	JGI25156J39149_1000058	3300002705	Bacteria	86233
4	JGI25162J39368_1000143	3300002737	Bacteria	77302
5	JGI25154J39366_1000174	3300002738	Bacteria	49957
6	JGI25158J39367_1000123	3300002739	Bacteria	18001
7	JGI25157J39369_1000078	3300002741	Bacteria	86233
8	JGI25152J39213_1000462	3300002773	Bacteria	23651
9	JGI25152J39213_1001551	3300002773	Bacteria	9751
10	JGI25152J39213_1001673	3300002773	Bacteria	9195
11	JGI25152J39213_1002597	3300002773	Bacteria	6735
12	JGI25152J39213_1002911	3300002773	Bacteria	6107
13	JGI25152J39213_1010426	3300002773	Bacteria	2126
14	JGI25152J39213_1011332	3300002773	Bacteria	1978
15	JGI25150J39212_1000047	3300002774	Bacteria	75103
16	JGI25150J39212_1000084	3300002774	Bacteria	55774
17	JGI25150J39212_1000085	3300002774	Bacteria	55053
18	JGI25159J45721_1000756	3300002987	Bacteria	14014
19	JGI25159J45721_1001008	3300002987	Bacteria	12127
20	JGI25151J46595_10000126	3300003187	Bacteria	103193
21	JGI25151J46595_10000190	3300003187	Bacteria	75765
22	JGI25151J46595_10002195	3300003187	Bacteria	12080
23	JGI25151J46595_10003188	3300003187	Bacteria	9195
24	JGI25151J46595_10014212	3300003187	Bacteria	3555
25	JGI25165J46597_1000356	3300003214	Bacteria	51368
26	JGI25165J46597_1000500	3300003214	Bacteria	37811
27	JGI25165J46597_1003573	3300003214	Bacteria	3782
28	JGI25153J46596_10001341	3300003215	Bacteria	14724
29	JGI25153J46596_10002046	3300003215	Bacteria	11886
30	JGI25153J46596_10003206	3300003215	Bacteria	9195
31	JGI25153J46596_10003219	3300003215	Bacteria	9174
32	JGI25153J46596_10027728	3300003215	Bacteria	1978
33	rootH1_10069601	3300003316	Bacteria	5388
34	rootH2_10059318	3300003320	Bacteria	5218
35	rootL2_10006456	3300003322	Bacteria	7179
36	JGI25160J50197_1000001	3300003354	Bacteria	782301
37	JGI25160J50197_1001364	3300003354	Bacteria	12298
38	JGI25160J50197_1002189	3300003354	Bacteria	9195
39	JGI25160J50197_1013198	3300003354	Bacteria	2828
40	JGI25161J50226_1000001	3300003374	Bacteria	655036
41	JGI25161J50226_1000118	3300003374	Bacteria	58587
42	JGI25161J50226_1004790	3300003374	Bacteria	2767
43	Ga0055526_1002019	3300003771	Bacteria	13965
44	Ga0055526_1003623	3300003771	Bacteria	9670
45	Ga0055526_1003912	3300003771	Bacteria	9195
46	Ga0055537_1001461	3300003773	Bacteria	9195
47	Ga0055524_1001714	3300003775	Bacteria	12172
48	Ga0055524_1002596	3300003775	Bacteria	9195
49	Ga0055524_1005388	3300003775	Bacteria	5719
50	Ga0055524_1007129	3300003775	Bacteria	4787
51	Ga0055534_1000847	3300003784	Bacteria	14054
52	Ga0055528_1000193	3300003790	Bacteria	51831
53	Ga0055528_1001004	3300003790	Bacteria	18707
54	Ga0055528_1002403	3300003790	Bacteria	10073
55	Ga0055528_1002762	3300003790	Bacteria	9195
56	Ga0055528_1007962	3300003790	Bacteria	4615
57	Ga0055528_1011260	3300003790	Bacteria	3570
58	Ga0055540_1000293	3300003792	Bacteria	44565
59	Ga0055540_1002969	3300003792	Bacteria	8507
60	Ga0055540_1013080	3300003792	Bacteria	2558
61	Ga0055531_10002692	3300003794	Bacteria	11701
62	Ga0055543_1000003	3300004625	Bacteria	358656
63	Ga0055543_1000304	3300004625	Bacteria	34441
64	Ga0055543_1006850	3300004625	Bacteria	2705
65	Ga0065165_1000469	3300005262	Bacteria	63164
66	Ga0065165_1002090	3300005262	Bacteria	18298
67	Ga0065165_1002753	3300005262	Bacteria	13999
68	Ga0065165_1010109	3300005262	Bacteria	4134
69	Ga0070658_10038326	3300005327	Bacteria	3865
70	Ga0070658_10039494	3300005327	Bacteria	3808
71	Ga0070670_100005707	3300005331	Bacteria	10518
72	Ga0070660_100033806	3300005339	Bacteria	3858
73	Ga0070660_100173045	3300005339	Bacteria	1745
74	Ga0070661_100092590	3300005344	Bacteria	2239
75	Ga0070669_100067798	3300005353	Bacteria	2633
76	Ga0070674_100051440	3300005356	Bacteria	2839
77	Ga0070673_100025932	3300005364	Bacteria	4322
78	Ga0068867_100120701	3300005459	Bacteria	2026
79	Ga0070665_100074211	3300005548	Bacteria	3407
80	Ga0068855_100257852	3300005563	Bacteria	1943
81	Ga0070664_100125069	3300005564	Bacteria	2254
82	Ga0068857_100008613	3300005577	Bacteria	8827
83	Ga0068854_100046271	3300005578	Bacteria	3097
84	Ga0068856_100078254	3300005614	Bacteria	3278
85	Ga0068852_100002986	3300005616	Bacteria	11756
86	Ga0068852_100114985	3300005616	Bacteria	2452
87	Ga0068851_10075727	3300005834	Bacteria	1749
88	Ga0068862_100053481	3300005844	Bacteria	3457
89	Ga0075365_10016689	3300006038	Bacteria	4474
90	Ga0075367_10018190	3300006178	Bacteria	3873
91	Ga0075366_10016151	3300006195	Bacteria	4287
92	Ga0068871_100185446	3300006358	Bacteria	1790
93	Ga0068865_100030805	3300006881	Bacteria	3571
94	Ga0105240_10000014	3300009093	Bacteria	482033
95	Ga0105241_10049730	3300009174	Bacteria	3194
96	Ga0105237_10001389	3300009545	Bacteria	31975
97	Ga0105237_10012821	3300009545	Bacteria	8816
98	Ga0123341_1007449	3300009765	Bacteria	9975
99	Ga0123342_1022778	3300009766	Bacteria	4184
100	Ga0105239_10001103	3300010375	Bacteria	37309
101	Ga0105239_10004698	3300010375	Bacteria	16222
102	Ga0105239_10097287	3300010375	Bacteria	3253
103	Ga0105239_10212986	3300010375	Bacteria	2166
104	Ga0157370_10001013	3300013104	Bacteria	35493
105	Ga0157370_10006535	3300013104	Bacteria	12836
106	Ga0157370_10053112	3300013104	Bacteria	3865
107	Ga0157375_10233559	3300013308	Bacteria	1998
108	Ga0182007_10004389	3300015262	Bacteria	6402
109	Ga0182005_1002036	3300015265	Bacteria	7584
110	Ga0163161_10000171	3300017792	Bacteria	59497
111	Ga0209435_100054	3300025206	Bacteria	86285
112	Ga0209436_100198	3300025208	Bacteria	27841
113	Ga0209437_100098	3300025233	Bacteria	229766
114	Ga0207425_1000010	3300025245	Bacteria	572898
115	Ga0207425_1000909	3300025245	Bacteria	14211
116	Ga0207425_1003761	3300025245	Bacteria	4743
117	Ga0207425_1012401	3300025245	Bacteria	2001
118	Ga0209646_1000170	3300025246	Bacteria	86285
119	Ga0209646_1003191	3300025246	Bacteria	3297
120	Ga0209026_1000193	3300025250	Bacteria	86285
121	Ga0209677_106413	3300025253	Bacteria	2785
122	Ga0209759_1000222	3300025256	Bacteria	86285
123	Ga0209129_1000013	3300025258	Bacteria	524874
124	Ga0209129_1000034	3300025258	Bacteria	330950
125	Ga0209129_1000348	3300025258	Bacteria	39224
126	Ga0209129_1001467	3300025258	Bacteria	13113
127	Ga0209129_1005104	3300025258	Bacteria	4810
128	Ga0209233_1000095	3300025261	Bacteria	303783
129	Ga0209233_1000148	3300025261	Bacteria	185135
130	Ga0209233_1000913	3300025261	Bacteria	12872
131	Ga0209565_1000228	3300025263	Bacteria	61687
132	Ga0209673_1000010	3300025273	Bacteria	596656
133	Ga0209673_1000025	3300025273	Bacteria	404572
134	Ga0209673_1000309	3300025273	Bacteria	90058
135	Ga0209673_1001435	3300025273	Bacteria	22697
136	Ga0209673_1001488	3300025273	Bacteria	21842
137	Ga0209673_1002597	3300025273	Bacteria	12182
138	Ga0209673_1002930	3300025273	Bacteria	10739
139	Ga0209130_1000003	3300025284	Bacteria	677988
140	Ga0209130_1000020	3300025284	Bacteria	379297
141	Ga0209130_1000284	3300025284	Bacteria	62277
142	Ga0209675_1000238	3300025291	Bacteria	54807
143	Ga0209676_1002911	3300025292	Bacteria	11198
144	Ga0209025_1000022	3300025294	Bacteria	574487
145	Ga0209025_1000026	3300025294	Bacteria	519850
146	Ga0209025_1000393	3300025294	Bacteria	90571
147	Ga0209025_1002036	3300025294	Bacteria	23065
148	Ga0209025_1002049	3300025294	Bacteria	22963
149	Ga0209025_1015702	3300025294	Bacteria	4539
150	Ga0209025_1017623	3300025294	Bacteria	4106
151	Ga0209025_1043431	3300025294	Bacteria	1894
152	Ga0209564_1000222	3300025295	Bacteria	129405
153	Ga0209564_1000618	3300025295	Bacteria	54453
154	Ga0209564_1000628	3300025295	Bacteria	53862
155	Ga0209564_1001430	3300025295	Bacteria	24490
156	Ga0209564_1006170	3300025295	Bacteria	6565
157	Ga0209564_1019076	3300025295	Bacteria	2580
158	Ga0209758_1000080	3300025297	Bacteria	261472
159	Ga0209758_1000134	3300025297	Bacteria	178294
160	Ga0209758_1001930	3300025297	Bacteria	22532
161	Ga0209758_1002077	3300025297	Bacteria	21309
162	Ga0209758_1002703	3300025297	Bacteria	17489
163	Ga0209758_1003551	3300025297	Bacteria	14026
164	Ga0209050_1006344	3300025298	Bacteria	7033
165	Ga0209256_1000060	3300025299	Bacteria	262342
166	Ga0209256_1000561	3300025299	Bacteria	53094
167	Ga0209256_1002014	3300025299	Bacteria	18121
168	Ga0209256_1002755	3300025299	Bacteria	13571
169	Ga0209256_1006638	3300025299	Bacteria	6035
170	Ga0207426_1000008	3300025302	Bacteria	848730
171	Ga0207426_1000011	3300025302	Bacteria	791203
172	Ga0207426_1000100	3300025302	Bacteria	262342
173	Ga0207426_1000218	3300025302	Bacteria	135865
174	Ga0209051_1000097	3300025303	Bacteria	167378
175	Ga0209051_1000245	3300025303	Bacteria	91350
176	Ga0209051_1023997	3300025303	Bacteria	2522
177	Ga0209257_1001946	3300025304	Bacteria	22293
178	Ga0209257_1007470	3300025304	Bacteria	6587
179	Ga0207645_10055364	3300025907	Bacteria	2532
180	Ga0207705_10023332	3300025909	Bacteria	4413
181	Ga0207705_10068794	3300025909	Bacteria	2564
182	Ga0207695_10000037	3300025913	Bacteria	476303
183	Ga0207671_10000168	3300025914	Bacteria	100117
184	Ga0207671_10003788	3300025914	Bacteria	14849
185	Ga0207657_10002856	3300025919	Bacteria	18574
186	Ga0207657_10044996	3300025919	Bacteria	3877
187	Ga0207657_10053820	3300025919	Bacteria	3484
188	Ga0207649_10020952	3300025920	Bacteria	3754
189	Ga0207681_10107524	3300025923	Bacteria	2023
190	Ga0207650_10000822	3300025925	Bacteria	23833
191	Ga0207704_10044550	3300025938	Bacteria	2629
192	Ga0207679_10186270	3300025945	Bacteria	1721
193	Ga0207667_10002485	3300025949	Bacteria	22977
194	Ga0207667_10165326	3300025949	Bacteria	2275
195	Ga0207651_10071975	3300025960	Bacteria	2453
196	Ga0207640_10028391	3300025981	Bacteria	3420
197	Ga0207640_10068670	3300025981	Bacteria	2376
198	Ga0207639_10102776	3300026041	Bacteria	2314
199	Ga0207678_10064369	3300026067	Bacteria	3150
200	Ga0207702_10058095	3300026078	Bacteria	3291
201	Ga0207702_10214095	3300026078	Bacteria	1793
202	Ga0207674_10036468	3300026116	Bacteria	5122
203	Ga0207683_10051785	3300026121	Bacteria	3597
204	Ga0207698_10092789	3300026142	Bacteria	2476
205	Ga0268266_10000974	3300028379	Bacteria	36355
206	Ga0268265_10009258	3300028380	Bacteria	6657
207	Ga0265319_1003170	3300028563	Bacteria	8663
208	Ga0307515_10023717	3300028794	Bacteria	10734
209	Ga0265338_10037801	3300028800	Bacteria	4585
210	Ga0265320_10020660	3300031240	Bacteria	3562
211	Ga0265325_10001162	3300031241	Bacteria	18825
212	Ga0265339_10000239	3300031249	Bacteria	44164
213	Ga0265316_10012591	3300031344	Bacteria	7576
214	Ga0265313_10001393	3300031595	Bacteria	22670
215	Ga0265313_10055472	3300031595	Bacteria	1877
216	Ga0265314_10103306	3300031711	Bacteria	1827
217	Ga0307412_10000061	3300031911	Bacteria	126274
218	Ga0307412_10023912	3300031911	Bacteria	3766
219	Ga0307416_100101946	3300032002	Bacteria	2501
220	Ga0451833_1329452	3300041491	Bacteria	2166
221	Ga0451837_1567322	3300041494	Bacteria	1461
222	Ga0451839_0012095	3300041496	Bacteria	4923
223	Ga0451845_0746327	3300041501	Bacteria	1765
224	Ga0466970_0000072	3300044765	Bacteria	40522
225	Ga0466959_0059387	3300045049	Bacteria	2785
226	Ga0495651_0171943	3300046462	Bacteria	1542
227	Ga0495650_0019875	3300046471	Bacteria	3290
228	Ga0495585_0034473	3300046492	Bacteria	2861
229	Ga0495585_0054958	3300046492	Bacteria	2201
230	Ga0495606_0006398	3300046507	Bacteria	10870
231	Ga0495606_0033436	3300046507	Bacteria	3546
232	Ga0495606_0098432	3300046507	Bacteria	1785
233	Ga0495610_0000861	3300046512	Bacteria	28368
234	Ga0495616_0055331	3300046513	Bacteria	1965
235	Ga0495616_0056083	3300046513	Bacteria	1947
236	Ga0495620_0009674	3300046515	Bacteria	5117
237	Ga0495632_0002455	3300046519	Bacteria	14104
238	Ga0495632_0041379	3300046519	Bacteria	2316
239	Ga0495632_0097918	3300046519	Bacteria	1384
240	Ga0495643_0007759	3300046522	Bacteria	6869
241	Ga0495643_0022638	3300046522	Bacteria	3583
242	Ga0495643_0025270	3300046522	Bacteria	3362
243	Ga0495643_0065430	3300046522	Bacteria	1919
244	Ga0495648_0028001	3300046524	Bacteria	3762
245	Ga0495654_0040337	3300046530	Bacteria	2327
246	Ga0495587_0076772	3300046536	Bacteria	1940
247	Ga0495609_0026716	3300046538	Bacteria	2642
248	Ga0495622_0094700	3300046557	Bacteria	1371
249	Ga0495633_0017445	3300046558	Bacteria	3670
250	Ga0495633_0060582	3300046558	Bacteria	1773
251	Ga0495668_0038967	3300046616	Bacteria	2654
252	Ga0495611_0058197	3300046648	Bacteria	1753
253	Ga0495625_0020565	3300046660	Bacteria	5093
254	Ga0495625_0057463	3300046660	Bacteria	2766
255	Ga0495625_0109714	3300046660	Bacteria	1887
256	Ga0495661_0022219	3300046665	Bacteria	4128
257	Ga0495657_0073137	3300046675	Bacteria	2234
258	Ga0495670_0057835	3300046691	Bacteria	1947
259	Ga0495671_0029811	3300046692	Bacteria	2799
260	Ga0495649_0067372	3300046694	Bacteria	1920
261	Ga0495604_0008505	3300047317	Bacteria	8103
262	Ga0495672_0014047	3300047320	Bacteria	5499
263	Ga0495683_0073442	3300047323	Bacteria	1677
264	Ga0495687_043788	3300047443	Bacteria	1948
265	Ga0495673_0052229	3300047469	Bacteria	1787
266	Ga0495686_0002146	3300047472	Bacteria	19287
267	Ga0495686_0005448	3300047472	Bacteria	10038
268	Ga0495686_0007219	3300047472	Bacteria	8366
269	Ga0495626_0073036	3300048091	Bacteria	1537
270	Ga0496100_0003636	3300048903	Bacteria	8058
271	Ga0496102_0003723	3300048905	Bacteria	12887
272	Ga0496102_0028351	3300048905	Bacteria	5000
273	Ga0496104_0007056	3300048907	Bacteria	9909
274	Ga0496105_0009886	3300048908	Bacteria	7479
275	Ga0496106_0000601	3300048909	Bacteria	25684
276	Ga0496106_0262855	3300048909	Bacteria	1381
277	Ga0496110_0009016	3300048913	Bacteria	8049
278	Ga0496111_0032193	3300048914	Bacteria	3738
279	Ga0496113_0008924	3300048916	Bacteria	6561
280	Ga0496113_0302194	3300048916	Bacteria	1281
281	Ga0496116_0001927	3300048919	Bacteria	22365
282	Ga0496116_0004742	3300048919	Bacteria	12840
283	Ga0496116_0008405	3300048919	Bacteria	8961
284	Ga0496116_0010833	3300048919	Bacteria	7605
285	Ga0496116_0018333	3300048919	Bacteria	5399
286	Ga0496116_0044368	3300048919	Bacteria	3020
287	Ga0496116_0044807	3300048919	Bacteria	3000
288	Ga0496116_0058861	3300048919	Bacteria	2502
289	Ga0496117_0001336	3300048920	Bacteria	36255
290	Ga0496117_0005284	3300048920	Bacteria	13681
291	Ga0496117_0012823	3300048920	Bacteria	7350
292	Ga0496117_0022676	3300048920	Bacteria	5029
293	Ga0496118_0003734	3300048921	Bacteria	18843
294	Ga0496118_0004095	3300048921	Bacteria	17672
295	Ga0496118_0007446	3300048921	Bacteria	11597
296	Ga0496118_0011741	3300048921	Bacteria	8513
297	Ga0496118_0019985	3300048921	Bacteria	5959
298	Ga0496118_0044626	3300048921	Bacteria	3469
299	Ga0496118_0053994	3300048921	Bacteria	3048
300	Ga0496118_0137912	3300048921	Bacteria	1553
301	Ga0496119_0005806	3300048922	Bacteria	11672
302	Ga0496120_0002450	3300048923	Bacteria	18765
303	Ga0496120_0028818	3300048923	Bacteria	3397
304	Ga0496121_0001365	3300048924	Bacteria	41600
305	Ga0496121_0001813	3300048924	Bacteria	34507
306	Ga0496121_0005187	3300048924	Bacteria	16886
307	Ga0496121_0006687	3300048924	Bacteria	14175
308	Ga0496121_0025023	3300048924	Bacteria	5684
309	Ga0496121_0063397	3300048924	Bacteria	3020
310	Ga0496121_0072256	3300048924	Bacteria	2770
311	Ga0496121_0086885	3300048924	Bacteria	2456
312	Ga0496121_0120142	3300048924	Bacteria	1986
313	Ga0496121_0140634	3300048924	Bacteria	1791
314	Ga0496121_0208622	3300048924	Bacteria	1386
315	Ga0496122_0000449	3300048925	Bacteria	85961
316	Ga0496122_0000669	3300048925	Bacteria	68904
317	Ga0496122_0006435	3300048925	Bacteria	13487
318	Ga0496122_0023514	3300048925	Bacteria	5429
319	Ga0496122_0059613	3300048925	Bacteria	2816
320	Ga0496122_0060433	3300048925	Bacteria	2790
321	Ga0496122_0103274	3300048925	Bacteria	1897
322	Ga0496122_0108561	3300048925	Bacteria	1830
323	Ga0496123_0000263	3300048926	Bacteria	105886
324	Ga0496123_0000977	3300048926	Bacteria	44079
325	Ga0496123_0001831	3300048926	Bacteria	27939
326	Ga0496123_0005654	3300048926	Bacteria	12483
327	Ga0496123_0029276	3300048926	Bacteria	4059
328	Ga0496123_0044405	3300048926	Bacteria	3039
329	Ga0496123_0051239	3300048926	Bacteria	2750
330	Ga0496124_0000103	3300048927	Bacteria	179162
331	Ga0496124_0002086	3300048927	Bacteria	26982
332	Ga0496124_0005915	3300048927	Bacteria	13538
333	Ga0496124_0005932	3300048927	Bacteria	13515
334	Ga0496124_0045318	3300048927	Bacteria	3770
335	Ga0496124_0132692	3300048927	Bacteria	1976
336	Ga0496125_0000051	3300048928	Bacteria	285754
337	Ga0496125_0010744	3300048928	Bacteria	9222
338	Ga0496125_0011052	3300048928	Bacteria	9060
339	Ga0496125_0013656	3300048928	Bacteria	7972
340	Ga0496125_0037025	3300048928	Bacteria	4248
341	Ga0496125_0125673	3300048928	Bacteria	1818
342	Ga0496126_0014121	3300048929	Bacteria	8088
343	Ga0496126_0023441	3300048929	Bacteria	5982
344	Ga0496126_0030206	3300048929	Bacteria	5136
345	Ga0496126_0120138	3300048929	Bacteria	2280
346	Ga0501032_0029098	3300049569	Bacteria	3794
347	Ga0501032_0050406	3300049569	Bacteria	2807
348	Ga0501033_0022120	3300049570	Bacteria	4797
349	Ga0501033_0025970	3300049570	Bacteria	4409
350	Ga0501034_0088750	3300049571	Bacteria	3090
351	Ga0501034_0094210	3300049571	Bacteria	2991
352	Ga0501034_0333873	3300049571	Bacteria	1447
353	Ga0501036_0028311	3300049572	Bacteria	4735
354	Ga0501036_0052321	3300049572	Bacteria	3458
355	Ga0501036_0230401	3300049572	Bacteria	1555
356	Ga0501037_0036402	3300049573	Bacteria	3627
357	Ga0501038_0025719	3300049574	Bacteria	5244
358	Ga0501038_0125881	3300049574	Bacteria	2109
359	Ga0501039_0011916	3300049575	Bacteria	6627
360	Ga0501039_0192647	3300049575	Bacteria	1603
361	Ga0501043_0038729	3300049579	Bacteria	3749
362	Ga0501043_0137821	3300049579	Bacteria	1911
363	Ga0501046_0004753	3300049580	Bacteria	12253
364	Ga0501046_0057349	3300049580	Bacteria	3055
365	Ga0501047_0015902	3300049581	Bacteria	7172
366	Ga0501068_0078033	3300049584	Bacteria	2029
367	Ga0501070_0016437	3300049586	Bacteria	6218
368	Ga0501070_0078893	3300049586	Bacteria	2724
369	Ga0501073_0100322	3300049589	Bacteria	2010
370	Ga0501238_006963	3300049671	Bacteria	1464
371	Ga0501080_0055270	3300049742	Bacteria	3698
372	Ga0501083_0015489	3300049744	Bacteria	5341
373	Ga0501035_0010430	3300049822	Bacteria	8612
374	Ga0501035_0024966	3300049822	Bacteria	5480
375	Ga0501035_0080027	3300049822	Bacteria	2885
376	Ga0501035_0268149	3300049822	Bacteria	1446
377	Ga0501044_0012345	3300049823	Bacteria	9247
378	Ga0501044_0019592	3300049823	Bacteria	7233
379	nmdc:mga07m45_292_c1	3300050496	Bacteria	20234
380	nmdc:mga0sz30_5581_c1	3300050516	Bacteria	4623
381	Ga0500610_0000748	3300053079	Bacteria	10188
382	Ga0500610_0059484	3300053079	Bacteria	1993
383	Ga0500610_0093992	3300053079	Bacteria	1556
384	Ga0500578_0006427	3300053086	Bacteria	7846
385	Ga0500593_002920	3300053117	Bacteria	6356
386	Ga0500618_000356	3300053125	Bacteria	31771
387	Ga0500618_000866	3300053125	Bacteria	16181
388	Ga0500658_0005523	3300053134	Bacteria	4706
389	Ga0500658_0084119	3300053134	Bacteria	1366
390	Ga0500559_0008594	3300053136	Bacteria	4467
391	Ga0500568_0000509	3300053139	Bacteria	28652
392	Ga0500568_0001937	3300053139	Bacteria	12678
393	Ga0500573_0003486	3300053140	Bacteria	8146
394	Ga0500573_0142096	3300053140	Bacteria	1321
395	Ga0500604_0003671	3300053151	Bacteria	4123
396	Ga0500616_0000421	3300053153	Bacteria	56739
397	Ga0500616_0003563	3300053153	Bacteria	11794
398	Ga0500616_0005619	3300053153	Bacteria	8467
399	Ga0500616_0006556	3300053153	Bacteria	7597
400	Ga0500622_0000210	3300053156	Bacteria	61827
401	Ga0500627_0005312	3300053158	Bacteria	4269
402	Ga0500627_0005636	3300053158	Bacteria	4177
403	Ga0500633_0000143	3300053160	Bacteria	9436
404	Ga0500634_0020975	3300053161	Bacteria	3536
405	Ga0500636_0069729	3300053177	Bacteria	2040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048919	Ga0496116_0044368	Ga0496116_0044368_1954_3009	328
2	3300053140	Ga0500573_0142096	Ga0500573_0142096_216_1295	346
3	3300048909	Ga0496106_0262855	Ga0496106_0262855_47_1159	350
4	3300028800	Ga0265338_10037801	Ga0265338_100378013	357
5	3300031241	Ga0265325_10001162	Ga0265325_1000116218	357
6	3300031249	Ga0265339_10000239	Ga0265339_1000023917	357
7	3300031344	Ga0265316_10012591	Ga0265316_100125918	357
8	3300031595	Ga0265313_10001393	Ga0265313_1000139318	357
9	3300049671	Ga0501238_006963	Ga0501238_006963_241_1413	360
10	3300005353	Ga0070669_100067798	Ga0070669_1000677982	361
11	3300046471	Ga0495650_0019875	Ga0495650_0019875_1791_3014	369
12	3300046512	Ga0495610_0000861	Ga0495610_0000861_8339_9562	369
13	3300046522	Ga0495643_0022638	Ga0495643_0022638_933_2156	369
14	3300047469	Ga0495673_0052229	Ga0495673_0052229_236_1459	369
15	3300047472	Ga0495686_0005448	Ga0495686_0005448_2476_3699	369
16	iso_pu_bacteria	2855730933	2855732081	370
17	iso_pu_bacteria	2855767633	2855768788	370
18	3300048921	Ga0496118_0044626	Ga0496118_0044626_705_1985	371
19	3300048923	Ga0496120_0028818	Ga0496120_0028818_390_1670	371
20	3300048925	Ga0496122_0108561	Ga0496122_0108561_185_1465	371
21	3300048928	Ga0496125_0000051	Ga0496125_0000051_262849_264129	371
22	3300025261	Ga0209233_1000913	Ga0209233_10009139	374
23	3300048924	Ga0496121_0001365	Ga0496121_0001365_28471_29751	376
24	3300005331	Ga0070670_100005707	Ga0070670_1000057073	378
25	3300025925	Ga0207650_10000822	Ga0207650_1000082220	378
26	3300025923	Ga0207681_10107524	Ga0207681_101075242	379
27	3300048927	Ga0496124_0045318	Ga0496124_0045318_377_1618	379
28	3300048919	Ga0496116_0010833	Ga0496116_0010833_6263_7498	380
29	3300048925	Ga0496122_0000449	Ga0496122_0000449_25316_26557	380
30	3300048926	Ga0496123_0000263	Ga0496123_0000263_79275_80516	380
31	3300002773	JGI25152J39213_1001673	JGI25152J39213_10016733	383
32	3300003214	JGI25165J46597_1003573	JGI25165J46597_10035732	383
33	3300003374	JGI25161J50226_1004790	JGI25161J50226_10047902	383
34	3300003784	Ga0055534_1000847	Ga0055534_100084717	383
35	3300003794	Ga0055531_10002692	Ga0055531_1000269215	383
36	3300004625	Ga0055543_1006850	Ga0055543_10068503	383
37	3300005262	Ga0065165_1002753	Ga0065165_100275317	383
38	3300025245	Ga0207425_1000909	Ga0207425_10009093	383
39	3300025258	Ga0209129_1000013	Ga0209129_1000013417	383
40	3300025263	Ga0209565_1000228	Ga0209565_100022813	383
41	3300025273	Ga0209673_1000309	Ga0209673_100030944	383
42	3300025284	Ga0209130_1000284	Ga0209130_100028454	383
43	3300025291	Ga0209675_1000238	Ga0209675_100023825	383
44	3300025292	Ga0209676_1002911	Ga0209676_100291115	383
45	3300025294	Ga0209025_1000393	Ga0209025_100039357	383
46	3300025295	Ga0209564_1000222	Ga0209564_100022285	383
47	3300025297	Ga0209758_1000134	Ga0209758_1000134127	383
48	3300025299	Ga0209256_1000060	Ga0209256_1000060194	383
49	3300025302	Ga0207426_1000100	Ga0207426_1000100194	383
50	3300025304	Ga0209257_1001946	Ga0209257_100194626	383
51	3300046462	Ga0495651_0171943	Ga0495651_0171943_367_1518	383
52	3300031911	Ga0307412_10000061	Ga0307412_10000061120	385
53	3300002739	JGI25158J39367_1000123	JGI25158J39367_100012320	387
54	3300002773	JGI25152J39213_1001551	JGI25152J39213_100155110	387
55	3300003215	JGI25153J46596_10002046	JGI25153J46596_1000204612	387
56	3300003354	JGI25160J50197_1013198	JGI25160J50197_10131983	387
57	3300003374	JGI25161J50226_1000118	JGI25161J50226_100011833	387
58	3300003790	Ga0055528_1002403	Ga0055528_10024032	387
59	3300004625	Ga0055543_1000304	Ga0055543_100030432	387
60	3300005356	Ga0070674_100051440	Ga0070674_1000514402	387
61	3300005364	Ga0070673_100025932	Ga0070673_1000259324	387
62	3300005459	Ga0068867_100120701	Ga0068867_1001207012	387
63	3300006881	Ga0068865_100030805	Ga0068865_1000308052	387
64	3300025208	Ga0209436_100198	Ga0209436_10019813	387
65	3300025284	Ga0209130_1000020	Ga0209130_1000020165	387
66	3300025297	Ga0209758_1002077	Ga0209758_100207717	387
67	3300025302	Ga0207426_1000008	Ga0207426_1000008234	387
68	3300025907	Ga0207645_10055364	Ga0207645_100553642	387
69	3300025938	Ga0207704_10044550	Ga0207704_100445501	387
70	3300025960	Ga0207651_10071975	Ga0207651_100719753	387
71	3300026121	Ga0207683_10051785	Ga0207683_100517855	387
72	3300053153	Ga0500616_0000421	Ga0500616_0000421_17793_19052	388
73	3300003775	Ga0055524_1007129	Ga0055524_10071294	389
74	3300003790	Ga0055528_1011260	Ga0055528_10112602	389
75	3300025273	Ga0209673_1001488	Ga0209673_10014882	389
76	3300025273	Ga0209673_1002597	Ga0209673_10025977	389
77	3300025294	Ga0209025_1043431	Ga0209025_10434312	389
78	3300025295	Ga0209564_1001430	Ga0209564_100143021	389
79	3300025299	Ga0209256_1006638	Ga0209256_10066384	389
80	3300048925	Ga0496122_0059613	Ga0496122_0059613_738_1961	389
81	3300005262	Ga0065165_1002090	Ga0065165_10020909	390
82	3300025909	Ga0207705_10023332	Ga0207705_100233326	390
83	3300025919	Ga0207657_10002856	Ga0207657_1000285621	390
84	3300048920	Ga0496117_0022676	Ga0496117_0022676_1215_2447	391
85	3300048921	Ga0496118_0053994	Ga0496118_0053994_903_2135	391
86	3300049580	Ga0501046_0004753	Ga0501046_0004753_4341_5591	391
87	3300049581	Ga0501047_0015902	Ga0501047_0015902_2110_3360	391
88	3300026067	Ga0207678_10064369	Ga0207678_100643693	392
89	3300048921	Ga0496118_0019985	Ga0496118_0019985_1251_2474	392
90	3300050516	nmdc:mga0sz30_5581_c1	nmdc:mga0sz30_5581_c1_1872_3095	392
91	3300003775	Ga0055524_1001714	Ga0055524_10017146	395
92	3300006358	Ga0068871_100185446	Ga0068871_1001854462	395
93	3300025273	Ga0209673_1002930	Ga0209673_100293013	395
94	3300025295	Ga0209564_1000628	Ga0209564_10006288	395
95	3300053140	Ga0500573_0003486	Ga0500573_0003486_4065_5306	395
96	3300025298	Ga0209050_1006344	Ga0209050_10063443	396
97	3300025303	Ga0209051_1023997	Ga0209051_10239973	396
98	3300048924	Ga0496121_0063397	Ga0496121_0063397_662_1903	396
99	3300048925	Ga0496122_0000669	Ga0496122_0000669_58994_60235	396
100	3300048926	Ga0496123_0000977	Ga0496123_0000977_18347_19588	396
101	3300048927	Ga0496124_0132692	Ga0496124_0132692_652_1893	396
102	3300048928	Ga0496125_0011052	Ga0496125_0011052_7611_8852	396
103	3300002773	JGI25152J39213_1002597	JGI25152J39213_10025972	397
104	3300003187	JGI25151J46595_10014212	JGI25151J46595_100142122	397
105	3300003790	Ga0055528_1001004	Ga0055528_10010045	397
106	3300005262	Ga0065165_1010109	Ga0065165_10101094	397
107	3300025258	Ga0209129_1000348	Ga0209129_100034842	397
108	3300025273	Ga0209673_1000010	Ga0209673_1000010330	397
109	3300025294	Ga0209025_1002049	Ga0209025_100204916	397
110	3300025294	Ga0209025_1017623	Ga0209025_10176236	397
111	3300025295	Ga0209564_1019076	Ga0209564_10190761	397
112	3300025299	Ga0209256_1002014	Ga0209256_100201424	397
113	3300048919	Ga0496116_0001927	Ga0496116_0001927_12226_13467	397
114	iso_pu_bacteria	2643221662	2644350964	397
115	3300002773	JGI25152J39213_1011332	JGI25152J39213_10113322	398
116	3300003215	JGI25153J46596_10027728	JGI25153J46596_100277282	398
117	3300025233	Ga0209437_100098	Ga0209437_10009879	398
118	3300025245	Ga0207425_1012401	Ga0207425_10124012	398
119	3300025258	Ga0209129_1005104	Ga0209129_10051042	398
120	3300025261	Ga0209233_1000095	Ga0209233_1000095196	398
121	3300025294	Ga0209025_1015702	Ga0209025_10157025	398
122	3300025297	Ga0209758_1003551	Ga0209758_100355117	398
123	3300046492	Ga0495585_0054958	Ga0495585_0054958_495_1718	398
124	3300046519	Ga0495632_0002455	Ga0495632_0002455_2440_3663	398
125	3300046557	Ga0495622_0094700	Ga0495622_0094700_66_1289	398
126	3300046558	Ga0495633_0060582	Ga0495633_0060582_102_1325	398
127	3300046660	Ga0495625_0020565	Ga0495625_0020565_405_1751	398
128	3300048928	Ga0496125_0037025	Ga0496125_0037025_306_1502	398
129	3300049570	Ga0501033_0025970	Ga0501033_0025970_2250_3473	398
130	3300049822	Ga0501035_0010430	Ga0501035_0010430_2486_3709	398
131	iso_pu_bacteria	2582581304	2585255199	398
132	iso_pu_bacteria	2599185292	2599902864	398
133	iso_pu_bacteria	2643221569	2643861699	398
134	iso_pu_bacteria	2643221594	2643983271	398
135	iso_pu_bacteria	2643221621	2644123535	398
136	iso_pu_bacteria	2808606395	2809033203	398
137	iso_pu_bacteria	2858950400	2858952122	398
138	iso_pu_bacteria	2941479691	2941482549	398
139	3300047317	Ga0495604_0008505	Ga0495604_0008505_3149_4411	399
140	3300049823	Ga0501044_0019592	Ga0501044_0019592_2563_3786	399
141	iso_pu_bacteria	2857542790	2857543416	399
142	3300046507	Ga0495606_0098432	Ga0495606_0098432_158_1381	400
143	3300046522	Ga0495643_0025270	Ga0495643_0025270_1354_2577	400
144	3300048919	Ga0496116_0058861	Ga0496116_0058861_639_1862	400
145	3300048920	Ga0496117_0012823	Ga0496117_0012823_2275_3498	400
146	3300048921	Ga0496118_0007446	Ga0496118_0007446_6787_8010	400
147	3300048924	Ga0496121_0025023	Ga0496121_0025023_3331_4554	400
148	3300048926	Ga0496123_0051239	Ga0496123_0051239_943_2166	400
149	3300048927	Ga0496124_0005915	Ga0496124_0005915_3448_4671	400
150	3300053153	Ga0500616_0006556	Ga0500616_0006556_3154_4383	400
151	3300053156	Ga0500622_0000210	Ga0500622_0000210_9648_10871	400
152	3300002987	JGI25159J45721_1001008	JGI25159J45721_100100816	401
153	3300003187	JGI25151J46595_10003188	JGI25151J46595_100031883	401
154	3300003215	JGI25153J46596_10003206	JGI25153J46596_100032063	401
155	3300003354	JGI25160J50197_1002189	JGI25160J50197_100218911	401
156	3300003771	Ga0055526_1003912	Ga0055526_10039123	401
157	3300003773	Ga0055537_1001461	Ga0055537_10014613	401
158	3300003775	Ga0055524_1002596	Ga0055524_10025963	401
159	3300003790	Ga0055528_1002762	Ga0055528_10027623	401
160	3300046538	Ga0495609_0026716	Ga0495609_0026716_564_1787	401
161	3300047320	Ga0495672_0014047	Ga0495672_0014047_2080_3303	401
162	3300048929	Ga0496126_0014121	Ga0496126_0014121_6388_7635	401
163	3300048929	Ga0496126_0023441	Ga0496126_0023441_844_2094	401
164	3300053079	Ga0500610_0093992	Ga0500610_0093992_17_1240	401
165	3300053134	Ga0500658_0084119	Ga0500658_0084119_17_1240	401
166	3300053139	Ga0500568_0000509	Ga0500568_0000509_9567_10790	401
167	3300053153	Ga0500616_0003563	Ga0500616_0003563_2970_4193	401
168	3300053158	Ga0500627_0005312	Ga0500627_0005312_2577_3800	401
169	iso_pu_bacteria	2513237087	2513593313	401
170	iso_pu_bacteria	2585427634	2586001069	401
171	iso_pu_bacteria	2643221629	2644165234	401
172	3300006195	Ga0075366_10016151	Ga0075366_100161518	402
173	3300046530	Ga0495654_0040337	Ga0495654_0040337_980_2311	402
174	3300046665	Ga0495661_0022219	Ga0495661_0022219_133_1464	402
175	3300048924	Ga0496121_0086885	Ga0496121_0086885_814_2061	402
176	3300048927	Ga0496124_0000103	Ga0496124_0000103_8604_9851	402
177	3300053079	Ga0500610_0000748	Ga0500610_0000748_594_1925	402
178	3300053117	Ga0500593_002920	Ga0500593_002920_2682_4013	402
179	3300053158	Ga0500627_0005636	Ga0500627_0005636_2699_4030	402
180	3300053161	Ga0500634_0020975	Ga0500634_0020975_2180_3508	402
181	iso_pu_bacteria	2509276021	2509391946	402
182	iso_pu_bacteria	2509276033	2509447202	402
183	iso_pu_bacteria	2510065019	2510134039	402
184	iso_pu_bacteria	2510461076	2510895459	402
185	iso_pu_bacteria	2510917030	2511199114	402
186	iso_pu_bacteria	2513237093	2513633297	402
187	iso_pu_bacteria	2513237103	2513707697	402
188	iso_pu_bacteria	2513237162	2514018227	402
189	iso_pu_bacteria	2515154113	2515639096	402
190	iso_pu_bacteria	2515154114	2515645742	402
191	iso_pu_bacteria	2515154116	2515655269	402
192	iso_pu_bacteria	2515154134	2515739567	402
193	iso_pu_bacteria	2516653077	2517036804	402
194	iso_pu_bacteria	2517287029	2517407487	402
195	iso_pu_bacteria	2529292951	2530645870	402
196	iso_pu_bacteria	2582581294	2585205727	402
197	iso_pu_bacteria	2582581298	2585222943	402
198	iso_pu_bacteria	2582581299	2585232527	402
199	iso_pu_bacteria	2582581867	2585404435	402
200	iso_pu_bacteria	2585427526	2585524585	402
201	iso_pu_bacteria	2585427528	2585538283	402
202	iso_pu_bacteria	2585427529	2585545526	402
203	iso_pu_bacteria	2585427590	2585824757	402
204	iso_pu_bacteria	2585427593	2585836236	402
205	iso_pu_bacteria	2585427594	2585845709	402
206	iso_pu_bacteria	2643221634	2644193295	402
207	iso_pu_bacteria	2718217927	2719386495	402
208	iso_pu_bacteria	2718218423	2721400199	402
209	iso_pu_bacteria	2721755809	2724039012	402
210	iso_pu_bacteria	2724679232	2725952454	402
211	iso_pu_bacteria	2738541293	2738799439	402
212	iso_pu_bacteria	2738541333	2739032923	402
213	iso_pu_bacteria	2765235942	2766065958	402
214	iso_pu_bacteria	2791355259	2793316004	402
215	iso_pu_bacteria	2791355261	2793330863	402
216	iso_pu_bacteria	2791355266	2793362053	402
217	iso_pu_bacteria	2791355267	2793368777	402
218	iso_pu_bacteria	2802429634	2806050144	402
219	iso_pu_bacteria	2802429635	2806056982	402
220	iso_pu_bacteria	2802429636	2806064363	402
221	iso_pu_bacteria	2802429637	2806071630	402
222	iso_pu_bacteria	2838042994	2838045049	402
223	iso_pu_bacteria	2838680041	2838683373	402
224	iso_pu_bacteria	2838686498	2838686966	402
225	iso_pu_bacteria	2838694306	2838697683	402
226	iso_pu_bacteria	2838707686	2838710799	402
227	iso_pu_bacteria	2838729681	2838730077	402
228	iso_pu_bacteria	2838742623	2838742908	402
229	iso_pu_bacteria	2841851746	2841852410	402
230	iso_pu_bacteria	2841864319	2841867039	402
231	iso_pu_bacteria	2842077413	2842078972	402
232	iso_pu_bacteria	2842110456	2842113180	402
233	iso_pu_bacteria	2842118031	2842118518	402
234	iso_pu_bacteria	2842156927	2842158132	402
235	iso_pu_bacteria	2842163707	2842168709	402
236	iso_pu_bacteria	2842180545	2842181751	402
237	iso_pu_bacteria	2842217011	2842218025	402
238	iso_pu_bacteria	2842229732	2842230199	402
239	iso_pu_bacteria	2842237096	2842240429	402
240	iso_pu_bacteria	2842243621	2842244086	402
241	iso_pu_bacteria	2842257432	2842257828	402
242	iso_pu_bacteria	2842271015	2842271496	402
243	iso_pu_bacteria	2842291075	2842292634	402
244	iso_pu_bacteria	2842304105	2842305128	402
245	iso_pu_bacteria	2842341865	2842347437	402
246	iso_pu_bacteria	2842363717	2842368872	402
247	iso_pu_bacteria	2842370503	2842374004	402
248	iso_pu_bacteria	2842377471	2842379032	402
249	iso_pu_bacteria	2842384541	2842385028	402
250	iso_pu_bacteria	2842395702	2842400263	402
251	iso_pu_bacteria	2844454524	2844458262	402
252	iso_pu_bacteria	2857516855	2857517343	402
253	iso_pu_bacteria	2881412998	2881415260	402
254	iso_pu_bacteria	2919100787	2919106377	402
255	iso_pu_bacteria	2933586486	2933588763	402
256	iso_pu_bacteria	2935894831	2935896931	402
257	iso_pu_bacteria	2935901341	2935901873	402
258	iso_pu_bacteria	2936367885	2936371953	402
259	iso_pu_bacteria	2936375103	2936379788	402
260	iso_pu_bacteria	2936381700	2936388307	402
261	iso_pu_bacteria	3005445848	3005448535	402
262	iso_pu_bacteria	639633055	639649264	402
263	iso_pu_bacteria	8005275841	8005281296	402
264	iso_pu_bacteria	8005307578	8005312916	402
265	iso_pu_bacteria	8005376324	8005381011	402
266	iso_pu_bacteria	8005382845	8005389036	402
267	iso_pu_bacteria	8005556819	8005556934	402
268	iso_pu_bacteria	8005570704	8005573376	402
269	iso_pu_bacteria	8005695170	8005697492	402
270	iso_pu_bacteria	8018163183	8018164488	402
271	iso_pu_bacteria	8018176218	8018176967	402
272	iso_pu_bacteria	8024479707	8024482781	402
273	iso_pu_bacteria	8024486573	8024488120	402
274	iso_pu_bacteria	8056375014	8056376017	402
275	iso_pu_bacteria	8057874678	8057877594	402
276	3300005844	Ga0068862_100053481	Ga0068862_1000534813	403
277	3300028380	Ga0268265_10009258	Ga0268265_100092588	403
278	3300049571	Ga0501034_0094210	Ga0501034_0094210_735_1949	403
279	3300053079	Ga0500610_0059484	Ga0500610_0059484_312_1556	403
280	3300049572	Ga0501036_0230401	Ga0501036_0230401_55_1275	405
281	3300049822	Ga0501035_0268149	Ga0501035_0268149_180_1400	405
282	iso_pu_bacteria	2510917026	2511174111	405
283	iso_pu_bacteria	2582581308	2585279157	405
284	iso_pu_bacteria	2582581316	2585331343	405
285	iso_pu_bacteria	2585427527	2585531358	405
286	iso_pu_bacteria	2585427608	2585898351	405
287	iso_pu_bacteria	2585427609	2585904084	405
288	iso_pu_bacteria	2585428125	2587980799	405
289	iso_pu_bacteria	2615840698	2616554342	405
290	iso_pu_bacteria	2667528174	2671111340	405
291	iso_pu_bacteria	2818991448	2819609228	405
292	iso_pu_bacteria	2838029111	2838033642	405
293	iso_pu_bacteria	2842298080	2842303966	405
294	iso_pu_bacteria	2842357229	2842363576	405
295	iso_pu_bacteria	2842475841	2842480389	405
296	iso_pu_bacteria	2842502639	2842505390	405
297	iso_pu_bacteria	2842509118	2842511013	405
298	iso_pu_bacteria	2842733646	2842735707	405
299	iso_pu_bacteria	2842747753	2842749105	405
300	iso_pu_bacteria	2852387548	2852390339	405
301	iso_pu_bacteria	2919408235	2919410092	405
302	iso_pu_bacteria	2945909444	2945910732	405
303	iso_pu_bacteria	3005416602	3005417459	405
304	iso_pu_bacteria	8005314921	8005315752	405
305	iso_pu_bacteria	8005484373	8005489103	405
306	iso_pu_bacteria	8005645114	8005650086	405
307	iso_pu_bacteria	8005682033	8005682798	405
308	iso_pu_bacteria	8046767195	8046771853	405
309	iso_pu_bacteria	8057575449	8057575616	405
310	3300002773	JGI25152J39213_1000462	JGI25152J39213_100046225	406
311	3300002773	JGI25152J39213_1002911	JGI25152J39213_10029115	406
312	3300002773	JGI25152J39213_1010426	JGI25152J39213_10104262	406
313	3300002774	JGI25150J39212_1000047	JGI25150J39212_100004724	406
314	3300002774	JGI25150J39212_1000084	JGI25150J39212_100008458	406
315	3300002774	JGI25150J39212_1000085	JGI25150J39212_10000853	406
316	3300003187	JGI25151J46595_10000126	JGI25151J46595_1000012656	406
317	3300003187	JGI25151J46595_10000190	JGI25151J46595_1000019028	406
318	3300003187	JGI25151J46595_10002195	JGI25151J46595_100021954	406
319	3300003215	JGI25153J46596_10001341	JGI25153J46596_100013413	406
320	3300003215	JGI25153J46596_10003219	JGI25153J46596_100032192	406
321	3300003354	JGI25160J50197_1001364	JGI25160J50197_10013648	406
322	3300003771	Ga0055526_1002019	Ga0055526_100201911	406
323	3300003771	Ga0055526_1003623	Ga0055526_100362311	406
324	3300003775	Ga0055524_1005388	Ga0055524_10053887	406
325	3300003790	Ga0055528_1000193	Ga0055528_100019360	406
326	3300003790	Ga0055528_1007962	Ga0055528_10079623	406
327	3300003792	Ga0055540_1000293	Ga0055540_100029340	406
328	3300003792	Ga0055540_1002969	Ga0055540_10029696	406
329	3300003792	Ga0055540_1013080	Ga0055540_10130803	406
330	3300005327	Ga0070658_10038326	Ga0070658_100383263	406
331	3300005327	Ga0070658_10039494	Ga0070658_100394943	406
332	3300005339	Ga0070660_100033806	Ga0070660_1000338063	406
333	3300005339	Ga0070660_100173045	Ga0070660_1001730451	406
334	3300005344	Ga0070661_100092590	Ga0070661_1000925902	406
335	3300005563	Ga0068855_100257852	Ga0068855_1002578522	406
336	3300005564	Ga0070664_100125069	Ga0070664_1001250692	406
337	3300005577	Ga0068857_100008613	Ga0068857_1000086135	406
338	3300005578	Ga0068854_100046271	Ga0068854_1000462713	406
339	3300005614	Ga0068856_100078254	Ga0068856_1000782541	406
340	3300005616	Ga0068852_100002986	Ga0068852_1000029864	406
341	3300005616	Ga0068852_100114985	Ga0068852_1001149852	406
342	3300006038	Ga0075365_10016689	Ga0075365_100166892	406
343	3300006178	Ga0075367_10018190	Ga0075367_100181902	406
344	3300009174	Ga0105241_10049730	Ga0105241_100497303	406
345	3300009765	Ga0123341_1007449	Ga0123341_100744911	406
346	3300009766	Ga0123342_1022778	Ga0123342_10227787	406
347	3300010375	Ga0105239_10097287	Ga0105239_100972872	406
348	3300010375	Ga0105239_10212986	Ga0105239_102129862	406
349	3300013104	Ga0157370_10053112	Ga0157370_100531123	406
350	3300013308	Ga0157375_10233559	Ga0157375_102335592	406
351	3300025245	Ga0207425_1000010	Ga0207425_1000010248	406
352	3300025245	Ga0207425_1003761	Ga0207425_10037612	406
353	3300025258	Ga0209129_1000034	Ga0209129_100003493	406
354	3300025258	Ga0209129_1001467	Ga0209129_10014677	406
355	3300025273	Ga0209673_1000025	Ga0209673_1000025349	406
356	3300025273	Ga0209673_1001435	Ga0209673_100143516	406
357	3300025294	Ga0209025_1000022	Ga0209025_1000022334	406
358	3300025294	Ga0209025_1000026	Ga0209025_100002683	406
359	3300025294	Ga0209025_1002036	Ga0209025_100203618	406
360	3300025295	Ga0209564_1000618	Ga0209564_100061860	406
361	3300025295	Ga0209564_1006170	Ga0209564_10061707	406
362	3300025297	Ga0209758_1000080	Ga0209758_1000080186	406
363	3300025297	Ga0209758_1001930	Ga0209758_100193019	406
364	3300025297	Ga0209758_1002703	Ga0209758_100270315	406
365	3300025299	Ga0209256_1000561	Ga0209256_100056160	406
366	3300025299	Ga0209256_1002755	Ga0209256_10027554	406
367	3300025302	Ga0207426_1000218	Ga0207426_1000218124	406
368	3300025303	Ga0209051_1000097	Ga0209051_1000097150	406
369	3300025303	Ga0209051_1000245	Ga0209051_100024562	406
370	3300025304	Ga0209257_1007470	Ga0209257_10074704	406
371	3300025909	Ga0207705_10068794	Ga0207705_100687942	406
372	3300025919	Ga0207657_10044996	Ga0207657_100449963	406
373	3300025919	Ga0207657_10053820	Ga0207657_100538204	406
374	3300025920	Ga0207649_10020952	Ga0207649_100209522	406
375	3300025945	Ga0207679_10186270	Ga0207679_101862702	406
376	3300025949	Ga0207667_10002485	Ga0207667_1000248523	406
377	3300025981	Ga0207640_10068670	Ga0207640_100686701	406
378	3300026041	Ga0207639_10102776	Ga0207639_101027762	406
379	3300026078	Ga0207702_10058095	Ga0207702_100580952	406
380	3300026078	Ga0207702_10214095	Ga0207702_102140952	406
381	3300026116	Ga0207674_10036468	Ga0207674_100364684	406
382	3300026142	Ga0207698_10092789	Ga0207698_100927893	406
383	3300028794	Ga0307515_10023717	Ga0307515_1002371714	406
384	3300031595	Ga0265313_10055472	Ga0265313_100554721	406
385	3300031711	Ga0265314_10103306	Ga0265314_101033062	406
386	3300031911	Ga0307412_10023912	Ga0307412_100239125	406
387	3300041491	Ga0451833_1329452	Ga0451833_1329452_14_1234	406
388	3300041494	Ga0451837_1567322	Ga0451837_1567322_222_1442	406
389	3300041496	Ga0451839_0012095	Ga0451839_0012095_2816_4036	406
390	3300041501	Ga0451845_0746327	Ga0451845_0746327_499_1719	406
391	3300046492	Ga0495585_0034473	Ga0495585_0034473_470_1690	406
392	3300046507	Ga0495606_0033436	Ga0495606_0033436_650_1963	406
393	3300046513	Ga0495616_0055331	Ga0495616_0055331_23_1243	406
394	3300046513	Ga0495616_0056083	Ga0495616_0056083_413_1651	406
395	3300046515	Ga0495620_0009674	Ga0495620_0009674_68_1288	406
396	3300046519	Ga0495632_0041379	Ga0495632_0041379_648_1961	406
397	3300046519	Ga0495632_0097918	Ga0495632_0097918_34_1272	406
398	3300046522	Ga0495643_0007759	Ga0495643_0007759_2587_3900	406
399	3300046522	Ga0495643_0065430	Ga0495643_0065430_371_1609	406
400	3300046524	Ga0495648_0028001	Ga0495648_0028001_455_1675	406
401	3300046536	Ga0495587_0076772	Ga0495587_0076772_421_1683	406
402	3300046558	Ga0495633_0017445	Ga0495633_0017445_2303_3523	406
403	3300046616	Ga0495668_0038967	Ga0495668_0038967_544_1857	406
404	3300046648	Ga0495611_0058197	Ga0495611_0058197_102_1322	406
405	3300046660	Ga0495625_0057463	Ga0495625_0057463_1424_2644	406
406	3300046660	Ga0495625_0109714	Ga0495625_0109714_340_1578	406
407	3300046675	Ga0495657_0073137	Ga0495657_0073137_931_2154	406
408	3300046691	Ga0495670_0057835	Ga0495670_0057835_580_1800	406
409	3300046692	Ga0495671_0029811	Ga0495671_0029811_93_1406	406
410	3300046694	Ga0495649_0067372	Ga0495649_0067372_388_1626	406
411	3300047323	Ga0495683_0073442	Ga0495683_0073442_272_1510	406
412	3300047443	Ga0495687_043788	Ga0495687_043788_312_1550	406
413	3300047472	Ga0495686_0007219	Ga0495686_0007219_7124_8344	406
414	3300048091	Ga0495626_0073036	Ga0495626_0073036_260_1498	406
415	3300048905	Ga0496102_0028351	Ga0496102_0028351_307_1530	406
416	3300048907	Ga0496104_0007056	Ga0496104_0007056_1331_2554	406
417	3300048908	Ga0496105_0009886	Ga0496105_0009886_674_1897	406
418	3300048909	Ga0496106_0000601	Ga0496106_0000601_1901_3124	406
419	3300048913	Ga0496110_0009016	Ga0496110_0009016_5910_7133	406
420	3300048914	Ga0496111_0032193	Ga0496111_0032193_1041_2264	406
421	3300048916	Ga0496113_0302194	Ga0496113_0302194_37_1260	406
422	3300048919	Ga0496116_0004742	Ga0496116_0004742_2663_3886	406
423	3300048919	Ga0496116_0018333	Ga0496116_0018333_673_1896	406
424	3300048919	Ga0496116_0044807	Ga0496116_0044807_1319_2542	406
425	3300048920	Ga0496117_0005284	Ga0496117_0005284_822_2045	406
426	3300048921	Ga0496118_0003734	Ga0496118_0003734_5635_6876	406
427	3300048921	Ga0496118_0011741	Ga0496118_0011741_7197_8420	406
428	3300048921	Ga0496118_0137912	Ga0496118_0137912_57_1298	406
429	3300048924	Ga0496121_0072256	Ga0496121_0072256_559_1782	406
430	3300048924	Ga0496121_0120142	Ga0496121_0120142_650_1873	406
431	3300048924	Ga0496121_0140634	Ga0496121_0140634_142_1365	406
432	3300048924	Ga0496121_0208622	Ga0496121_0208622_35_1258	406
433	3300048925	Ga0496122_0023514	Ga0496122_0023514_1524_2747	406
434	3300048925	Ga0496122_0060433	Ga0496122_0060433_921_2144	406
435	3300048925	Ga0496122_0103274	Ga0496122_0103274_457_1680	406
436	3300048926	Ga0496123_0001831	Ga0496123_0001831_24580_25803	406
437	3300048926	Ga0496123_0029276	Ga0496123_0029276_2363_3586	406
438	3300048926	Ga0496123_0044405	Ga0496123_0044405_1572_2795	406
439	3300048927	Ga0496124_0002086	Ga0496124_0002086_4407_5630	406
440	3300048928	Ga0496125_0013656	Ga0496125_0013656_737_1960	406
441	3300048929	Ga0496126_0120138	Ga0496126_0120138_817_2040	406
442	3300049569	Ga0501032_0029098	Ga0501032_0029098_2412_3635	406
443	3300049569	Ga0501032_0050406	Ga0501032_0050406_1148_2386	406
444	3300049570	Ga0501033_0022120	Ga0501033_0022120_2492_3730	406
445	3300049571	Ga0501034_0088750	Ga0501034_0088750_1693_2916	406
446	3300049571	Ga0501034_0333873	Ga0501034_0333873_207_1433	406
447	3300049572	Ga0501036_0028311	Ga0501036_0028311_3284_4507	406
448	3300049572	Ga0501036_0052321	Ga0501036_0052321_1667_2905	406
449	3300049573	Ga0501037_0036402	Ga0501037_0036402_219_1457	406
450	3300049574	Ga0501038_0025719	Ga0501038_0025719_2273_3511	406
451	3300049574	Ga0501038_0125881	Ga0501038_0125881_22_1245	406
452	3300049575	Ga0501039_0011916	Ga0501039_0011916_3832_5070	406
453	3300049575	Ga0501039_0192647	Ga0501039_0192647_326_1549	406
454	3300049579	Ga0501043_0038729	Ga0501043_0038729_1548_2771	406
455	3300049579	Ga0501043_0137821	Ga0501043_0137821_145_1383	406
456	3300049580	Ga0501046_0057349	Ga0501046_0057349_1204_2427	406
457	3300049584	Ga0501068_0078033	Ga0501068_0078033_144_1367	406
458	3300049586	Ga0501070_0016437	Ga0501070_0016437_4169_5392	406
459	3300049586	Ga0501070_0078893	Ga0501070_0078893_1259_2497	406
460	3300049589	Ga0501073_0100322	Ga0501073_0100322_359_1582	406
461	3300049742	Ga0501080_0055270	Ga0501080_0055270_158_1396	406
462	3300049744	Ga0501083_0015489	Ga0501083_0015489_1681_2904	406
463	3300049822	Ga0501035_0024966	Ga0501035_0024966_1777_3015	406
464	3300049822	Ga0501035_0080027	Ga0501035_0080027_1302_2525	406
465	3300049823	Ga0501044_0012345	Ga0501044_0012345_131_1354	406
466	3300053086	Ga0500578_0006427	Ga0500578_0006427_3564_4877	406
467	3300053125	Ga0500618_000356	Ga0500618_000356_2745_3971	406
468	3300053134	Ga0500658_0005523	Ga0500658_0005523_1308_2528	406
469	3300053136	Ga0500559_0008594	Ga0500559_0008594_3175_4404	406
470	3300053139	Ga0500568_0001937	Ga0500568_0001937_9631_10854	406
471	3300053151	Ga0500604_0003671	Ga0500604_0003671_1322_2545	406
472	3300053153	Ga0500616_0005619	Ga0500616_0005619_5088_6401	406
473	3300053160	Ga0500633_0000143	Ga0500633_0000143_6303_7526	406
474	3300053177	Ga0500636_0069729	Ga0500636_0069729_193_1416	406
475	iso_pu_bacteria	2513237085	2513577031	406
476	iso_pu_bacteria	2517093000	2517095915	406
477	iso_pu_bacteria	2643221599	2644005349	406
478	iso_pu_bacteria	2802429633	2806045061	406
479	iso_pu_bacteria	2928115317	2928117825	406
480	iso_pu_bacteria	2933570622	2933570935	406
481	iso_pu_bacteria	8005395548	8005396019	406
482	iso_pu_bacteria	8023680758	8023683084	406
483	3300005548	Ga0070665_100074211	Ga0070665_1000742112	407
484	3300009545	Ga0105237_10001389	Ga0105237_1000138915	407
485	3300010375	Ga0105239_10001103	Ga0105239_1000110321	407
486	3300025914	Ga0207671_10000168	Ga0207671_1000016812	407
487	3300028379	Ga0268266_10000974	Ga0268266_1000097429	407
488	3300028563	Ga0265319_1003170	Ga0265319_10031704	407
489	3300031240	Ga0265320_10020660	Ga0265320_100206601	407
490	3300046507	Ga0495606_0006398	Ga0495606_0006398_3478_4704	407
491	3300047472	Ga0495686_0002146	Ga0495686_0002146_6564_7790	407
492	3300048924	Ga0496121_0006687	Ga0496121_0006687_10991_12217	407
493	3300013104	Ga0157370_10006535	Ga0157370_100065355	408
494	3300017792	Ga0163161_10000171	Ga0163161_100001715	408
495	3300032002	Ga0307416_100101946	Ga0307416_1001019463	408
496	3300050496	nmdc:mga07m45_292_c1	nmdc:mga07m45_292_c1_7234_8547	408
497	iso_pu_bacteria	2738541307	2738884732	408
498	3300001979	JGI24740J21852_10000010	JGI24740J21852_1000001060	409
499	3300002704	JGI25155J39150_1000044	JGI25155J39150_100004450	409
500	3300002705	JGI25156J39149_1000058	JGI25156J39149_100005842	409
501	3300002737	JGI25162J39368_1000143	JGI25162J39368_100014332	409
502	3300002738	JGI25154J39366_1000174	JGI25154J39366_100017450	409
503	3300002741	JGI25157J39369_1000078	JGI25157J39369_100007842	409
504	3300002987	JGI25159J45721_1000756	JGI25159J45721_10007566	409
505	3300003214	JGI25165J46597_1000356	JGI25165J46597_100035610	409
506	3300003214	JGI25165J46597_1000500	JGI25165J46597_100050021	409
507	3300003316	rootH1_10069601	rootH1_100696016	409
508	3300003320	rootH2_10059318	rootH2_100593185	409
509	3300003322	rootL2_10006456	rootL2_100064568	409
510	3300003354	JGI25160J50197_1000001	JGI25160J50197_1000001537	409
511	3300003374	JGI25161J50226_1000001	JGI25161J50226_1000001219	409
512	3300004625	Ga0055543_1000003	Ga0055543_1000003235	409
513	3300005262	Ga0065165_1000469	Ga0065165_100046967	409
514	3300005834	Ga0068851_10075727	Ga0068851_100757272	409
515	3300009093	Ga0105240_10000014	Ga0105240_10000014426	409
516	3300009545	Ga0105237_10012821	Ga0105237_100128219	409
517	3300010375	Ga0105239_10004698	Ga0105239_1000469816	409
518	3300013104	Ga0157370_10001013	Ga0157370_100010135	409
519	3300015262	Ga0182007_10004389	Ga0182007_1000438910	409
520	3300015265	Ga0182005_1002036	Ga0182005_10020368	409
521	3300025206	Ga0209435_100054	Ga0209435_10005452	409
522	3300025246	Ga0209646_1000170	Ga0209646_100017052	409
523	3300025246	Ga0209646_1003191	Ga0209646_10031911	409
524	3300025250	Ga0209026_1000193	Ga0209026_100019352	409
525	3300025253	Ga0209677_106413	Ga0209677_1064133	409
526	3300025256	Ga0209759_1000222	Ga0209759_100022252	409
527	3300025261	Ga0209233_1000148	Ga0209233_100014846	409
528	3300025284	Ga0209130_1000003	Ga0209130_1000003238	409
529	3300025302	Ga0207426_1000011	Ga0207426_1000011538	409
530	3300025913	Ga0207695_10000037	Ga0207695_10000037428	409
531	3300025914	Ga0207671_10003788	Ga0207671_1000378813	409
532	3300025949	Ga0207667_10165326	Ga0207667_101653262	409
533	3300025981	Ga0207640_10028391	Ga0207640_100283912	409
534	3300044765	Ga0466970_0000072	Ga0466970_0000072_35772_37001	409
535	3300045049	Ga0466959_0059387	Ga0466959_0059387_342_1571	409
536	3300048903	Ga0496100_0003636	Ga0496100_0003636_5554_6783	409
537	3300048905	Ga0496102_0003723	Ga0496102_0003723_6531_7760	409
538	3300048916	Ga0496113_0008924	Ga0496113_0008924_1143_2372	409
539	3300048919	Ga0496116_0008405	Ga0496116_0008405_4957_6186	409
540	3300048920	Ga0496117_0001336	Ga0496117_0001336_30213_31442	409
541	3300048921	Ga0496118_0004095	Ga0496118_0004095_4814_6043	409
542	3300048922	Ga0496119_0005806	Ga0496119_0005806_6206_7435	409
543	3300048923	Ga0496120_0002450	Ga0496120_0002450_4809_6038	409
544	3300048924	Ga0496121_0001813	Ga0496121_0001813_4917_6146	409
545	3300048924	Ga0496121_0005187	Ga0496121_0005187_4624_5853	409
546	3300048925	Ga0496122_0006435	Ga0496122_0006435_10773_12002	409
547	3300048926	Ga0496123_0005654	Ga0496123_0005654_4402_5631	409
548	3300048927	Ga0496124_0005932	Ga0496124_0005932_7475_8704	409
549	3300048928	Ga0496125_0010744	Ga0496125_0010744_5172_6401	409
550	3300048928	Ga0496125_0125673	Ga0496125_0125673_400_1629	409
551	3300048929	Ga0496126_0030206	Ga0496126_0030206_1053_2282	409
552	3300053125	Ga0500618_000866	Ga0500618_000866_9319_10548	409
553	iso_pu_bacteria	2524023209	2524463258	409
554	iso_pu_bacteria	2582581307	2585271224	409
555	iso_pu_bacteria	2582581315	2585323238	409
556	iso_pu_bacteria	2585427530	2585552719	409
557	iso_pu_bacteria	2585427531	2585558969	409
558	iso_pu_bacteria	2615840626	2616312809	409
559	iso_pu_bacteria	2818991453	2819641463	409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05977

MFS_3

Transmembrane secretion effector

72

433

0.86 PF07690

MFS_1

Major Facilitator Superfamily

82

423

0.79 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6kkk-assembly3.cif.gz_C	crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant)	0.8597	14	399
6kkk-assembly3.cif.gz_C	crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant)	0.841	14	399
6kkl-assembly1.cif.gz_A	crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant)	0.8359	16	400
8jtc-assembly1.cif.gz_A	human vmat2 complex with reserpine	0.8275	16	397
6kkl-assembly1.cif.gz_A	crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant)	0.8238	16	400

ID	Description	Score	Start	End	Superfamily
af_P24077_14_401_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9572	15	400	1.20.1250.20
af_P24077_14_401_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9477	15	400	1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9243	11	210	1.20.1250.20
af_P9WJX9_6_194_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9201	16	197	1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9155	11	210	1.20.1250.20

ID	Description	Score	Start	End	GO Terms
AF-E3HP86-F1-model_v4	Major facilitator superfamily protein 3	0.9908	7	409	GO:0005886 GO:0022857
AF-A0A2V7CHS9-F1-model_v4	MFS transporter	0.99	13	409	GO:0005886
AF-A0A244DEA1-F1-model_v4	deleted	0.99	11	409
AF-A0A1P8FQ99-F1-model_v4	Multidrug efflux pump Tap	0.9893	17	409	GO:0005886 GO:0022857
AF-A0A2V6PQG9-F1-model_v4	MFS transporter	0.9886	34	405	GO:0005886 GO:0022857

Feature Viewer

pLDDT	pTM	Quality
83.55	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F463526

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF05977

MFS_3

Transmembrane secretion effector

72

433

0.86

PF07690

MFS_1

Major Facilitator Superfamily

82

423

0.79

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map