F463488

General Info

Members Datasets Scaffolds Average Seq Length
558 255 1116 179

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0478505|Ga0495623_0478505_100_606
Length 168
Sequence MTRGRLTIKRAEPAHAQVLHSLITANLEEGHLLPRTLDELRVHAGRFTVVMRGKKVVGCAELSAQVAEVRSLAVDAKERDKGIGSMLVDELRRRAHEDGYDKLSAFTHAPGYFSQMGFSIVPHLWVPEKVFSDCVKCPMFRRCGQYAMVAPLDTADQPQPAVLVARHA

Samples

Sample ID Description Type Environment
1 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 3.41
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495623_0478505 3300046679 Unclassified 660
2 Ga0065712_10101224 3300005290 Bacteria 2041
3 Ga0070658_10165130 3300005327 Bacteria 1859
4 Ga0070683_100050714 3300005329 Bacteria 3843
5 Ga0070683_100167698 3300005329 Bacteria 2084
6 Ga0070690_100052440 3300005330 Bacteria 2607
7 Ga0070690_100689106 3300005330 Unclassified 784
8 Ga0070690_100711662 3300005330 Bacteria 772
9 Ga0070690_101016919 3300005330 Bacteria 654
10 Ga0070670_100205776 3300005331 Bacteria 1710
11 Ga0068869_100209054 3300005334 Bacteria 1542
12 Ga0070666_10012780 3300005335 Bacteria 5307
13 Ga0070680_100263066 3300005336 Bacteria 1460
14 Ga0068868_100039007 3300005338 Bacteria 3688
15 Ga0068868_100254712 3300005338 Bacteria 1478
16 Ga0068868_100970931 3300005338 Bacteria 776
17 Ga0070660_100016166 3300005339 Bacteria 5410
18 Ga0070689_100129866 3300005340 Bacteria 2020
19 Ga0070689_101179861 3300005340 Bacteria 687
20 Ga0070691_10001122 3300005341 Bacteria 11122
21 Ga0070687_100061326 3300005343 Bacteria 1988
22 Ga0070668_100464381 3300005347 Bacteria 1090
23 Ga0070669_100032682 3300005353 Bacteria 3759
24 Ga0070669_100941457 3300005353 Unclassified 739
25 Ga0070675_100002755 3300005354 Bacteria 13207
26 Ga0070675_100015148 3300005354 Bacteria 6089
27 Ga0070675_100022447 3300005354 Bacteria 5044
28 Ga0070675_100881441 3300005354 Bacteria 820
29 Ga0070675_100895445 3300005354 Bacteria 813
30 Ga0070671_100028744 3300005355 Bacteria 4581
31 Ga0070671_100689606 3300005355 Bacteria 886
32 Ga0070671_100820108 3300005355 Bacteria 811
33 Ga0070674_100636088 3300005356 Unclassified 905
34 Ga0070673_100007116 3300005364 Bacteria 7349
35 Ga0070673_100218161 3300005364 Bacteria 1650
36 Ga0070673_100572558 3300005364 Unclassified 1028
37 Ga0070673_100724037 3300005364 Bacteria 915
38 Ga0070688_100008618 3300005365 Bacteria 5549
39 Ga0070659_100418430 3300005366 Unclassified 1133
40 Ga0070659_100917676 3300005366 Bacteria 766
41 Ga0070709_10355237 3300005434 Bacteria 1084
42 Ga0070714_100005752 3300005435 Bacteria 9507
43 Ga0070713_100101685 3300005436 Bacteria 2490
44 Ga0070713_100250049 3300005436 Bacteria 1617
45 Ga0070701_10013591 3300005438 Bacteria 3708
46 Ga0070711_100273927 3300005439 Bacteria 1333
47 Ga0070705_100007345 3300005440 Bacteria 5423
48 Ga0070705_101002029 3300005440 Bacteria 678
49 Ga0070700_100052736 3300005441 Bacteria 2537
50 Ga0070694_100007290 3300005444 Bacteria 6738
51 Ga0070694_100079735 3300005444 Bacteria 2273
52 Ga0070708_100230259 3300005445 Bacteria 1739
53 Ga0070708_100244048 3300005445 Bacteria 1687
54 Ga0070708_100589475 3300005445 Bacteria 1048
55 Ga0070708_100592022 3300005445 Bacteria 1046
56 Ga0070708_101467876 3300005445 Bacteria 636
57 Ga0070678_100024937 3300005456 Bacteria 4013
58 Ga0070678_100172909 3300005456 Bacteria 1761
59 Ga0070678_100369748 3300005456 Bacteria 1238
60 Ga0070662_100520468 3300005457 Bacteria 994
61 Ga0070662_101547215 3300005457 Unclassified 572
62 Ga0070681_10150241 3300005458 Bacteria 2256
63 Ga0070681_11023501 3300005458 Bacteria 746
64 Ga0070685_10174077 3300005466 Bacteria 1381
65 Ga0070706_100489779 3300005467 Bacteria 1144
66 Ga0070706_100660743 3300005467 Unclassified 970
67 Ga0070706_100929727 3300005467 Bacteria 803
68 Ga0070707_100048000 3300005468 Bacteria 4089
69 Ga0070707_100096336 3300005468 Bacteria 2866
70 Ga0070707_100133795 3300005468 Bacteria 2412
71 Ga0070698_100046896 3300005471 Bacteria 4418
72 Ga0070698_100116969 3300005471 Bacteria 2628
73 Ga0070699_100031897 3300005518 Bacteria 4550
74 Ga0070699_100124982 3300005518 Bacteria 2264
75 Ga0070699_100283987 3300005518 Bacteria 1483
76 Ga0070679_100128930 3300005530 Bacteria 2511
77 Ga0070679_100190899 3300005530 Bacteria 2018
78 Ga0070679_100931825 3300005530 Bacteria 812
79 Ga0070684_100075474 3300005535 Bacteria 2974
80 Ga0070697_100027724 3300005536 Bacteria 4532
81 Ga0070697_100047239 3300005536 Bacteria 3491
82 Ga0068853_100221270 3300005539 Bacteria 1729
83 Ga0068853_100472655 3300005539 Bacteria 1181
84 Ga0068853_100727097 3300005539 Bacteria 948
85 Ga0068853_100751438 3300005539 Bacteria 932
86 Ga0070686_100000724 3300005544 Bacteria 19155
87 Ga0070686_100249428 3300005544 Bacteria 1296
88 Ga0070695_100004708 3300005545 Bacteria 8027
89 Ga0070695_100034496 3300005545 Bacteria 3173
90 Ga0070695_100090030 3300005545 Bacteria 2047
91 Ga0070696_100198416 3300005546 Bacteria 1497
92 Ga0070696_100215795 3300005546 Bacteria 1438
93 Ga0070693_100201372 3300005547 Bacteria 1293
94 Ga0070693_100275303 3300005547 Bacteria 1125
95 Ga0070665_100001384 3300005548 Bacteria 28575
96 Ga0070665_100004631 3300005548 Bacteria 14377
97 Ga0070704_100002214 3300005549 Bacteria 10835
98 Ga0070704_100038507 3300005549 Bacteria 3276
99 Ga0070704_100270140 3300005549 Bacteria 1405
100 Ga0068855_100004263 3300005563 Bacteria 17459
101 Ga0068855_100465448 3300005563 Bacteria 1378
102 Ga0068855_100741727 3300005563 Bacteria 1048
103 Ga0068855_100760371 3300005563 Bacteria 1033
104 Ga0070664_100230221 3300005564 Bacteria 1661
105 Ga0070664_100846585 3300005564 Unclassified 856
106 Ga0070664_100909896 3300005564 Bacteria 825
107 Ga0070664_101405455 3300005564 Bacteria 660
108 Ga0068854_100008134 3300005578 Bacteria 6729
109 Ga0068854_100138550 3300005578 Bacteria 1864
110 Ga0068854_100491369 3300005578 Bacteria 1032
111 Ga0068856_100908770 3300005614 Bacteria 899
112 Ga0070702_100000381 3300005615 Bacteria 15665
113 Ga0070702_100316906 3300005615 Bacteria 1085
114 Ga0070702_100583725 3300005615 Bacteria 835
115 Ga0068852_100149951 3300005616 Bacteria 2167
116 Ga0068852_101230347 3300005616 Bacteria 770
117 Ga0068859_100078059 3300005617 Bacteria 3352
118 Ga0068859_100185569 3300005617 Bacteria 2164
119 Ga0068859_100505108 3300005617 Bacteria 1304
120 Ga0068864_100004024 3300005618 Bacteria 12078
121 Ga0068864_100070984 3300005618 Bacteria 3032
122 Ga0068864_100081895 3300005618 Bacteria 2831
123 Ga0068864_100117293 3300005618 Bacteria 2376
124 Ga0068864_100229526 3300005618 Unclassified 1716
125 Ga0068864_100470204 3300005618 Bacteria 1205
126 Ga0068866_10065978 3300005718 Bacteria 1895
127 Ga0068866_10512143 3300005718 Bacteria 796
128 Ga0068866_10828474 3300005718 Bacteria 645
129 Ga0068861_100000721 3300005719 Bacteria 19783
130 Ga0068861_100410702 3300005719 Bacteria 1204
131 Ga0068861_100439409 3300005719 Bacteria 1166
132 Ga0068851_10201026 3300005834 Bacteria 1112
133 Ga0068863_100498429 3300005841 Bacteria 1199
134 Ga0068858_100004822 3300005842 Bacteria 13211
135 Ga0068858_100048591 3300005842 Bacteria 3930
136 Ga0068858_100168227 3300005842 Bacteria 2066
137 Ga0068858_101624659 3300005842 Bacteria 638
138 Ga0068862_100005863 3300005844 Bacteria 10233
139 Ga0068862_100017302 3300005844 Bacteria 6002
140 Ga0068862_100219277 3300005844 Bacteria 1721
141 Ga0068862_100295678 3300005844 Bacteria 1488
142 Ga0068862_100450569 3300005844 Unclassified 1213
143 Ga0068862_100516942 3300005844 Bacteria 1135
144 Ga0068862_101071409 3300005844 Bacteria 800
145 Ga0081455_10215353 3300005937 Bacteria 1428
146 Ga0081540_1048140 3300005983 Bacteria 2138
147 Ga0081539_10003680 3300005985 Bacteria 18367
148 Ga0081539_10168640 3300005985 Bacteria 1037
149 Ga0075432_10022219 3300006058 Bacteria 2169
150 Ga0070715_10060035 3300006163 Bacteria 1666
151 Ga0070715_10220808 3300006163 Bacteria 974
152 Ga0070716_100275755 3300006173 Bacteria 1158
153 Ga0097621_100000311 3300006237 Bacteria 32935
154 Ga0097621_100011145 3300006237 Bacteria 6615
155 Ga0097621_100085902 3300006237 Bacteria 2625
156 Ga0068871_100000337 3300006358 Bacteria 32470
157 Ga0068871_100002546 3300006358 Bacteria 12439
158 Ga0068871_100073214 3300006358 Bacteria 2824
159 Ga0068871_100298593 3300006358 Bacteria 1413
160 Ga0068871_100719127 3300006358 Bacteria 916
161 Ga0068871_101146032 3300006358 Bacteria 728
162 Ga0075428_100094858 3300006844 Bacteria 3252
163 Ga0075428_100286419 3300006844 Bacteria 1772
164 Ga0075431_100378126 3300006847 Bacteria 1421
165 Ga0075433_10102157 3300006852 Bacteria 2539
166 Ga0075433_10115551 3300006852 Bacteria 2381
167 Ga0075433_10219383 3300006852 Bacteria 1689
168 Ga0075433_10255872 3300006852 Unclassified 1553
169 Ga0075433_10259032 3300006852 Bacteria 1542
170 Ga0075433_10767417 3300006852 Bacteria 843
171 Ga0075433_10867929 3300006852 Bacteria 787
172 Ga0075434_100004421 3300006871 Bacteria 12672
173 Ga0075434_100006255 3300006871 Bacteria 10904
174 Ga0075434_100070095 3300006871 Bacteria 3496
175 Ga0075434_100493492 3300006871 Bacteria 1245
176 Ga0075434_100594290 3300006871 Bacteria 1126
177 Ga0075434_100653138 3300006871 Bacteria 1070
178 Ga0075434_101470492 3300006871 Unclassified 691
179 Ga0075434_101916447 3300006871 Bacteria 598
180 Ga0075429_100114277 3300006880 Bacteria 2360
181 Ga0075429_100707125 3300006880 Bacteria 883
182 Ga0068865_100000944 3300006881 Bacteria 16522
183 Ga0068865_100257880 3300006881 Bacteria 1379
184 Ga0075436_100002315 3300006914 Bacteria 13135
185 Ga0075436_100057952 3300006914 Bacteria 2675
186 Ga0075436_100344516 3300006914 Bacteria 1073
187 Ga0097620_100078057 3300006931 Bacteria 3352
188 Ga0097620_100185557 3300006931 Bacteria 2164
189 Ga0097620_100505116 3300006931 Bacteria 1304
190 Ga0075435_100000331 3300007076 Bacteria 29105
191 Ga0075435_100005015 3300007076 Bacteria 9190
192 Ga0075435_100010061 3300007076 Bacteria 6898
193 Ga0075435_100029276 3300007076 Bacteria 4321
194 Ga0075435_100031187 3300007076 Bacteria 4197
195 Ga0075435_100089653 3300007076 Bacteria 2536
196 Ga0075435_100336307 3300007076 Bacteria 1294
197 Ga0075435_100344800 3300007076 Bacteria 1276
198 Ga0105251_10077631 3300009011 Bacteria 1539
199 Ga0105240_10102793 3300009093 Bacteria 3472
200 Ga0105240_10234952 3300009093 Bacteria 2128
201 Ga0105240_10385515 3300009093 Bacteria 1582
202 Ga0105240_10520688 3300009093 Bacteria 1320
203 Ga0111539_10001186 3300009094 Bacteria 34634
204 Ga0111539_10186479 3300009094 Bacteria 2422
205 Ga0111539_10448287 3300009094 Bacteria 1503
206 Ga0111539_10847373 3300009094 Bacteria 1064
207 Ga0111539_10878246 3300009094 Bacteria 1043
208 Ga0105245_10171191 3300009098 Bacteria 2068
209 Ga0105245_10876177 3300009098 Bacteria 939
210 Ga0105247_10008271 3300009101 Bacteria 6348
211 Ga0114129_10002983 3300009147 Bacteria 23718
212 Ga0114129_10005106 3300009147 Bacteria 18477
213 Ga0114129_10022929 3300009147 Bacteria 8855
214 Ga0114129_10034998 3300009147 Bacteria 7094
215 Ga0114129_10108986 3300009147 Bacteria 3822
216 Ga0114129_10157597 3300009147 Bacteria 3104
217 Ga0114129_10781453 3300009147 Bacteria 1220
218 Ga0114129_10870101 3300009147 Bacteria 1144
219 Ga0114129_10988100 3300009147 Bacteria 1061
220 Ga0114129_11990317 3300009147 Bacteria 703
221 Ga0105243_10024715 3300009148 Bacteria 4584
222 Ga0105243_10781007 3300009148 Unclassified 939
223 Ga0105241_10059560 3300009174 Bacteria 2936
224 Ga0105242_10000999 3300009176 Bacteria 22176
225 Ga0105242_10005849 3300009176 Bacteria 9476
226 Ga0105242_10368842 3300009176 Bacteria 1331
227 Ga0105242_11470922 3300009176 Bacteria 711
228 Ga0105242_11672944 3300009176 Bacteria 672
229 Ga0105248_10015618 3300009177 Bacteria 8370
230 Ga0105248_10045519 3300009177 Bacteria 4920
231 Ga0105248_10213522 3300009177 Bacteria 2174
232 Ga0105248_10370024 3300009177 Bacteria 1613
233 Ga0105248_11033591 3300009177 Bacteria 928
234 Ga0105249_10332334 3300009553 Bacteria 1534
235 Ga0105249_11116710 3300009553 Bacteria 859
236 Ga0157369_10495239 3300013105 Bacteria 1264
237 Ga0157374_10043232 3300013296 Bacteria 4161
238 Ga0157378_10107163 3300013297 Bacteria 2557
239 Ga0157378_10484587 3300013297 Bacteria 1233
240 Ga0163162_10965549 3300013306 Bacteria 963
241 Ga0157372_10179826 3300013307 Bacteria 2448
242 Ga0157375_10214249 3300013308 Bacteria 2084
243 Ga0157375_10632424 3300013308 Bacteria 1227
244 Ga0163163_10011277 3300014325 Bacteria 8101
245 Ga0163163_10154669 3300014325 Bacteria 2337
246 Ga0163163_10333359 3300014325 Bacteria 1572
247 Ga0157380_10207113 3300014326 Bacteria 1745
248 Ga0157380_10315202 3300014326 Bacteria 1447
249 Ga0157380_10523026 3300014326 Bacteria 1157
250 Ga0157380_11339256 3300014326 Bacteria 764
251 Ga0157377_10265343 3300014745 Bacteria 1119
252 Ga0157377_10420468 3300014745 Bacteria 915
253 Ga0157377_10732265 3300014745 Unclassified 721
254 Ga0157379_10010647 3300014968 Bacteria 8015
255 Ga0157379_10096122 3300014968 Bacteria 2659
256 Ga0157379_11001425 3300014968 Bacteria 797
257 Ga0157379_11421715 3300014968 Unclassified 673
258 Ga0157376_10012896 3300014969 Bacteria 6218
259 Ga0157376_10690198 3300014969 Unclassified 1025
260 Ga0182007_10299340 3300015262 Bacteria 590
261 Ga0207656_10271683 3300025321 Bacteria 834
262 Ga0207682_10167686 3300025893 Bacteria 998
263 Ga0207682_10451429 3300025893 Bacteria 609
264 Ga0207642_10023545 3300025899 Bacteria 2461
265 Ga0207710_10171025 3300025900 Bacteria 1062
266 Ga0207688_10279042 3300025901 Bacteria 1018
267 Ga0207680_10014153 3300025903 Bacteria 4119
268 Ga0207680_10014704 3300025903 Bacteria 4062
269 Ga0207685_10328422 3300025905 Bacteria 765
270 Ga0207645_10001520 3300025907 Bacteria 18951
271 Ga0207645_10042386 3300025907 Bacteria 2912
272 Ga0207645_10167164 3300025907 Bacteria 1440
273 Ga0207705_10306188 3300025909 Bacteria 1219
274 Ga0207684_10203812 3300025910 Bacteria 1706
275 Ga0207684_10312314 3300025910 Bacteria 1355
276 Ga0207684_11303385 3300025910 Unclassified 598
277 Ga0207654_10798006 3300025911 Bacteria 682
278 Ga0207707_10195235 3300025912 Bacteria 1766
279 Ga0207707_10394447 3300025912 Bacteria 1189
280 Ga0207695_10151028 3300025913 Bacteria 2262
281 Ga0207695_10578049 3300025913 Bacteria 1005
282 Ga0207663_10287992 3300025916 Unclassified 1223
283 Ga0207660_10244801 3300025917 Unclassified 1414
284 Ga0207660_10449939 3300025917 Bacteria 1041
285 Ga0207662_10018965 3300025918 Bacteria 3908
286 Ga0207657_10329011 3300025919 Bacteria 1207
287 Ga0207652_10034744 3300025921 Bacteria 4251
288 Ga0207652_10076656 3300025921 Bacteria 2916
289 Ga0207652_10779215 3300025921 Bacteria 850
290 Ga0207646_10024978 3300025922 Bacteria 5468
291 Ga0207646_10642309 3300025922 Bacteria 951
292 Ga0207681_10091757 3300025923 Bacteria 2170
293 Ga0207681_10101351 3300025923 Bacteria 2077
294 Ga0207681_10126729 3300025923 Bacteria 1881
295 Ga0207694_10218479 3300025924 Bacteria 1554
296 Ga0207650_10829115 3300025925 Bacteria 784
297 Ga0207659_10001358 3300025926 Bacteria 14609
298 Ga0207659_10178145 3300025926 Bacteria 1682
299 Ga0207659_10398873 3300025926 Bacteria 1150
300 Ga0207687_10348905 3300025927 Bacteria 1205
301 Ga0207700_10141360 3300025928 Bacteria 1978
302 Ga0207700_10321054 3300025928 Bacteria 1342
303 Ga0207700_10493657 3300025928 Bacteria 1083
304 Ga0207664_10030226 3300025929 Bacteria 4136
305 Ga0207644_10023320 3300025931 Bacteria 4238
306 Ga0207644_10176440 3300025931 Bacteria 1672
307 Ga0207690_10307712 3300025932 Unclassified 1242
308 Ga0207690_10689960 3300025932 Unclassified 839
309 Ga0207690_10697292 3300025932 Bacteria 834
310 Ga0207706_10349520 3300025933 Bacteria 1286
311 Ga0207706_10413769 3300025933 Bacteria 1168
312 Ga0207706_11353006 3300025933 Unclassified 586
313 Ga0207686_10060563 3300025934 Bacteria 2396
314 Ga0207686_10260646 3300025934 Bacteria 1271
315 Ga0207686_10548352 3300025934 Bacteria 904
316 Ga0207686_10884159 3300025934 Bacteria 720
317 Ga0207670_10145156 3300025936 Bacteria 1754
318 Ga0207670_10810594 3300025936 Bacteria 780
319 Ga0207669_10025073 3300025937 Bacteria 3216
320 Ga0207669_10447620 3300025937 Unclassified 1023
321 Ga0207704_10158269 3300025938 Bacteria 1608
322 Ga0207704_10424885 3300025938 Bacteria 1054
323 Ga0207665_10205759 3300025939 Bacteria 1436
324 Ga0207665_11078233 3300025939 Unclassified 640
325 Ga0207691_10241775 3300025940 Bacteria 1560
326 Ga0207691_10248028 3300025940 Bacteria 1538
327 Ga0207691_10372281 3300025940 Bacteria 1220
328 Ga0207711_10017574 3300025941 Bacteria 5942
329 Ga0207711_10163785 3300025941 Bacteria 2015
330 Ga0207711_10170227 3300025941 Bacteria 1976
331 Ga0207711_10217828 3300025941 Bacteria 1745
332 Ga0207689_10822734 3300025942 Bacteria 784
333 Ga0207661_10058344 3300025944 Bacteria 3106
334 Ga0207661_10735386 3300025944 Unclassified 908
335 Ga0207679_10051719 3300025945 Bacteria 3009
336 Ga0207679_10233426 3300025945 Bacteria 1555
337 Ga0207679_10370575 3300025945 Bacteria 1253
338 Ga0207679_10944009 3300025945 Unclassified 790
339 Ga0207679_11618617 3300025945 Bacteria 593
340 Ga0207667_10070693 3300025949 Bacteria 3632
341 Ga0207667_10551318 3300025949 Bacteria 1166
342 Ga0207667_11313100 3300025949 Bacteria 699
343 Ga0207651_10028412 3300025960 Bacteria 3528
344 Ga0207668_10023022 3300025972 Bacteria 3997
345 Ga0207668_11395005 3300025972 Bacteria 631
346 Ga0207640_10005788 3300025981 Bacteria 6741
347 Ga0207640_10017134 3300025981 Bacteria 4232
348 Ga0207658_10511400 3300025986 Bacteria 1071
349 Ga0207677_10051404 3300026023 Bacteria 2794
350 Ga0207677_10129698 3300026023 Bacteria 1912
351 Ga0207677_10215980 3300026023 Bacteria 1535
352 Ga0207677_10248858 3300026023 Bacteria 1442
353 Ga0207677_10532098 3300026023 Bacteria 1021
354 Ga0207703_10013301 3300026035 Bacteria 6411
355 Ga0207703_10050363 3300026035 Bacteria 3371
356 Ga0207703_10161399 3300026035 Bacteria 1963
357 Ga0207703_11095991 3300026035 Bacteria 765
358 Ga0207639_10438606 3300026041 Bacteria 1184
359 Ga0207708_10045500 3300026075 Bacteria 3345
360 Ga0207708_10073241 3300026075 Bacteria 2625
361 Ga0207708_10308944 3300026075 Bacteria 1288
362 Ga0207702_10593904 3300026078 Bacteria 1086
363 Ga0207648_10035019 3300026089 Bacteria 4426
364 Ga0207648_10327480 3300026089 Bacteria 1377
365 Ga0207648_10336099 3300026089 Bacteria 1359
366 Ga0207676_10005066 3300026095 Bacteria 9324
367 Ga0207676_10109539 3300026095 Bacteria 2308
368 Ga0207676_10179039 3300026095 Unclassified 1855
369 Ga0207676_10377156 3300026095 Bacteria 1319
370 Ga0207676_10825683 3300026095 Bacteria 905
371 Ga0207674_10276881 3300026116 Bacteria 1626
372 Ga0207675_100003742 3300026118 Bacteria 14820
373 Ga0207675_100149272 3300026118 Bacteria 2224
374 Ga0207675_100169552 3300026118 Bacteria 2086
375 Ga0207675_100171637 3300026118 Bacteria 2073
376 Ga0207675_100662730 3300026118 Bacteria 1050
377 Ga0207675_101132180 3300026118 Bacteria 803
378 Ga0207683_10042520 3300026121 Bacteria 3969
379 Ga0207683_10042803 3300026121 Bacteria 3955
380 Ga0207683_10043617 3300026121 Bacteria 3920
381 Ga0207698_10116593 3300026142 Bacteria 2251
382 Ga0209998_10057032 3300027717 Bacteria 914
383 Ga0207428_10012421 3300027907 Bacteria 7484
384 Ga0207428_10196062 3300027907 Bacteria 1521
385 Ga0207428_10338608 3300027907 Bacteria 1108
386 Ga0268266_10013631 3300028379 Bacteria 7001
387 Ga0268266_10045134 3300028379 Bacteria 3769
388 Ga0268266_10890086 3300028379 Bacteria 861
389 Ga0268265_10020199 3300028380 Bacteria 4646
390 Ga0268265_10097120 3300028380 Bacteria 2370
391 Ga0268264_10259561 3300028381 Bacteria 1618
392 Ga0268264_10379239 3300028381 Bacteria 1354
393 Ga0268264_10709325 3300028381 Bacteria 1000
394 Ga0373930_0000929 3300034816 Bacteria 4193
395 Ga0373948_0000168 3300034817 Bacteria 7335
396 Ga0373950_0000800 3300034818 Bacteria 3938
397 Ga0373959_0001654 3300034820 Bacteria 3545
398 Ga0373938_0002264 3300034957 Bacteria 3092
399 Ga0373928_0001495 3300035084 Bacteria 4545
400 Ga0373929_0000061 3300035085 Bacteria 18553
401 Ga0373944_0026816 3300035089 Bacteria 1704
402 Ga0373949_0003987 3300035090 Bacteria 3424
403 Ga0373951_0000452 3300035091 Bacteria 11894
404 Ga0373952_0012910 3300035092 Bacteria 1650
405 Ga0373932_0010201 3300035112 Bacteria 2270
406 Ga0373932_0156788 3300035112 Bacteria 785
407 Ga0373936_0083801 3300035113 Bacteria 1330
408 Ga0373939_0001943 3300035114 Bacteria 4942
409 Ga0373941_0001034 3300035115 Bacteria 5783
410 Ga0373941_0075920 3300035115 Bacteria 1125
411 Ga0373953_0059805 3300035117 Bacteria 1556
412 Ga0373956_0048577 3300035119 Bacteria 1901
413 Ga0373960_0000030 3300035121 Bacteria 17918
414 Ga0373943_0799003 3300035170 Unclassified 561
415 Ga0373946_0039999 3300035171 Bacteria 1916
416 Ga0373942_0000248 3300035207 Bacteria 14328
417 Ga0373961_0000392 3300035241 Bacteria 18436
418 Ga0373924_0023896 3300035410 Bacteria 2403
419 Ga0373931_0005554 3300035691 Bacteria 5844
420 Ga0373935_0077753 3300035692 Bacteria 2151
421 Ga0373935_0223480 3300035692 Bacteria 1309
422 Ga0373935_0658008 3300035692 Bacteria 769
423 Ga0373947_0153333 3300035725 Unclassified 1485
424 Ga0373947_0193017 3300035725 Bacteria 1329
425 Ga0373937_0036417 3300036401 Bacteria 4484
426 Ga0373937_0078395 3300036401 Bacteria 3053
427 Ga0373937_0240642 3300036401 Bacteria 1705
428 Ga0373937_0799959 3300036401 Bacteria 891
429 Ga0373937_0953972 3300036401 Bacteria 806
430 Ga0373925_0020234 3300037068 Bacteria 4843
431 Ga0373925_0150548 3300037068 Bacteria 1827
432 Ga0373925_0488364 3300037068 Unclassified 1010
433 Ga0436365_0485056 3300039437 Bacteria 2798
434 Ga0439444_0061036 3300042437 Bacteria 787
435 Ga0466963_0215845 3300044694 Bacteria 1343
436 Ga0451576_0020061 3300045051 Bacteria 7286
437 Ga0451576_0152935 3300045051 Bacteria 2406
438 Ga0451576_0161611 3300045051 Bacteria 2338
439 Ga0466967_0241783 3300045976 Bacteria 1722
440 Ga0466967_0721559 3300045976 Bacteria 988
441 Ga0495629_0071582 3300046459 Bacteria 2420
442 Ga0495629_0277460 3300046459 Bacteria 1151
443 Ga0495629_0470834 3300046459 Bacteria 849
444 Ga0495651_0310436 3300046462 Bacteria 1055
445 Ga0495580_0030846 3300046472 Bacteria 3878
446 Ga0495582_0158245 3300046473 Bacteria 1288
447 Ga0495582_0580495 3300046473 Bacteria 649
448 Ga0495639_0187086 3300046475 Bacteria 1010
449 Ga0495639_0263515 3300046475 Bacteria 854
450 Ga0495662_0124197 3300046476 Bacteria 1268
451 Ga0495608_0112569 3300046511 Bacteria 1749
452 Ga0495618_0068336 3300046514 Bacteria 2260
453 Ga0495628_0100482 3300046516 Bacteria 2233
454 Ga0495630_0005407 3300046517 Bacteria 9013
455 Ga0495642_0205141 3300046528 Bacteria 860
456 Ga0495640_0346704 3300046533 Bacteria 917
457 Ga0495640_0644679 3300046533 Bacteria 638
458 Ga0495586_0080071 3300046535 Bacteria 1794
459 Ga0495587_0056425 3300046536 Bacteria 2311
460 Ga0495598_0260107 3300046537 Bacteria 645
461 Ga0495621_0282837 3300046539 Bacteria 684
462 Ga0495645_0005538 3300046543 Bacteria 8683
463 Ga0495633_0049919 3300046558 Bacteria 1974
464 Ga0495667_0046477 3300046559 Bacteria 2871
465 Ga0495634_0492827 3300046642 Bacteria 719
466 Ga0495634_0709630 3300046642 Bacteria 578
467 Ga0495659_0165344 3300046664 Bacteria 895
468 Ga0495659_0307482 3300046664 Unclassified 671
469 Ga0495599_0118179 3300046678 Bacteria 1649
470 Ga0495646_0225045 3300046680 Bacteria 1013
471 Ga0495658_0014056 3300046683 Bacteria 4081
472 Ga0495658_0772057 3300046683 Unclassified 615
473 Ga0495669_0027082 3300046684 Bacteria 2507
474 Ga0495600_0291864 3300046809 Bacteria 1030
475 Ga0495600_0362356 3300046809 Bacteria 907
476 Ga0495581_0067151 3300047315 Bacteria 2074
477 Ga0495636_0357830 3300047318 Bacteria 690
478 Ga0495674_0048747 3300047319 Bacteria 3747
479 Ga0495674_0220645 3300047319 Unclassified 1567
480 Ga0495674_0226050 3300047319 Bacteria 1546
481 Ga0495684_0000048 3300047471 Bacteria 89243
482 Ga0495684_0023470 3300047471 Bacteria 4742
483 Ga0495614_0197723 3300048089 Unclassified 909
484 Ga0496101_0404503 3300048904 Bacteria 1075
485 Ga0496102_0085319 3300048905 Bacteria 2915
486 Ga0496102_0437902 3300048905 Bacteria 1227
487 Ga0496104_0095753 3300048907 Bacteria 2840
488 Ga0496104_0608078 3300048907 Bacteria 1003
489 Ga0496104_1304621 3300048907 Bacteria 629
490 Ga0496105_0777978 3300048908 Bacteria 729
491 Ga0496106_0151145 3300048909 Bacteria 1832
492 Ga0496106_0814880 3300048909 Bacteria 740
493 Ga0496108_0025799 3300048911 Bacteria 4845
494 Ga0496109_0082392 3300048912 Bacteria 2965
495 Ga0496110_0299381 3300048913 Bacteria 1465
496 Ga0496112_0053726 3300048915 Bacteria 3957
497 Ga0496112_0364031 3300048915 Bacteria 1388
498 Ga0496112_1034786 3300048915 Bacteria 740
499 Ga0496113_0012946 3300048916 Bacteria 5627
500 Ga0496114_0036474 3300048917 Bacteria 4065
501 Ga0496114_0226158 3300048917 Bacteria 1643
502 Ga0496114_0279661 3300048917 Bacteria 1471
503 Ga0501042_0821270 3300049578 Bacteria 677
504 Ga0501047_0438861 3300049581 Bacteria 1136
505 Ga0501079_0472748 3300049741 Bacteria 985
506 Ga0501045_0670544 3300049824 Unclassified 766
507 nmdc:mga05p37_10193_c1 3300050507 Bacteria 11157
508 nmdc:mga05p37_20692_c1 3300050507 Bacteria 7961
509 nmdc:mga05p37_34136_c1 3300050507 Bacteria 6231
510 nmdc:mga05p37_399879_c1 3300050507 Bacteria 1604
511 nmdc:mga05p37_40625_c1 3300050507 Bacteria 5713
512 nmdc:mga05p37_425827_c1 3300050507 Bacteria 1543
513 nmdc:mga05p37_435691_c1 3300050507 Bacteria 1522
514 nmdc:mga05p37_44189_c1 3300050507 Bacteria 5481
515 nmdc:mga05p37_46925_c1 3300050507 Bacteria 5312
516 nmdc:mga09592_162416_c1 3300050508 Bacteria 1930
517 nmdc:mga09592_56031_c1 3300050508 Bacteria 3331
518 nmdc:mga06r32_836617_c1 3300050510 Bacteria 879
519 nmdc:mga08y16_213618_c1 3300050511 Bacteria 1998
520 nmdc:mga08y16_629522_c1 3300050511 Bacteria 1079
521 nmdc:mga08y16_8390_c1 3300050511 Bacteria 10811
522 nmdc:mga0n895_137285_c1 3300050512 Bacteria 2472
523 nmdc:mga0n895_151717_c1 3300050512 Bacteria 2348
524 nmdc:mga0n895_18382_c1 3300050512 Bacteria 6467
525 nmdc:mga0n895_1868_c1 3300050512 Bacteria 16079
526 nmdc:mga0n895_219530_c1 3300050512 Bacteria 1930
527 nmdc:mga0n895_367993_c1 3300050512 Bacteria 1455
528 nmdc:mga0n895_53336_c1 3300050512 Bacteria 3973
529 nmdc:mga0n895_552145_c1 3300050512 Bacteria 1158
530 nmdc:mga0rr50_127636_c1 3300050513 Bacteria 2032
531 nmdc:mga0rr50_1325636_c1 3300050513 Bacteria 610
532 nmdc:mga0rr50_18905_c1 3300050513 Bacteria 4640
533 nmdc:mga0rr50_26949_c1 3300050513 Bacteria 4018
534 nmdc:mga0rr50_3197_c1 3300050513 Bacteria 9369
535 nmdc:mga0rr50_408714_c1 3300050513 Bacteria 1147
536 nmdc:mga0rr50_45651_c1 3300050513 Bacteria 3222
537 nmdc:mga0rr50_56723_c1 3300050513 Bacteria 2927
538 nmdc:mga0rr50_57_c1 3300050513 Bacteria 67718
539 nmdc:mga0rr50_66682_c1 3300050513 Bacteria 2732
540 nmdc:mga08x19_30497_c1 3300050514 Bacteria 3388
541 nmdc:mga08x19_35582_c1 3300050514 Bacteria 3152
542 nmdc:mga08x19_560_c1 3300050514 Bacteria 24336
543 nmdc:mga08x19_580987_c1 3300050514 Bacteria 793
544 nmdc:mga08x19_828285_c1 3300050514 Bacteria 657
545 nmdc:mga08x19_92872_c1 3300050514 Bacteria 1994
546 nmdc:mga0a205_15028_c1 3300050515 Bacteria 7226
547 nmdc:mga0a205_150569_c1 3300050515 Bacteria 2226
548 nmdc:mga0a205_155837_c1 3300050515 Bacteria 2182
549 nmdc:mga0a205_28689_c1 3300050515 Bacteria 5322
550 nmdc:mga0a205_303147_c1 3300050515 Bacteria 1470
551 nmdc:mga0a205_318103_c1 3300050515 Unclassified 1428
552 nmdc:mga0a205_90572_c1 3300050515 Bacteria 2956
553 Ga0495601_0005324 3300053077 Bacteria 7491
554 Ga0495601_0504035 3300053077 Bacteria 781
555 Ga0495595_0212153 3300053084 Bacteria 965
556 Ga0495619_0017311 3300053085 Bacteria 4564
557 Ga0500658_0192797 3300053134 Bacteria 930
558 Ga0530510_0728081 3300061734 Bacteria 756
559 Ga0495623_0478505
560 Ga0065712_10101224
561 Ga0070658_10165130
562 Ga0070683_100050714
563 Ga0070683_100167698
564 Ga0070690_100052440
565 Ga0070690_100689106
566 Ga0070690_100711662
567 Ga0070690_101016919
568 Ga0070670_100205776
569 Ga0068869_100209054
570 Ga0070666_10012780
571 Ga0070680_100263066
572 Ga0068868_100039007
573 Ga0068868_100254712
574 Ga0068868_100970931
575 Ga0070660_100016166
576 Ga0070689_100129866
577 Ga0070689_101179861
578 Ga0070691_10001122
579 Ga0070687_100061326
580 Ga0070668_100464381
581 Ga0070669_100032682
582 Ga0070669_100941457
583 Ga0070675_100002755
584 Ga0070675_100015148
585 Ga0070675_100022447
586 Ga0070675_100881441
587 Ga0070675_100895445
588 Ga0070671_100028744
589 Ga0070671_100689606
590 Ga0070671_100820108
591 Ga0070674_100636088
592 Ga0070673_100007116
593 Ga0070673_100218161
594 Ga0070673_100572558
595 Ga0070673_100724037
596 Ga0070688_100008618
597 Ga0070659_100418430
598 Ga0070659_100917676
599 Ga0070709_10355237
600 Ga0070714_100005752
601 Ga0070713_100101685
602 Ga0070713_100250049
603 Ga0070701_10013591
604 Ga0070711_100273927
605 Ga0070705_100007345
606 Ga0070705_101002029
607 Ga0070700_100052736
608 Ga0070694_100007290
609 Ga0070694_100079735
610 Ga0070708_100230259
611 Ga0070708_100244048
612 Ga0070708_100589475
613 Ga0070708_100592022
614 Ga0070708_101467876
615 Ga0070678_100024937
616 Ga0070678_100172909
617 Ga0070678_100369748
618 Ga0070662_100520468
619 Ga0070662_101547215
620 Ga0070681_10150241
621 Ga0070681_11023501
622 Ga0070685_10174077
623 Ga0070706_100489779
624 Ga0070706_100660743
625 Ga0070706_100929727
626 Ga0070707_100048000
627 Ga0070707_100096336
628 Ga0070707_100133795
629 Ga0070698_100046896
630 Ga0070698_100116969
631 Ga0070699_100031897
632 Ga0070699_100124982
633 Ga0070699_100283987
634 Ga0070679_100128930
635 Ga0070679_100190899
636 Ga0070679_100931825
637 Ga0070684_100075474
638 Ga0070697_100027724
639 Ga0070697_100047239
640 Ga0068853_100221270
641 Ga0068853_100472655
642 Ga0068853_100727097
643 Ga0068853_100751438
644 Ga0070686_100000724
645 Ga0070686_100249428
646 Ga0070695_100004708
647 Ga0070695_100034496
648 Ga0070695_100090030
649 Ga0070696_100198416
650 Ga0070696_100215795
651 Ga0070693_100201372
652 Ga0070693_100275303
653 Ga0070665_100001384
654 Ga0070665_100004631
655 Ga0070704_100002214
656 Ga0070704_100038507
657 Ga0070704_100270140
658 Ga0068855_100004263
659 Ga0068855_100465448
660 Ga0068855_100741727
661 Ga0068855_100760371
662 Ga0070664_100230221
663 Ga0070664_100846585
664 Ga0070664_100909896
665 Ga0070664_101405455
666 Ga0068854_100008134
667 Ga0068854_100138550
668 Ga0068854_100491369
669 Ga0068856_100908770
670 Ga0070702_100000381
671 Ga0070702_100316906
672 Ga0070702_100583725
673 Ga0068852_100149951
674 Ga0068852_101230347
675 Ga0068859_100078059
676 Ga0068859_100185569
677 Ga0068859_100505108
678 Ga0068864_100004024
679 Ga0068864_100070984
680 Ga0068864_100081895
681 Ga0068864_100117293
682 Ga0068864_100229526
683 Ga0068864_100470204
684 Ga0068866_10065978
685 Ga0068866_10512143
686 Ga0068866_10828474
687 Ga0068861_100000721
688 Ga0068861_100410702
689 Ga0068861_100439409
690 Ga0068851_10201026
691 Ga0068863_100498429
692 Ga0068858_100004822
693 Ga0068858_100048591
694 Ga0068858_100168227
695 Ga0068858_101624659
696 Ga0068862_100005863
697 Ga0068862_100017302
698 Ga0068862_100219277
699 Ga0068862_100295678
700 Ga0068862_100450569
701 Ga0068862_100516942
702 Ga0068862_101071409
703 Ga0081455_10215353
704 Ga0081540_1048140
705 Ga0081539_10003680
706 Ga0081539_10168640
707 Ga0075432_10022219
708 Ga0070715_10060035
709 Ga0070715_10220808
710 Ga0070716_100275755
711 Ga0097621_100000311
712 Ga0097621_100011145
713 Ga0097621_100085902
714 Ga0068871_100000337
715 Ga0068871_100002546
716 Ga0068871_100073214
717 Ga0068871_100298593
718 Ga0068871_100719127
719 Ga0068871_101146032
720 Ga0075428_100094858
721 Ga0075428_100286419
722 Ga0075431_100378126
723 Ga0075433_10102157
724 Ga0075433_10115551
725 Ga0075433_10219383
726 Ga0075433_10255872
727 Ga0075433_10259032
728 Ga0075433_10767417
729 Ga0075433_10867929
730 Ga0075434_100004421
731 Ga0075434_100006255
732 Ga0075434_100070095
733 Ga0075434_100493492
734 Ga0075434_100594290
735 Ga0075434_100653138
736 Ga0075434_101470492
737 Ga0075434_101916447
738 Ga0075429_100114277
739 Ga0075429_100707125
740 Ga0068865_100000944
741 Ga0068865_100257880
742 Ga0075436_100002315
743 Ga0075436_100057952
744 Ga0075436_100344516
745 Ga0097620_100078057
746 Ga0097620_100185557
747 Ga0097620_100505116
748 Ga0075435_100000331
749 Ga0075435_100005015
750 Ga0075435_100010061
751 Ga0075435_100029276
752 Ga0075435_100031187
753 Ga0075435_100089653
754 Ga0075435_100336307
755 Ga0075435_100344800
756 Ga0105251_10077631
757 Ga0105240_10102793
758 Ga0105240_10234952
759 Ga0105240_10385515
760 Ga0105240_10520688
761 Ga0111539_10001186
762 Ga0111539_10186479
763 Ga0111539_10448287
764 Ga0111539_10847373
765 Ga0111539_10878246
766 Ga0105245_10171191
767 Ga0105245_10876177
768 Ga0105247_10008271
769 Ga0114129_10002983
770 Ga0114129_10005106
771 Ga0114129_10022929
772 Ga0114129_10034998
773 Ga0114129_10108986
774 Ga0114129_10157597
775 Ga0114129_10781453
776 Ga0114129_10870101
777 Ga0114129_10988100
778 Ga0114129_11990317
779 Ga0105243_10024715
780 Ga0105243_10781007
781 Ga0105241_10059560
782 Ga0105242_10000999
783 Ga0105242_10005849
784 Ga0105242_10368842
785 Ga0105242_11470922
786 Ga0105242_11672944
787 Ga0105248_10015618
788 Ga0105248_10045519
789 Ga0105248_10213522
790 Ga0105248_10370024
791 Ga0105248_11033591
792 Ga0105249_10332334
793 Ga0105249_11116710
794 Ga0157369_10495239
795 Ga0157374_10043232
796 Ga0157378_10107163
797 Ga0157378_10484587
798 Ga0163162_10965549
799 Ga0157372_10179826
800 Ga0157375_10214249
801 Ga0157375_10632424
802 Ga0163163_10011277
803 Ga0163163_10154669
804 Ga0163163_10333359
805 Ga0157380_10207113
806 Ga0157380_10315202
807 Ga0157380_10523026
808 Ga0157380_11339256
809 Ga0157377_10265343
810 Ga0157377_10420468
811 Ga0157377_10732265
812 Ga0157379_10010647
813 Ga0157379_10096122
814 Ga0157379_11001425
815 Ga0157379_11421715
816 Ga0157376_10012896
817 Ga0157376_10690198
818 Ga0182007_10299340
819 Ga0207656_10271683
820 Ga0207682_10167686
821 Ga0207682_10451429
822 Ga0207642_10023545
823 Ga0207710_10171025
824 Ga0207688_10279042
825 Ga0207680_10014153
826 Ga0207680_10014704
827 Ga0207685_10328422
828 Ga0207645_10001520
829 Ga0207645_10042386
830 Ga0207645_10167164
831 Ga0207705_10306188
832 Ga0207684_10203812
833 Ga0207684_10312314
834 Ga0207684_11303385
835 Ga0207654_10798006
836 Ga0207707_10195235
837 Ga0207707_10394447
838 Ga0207695_10151028
839 Ga0207695_10578049
840 Ga0207663_10287992
841 Ga0207660_10244801
842 Ga0207660_10449939
843 Ga0207662_10018965
844 Ga0207657_10329011
845 Ga0207652_10034744
846 Ga0207652_10076656
847 Ga0207652_10779215
848 Ga0207646_10024978
849 Ga0207646_10642309
850 Ga0207681_10091757
851 Ga0207681_10101351
852 Ga0207681_10126729
853 Ga0207694_10218479
854 Ga0207650_10829115
855 Ga0207659_10001358
856 Ga0207659_10178145
857 Ga0207659_10398873
858 Ga0207687_10348905
859 Ga0207700_10141360
860 Ga0207700_10321054
861 Ga0207700_10493657
862 Ga0207664_10030226
863 Ga0207644_10023320
864 Ga0207644_10176440
865 Ga0207690_10307712
866 Ga0207690_10689960
867 Ga0207690_10697292
868 Ga0207706_10349520
869 Ga0207706_10413769
870 Ga0207706_11353006
871 Ga0207686_10060563
872 Ga0207686_10260646
873 Ga0207686_10548352
874 Ga0207686_10884159
875 Ga0207670_10145156
876 Ga0207670_10810594
877 Ga0207669_10025073
878 Ga0207669_10447620
879 Ga0207704_10158269
880 Ga0207704_10424885
881 Ga0207665_10205759
882 Ga0207665_11078233
883 Ga0207691_10241775
884 Ga0207691_10248028
885 Ga0207691_10372281
886 Ga0207711_10017574
887 Ga0207711_10163785
888 Ga0207711_10170227
889 Ga0207711_10217828
890 Ga0207689_10822734
891 Ga0207661_10058344
892 Ga0207661_10735386
893 Ga0207679_10051719
894 Ga0207679_10233426
895 Ga0207679_10370575
896 Ga0207679_10944009
897 Ga0207679_11618617
898 Ga0207667_10070693
899 Ga0207667_10551318
900 Ga0207667_11313100
901 Ga0207651_10028412
902 Ga0207668_10023022
903 Ga0207668_11395005
904 Ga0207640_10005788
905 Ga0207640_10017134
906 Ga0207658_10511400
907 Ga0207677_10051404
908 Ga0207677_10129698
909 Ga0207677_10215980
910 Ga0207677_10248858
911 Ga0207677_10532098
912 Ga0207703_10013301
913 Ga0207703_10050363
914 Ga0207703_10161399
915 Ga0207703_11095991
916 Ga0207639_10438606
917 Ga0207708_10045500
918 Ga0207708_10073241
919 Ga0207708_10308944
920 Ga0207702_10593904
921 Ga0207648_10035019
922 Ga0207648_10327480
923 Ga0207648_10336099
924 Ga0207676_10005066
925 Ga0207676_10109539
926 Ga0207676_10179039
927 Ga0207676_10377156
928 Ga0207676_10825683
929 Ga0207674_10276881
930 Ga0207675_100003742
931 Ga0207675_100149272
932 Ga0207675_100169552
933 Ga0207675_100171637
934 Ga0207675_100662730
935 Ga0207675_101132180
936 Ga0207683_10042520
937 Ga0207683_10042803
938 Ga0207683_10043617
939 Ga0207698_10116593
940 Ga0209998_10057032
941 Ga0207428_10012421
942 Ga0207428_10196062
943 Ga0207428_10338608
944 Ga0268266_10013631
945 Ga0268266_10045134
946 Ga0268266_10890086
947 Ga0268265_10020199
948 Ga0268265_10097120
949 Ga0268264_10259561
950 Ga0268264_10379239
951 Ga0268264_10709325
952 Ga0373930_0000929
953 Ga0373948_0000168
954 Ga0373950_0000800
955 Ga0373959_0001654
956 Ga0373938_0002264
957 Ga0373928_0001495
958 Ga0373929_0000061
959 Ga0373944_0026816
960 Ga0373949_0003987
961 Ga0373951_0000452
962 Ga0373952_0012910
963 Ga0373932_0010201
964 Ga0373932_0156788
965 Ga0373936_0083801
966 Ga0373939_0001943
967 Ga0373941_0001034
968 Ga0373941_0075920
969 Ga0373953_0059805
970 Ga0373956_0048577
971 Ga0373960_0000030
972 Ga0373943_0799003
973 Ga0373946_0039999
974 Ga0373942_0000248
975 Ga0373961_0000392
976 Ga0373924_0023896
977 Ga0373931_0005554
978 Ga0373935_0077753
979 Ga0373935_0223480
980 Ga0373935_0658008
981 Ga0373947_0153333
982 Ga0373947_0193017
983 Ga0373937_0036417
984 Ga0373937_0078395
985 Ga0373937_0240642
986 Ga0373937_0799959
987 Ga0373937_0953972
988 Ga0373925_0020234
989 Ga0373925_0150548
990 Ga0373925_0488364
991 Ga0436365_0485056
992 Ga0439444_0061036
993 Ga0466963_0215845
994 Ga0451576_0020061
995 Ga0451576_0152935
996 Ga0451576_0161611
997 Ga0466967_0241783
998 Ga0466967_0721559
999 Ga0495629_0071582
1000 Ga0495629_0277460
1001 Ga0495629_0470834
1002 Ga0495651_0310436
1003 Ga0495580_0030846
1004 Ga0495582_0158245
1005 Ga0495582_0580495
1006 Ga0495639_0187086
1007 Ga0495639_0263515
1008 Ga0495662_0124197
1009 Ga0495608_0112569
1010 Ga0495618_0068336
1011 Ga0495628_0100482
1012 Ga0495630_0005407
1013 Ga0495642_0205141
1014 Ga0495640_0346704
1015 Ga0495640_0644679
1016 Ga0495586_0080071
1017 Ga0495587_0056425
1018 Ga0495598_0260107
1019 Ga0495621_0282837
1020 Ga0495645_0005538
1021 Ga0495633_0049919
1022 Ga0495667_0046477
1023 Ga0495634_0492827
1024 Ga0495634_0709630
1025 Ga0495659_0165344
1026 Ga0495659_0307482
1027 Ga0495599_0118179
1028 Ga0495646_0225045
1029 Ga0495658_0014056
1030 Ga0495658_0772057
1031 Ga0495669_0027082
1032 Ga0495600_0291864
1033 Ga0495600_0362356
1034 Ga0495581_0067151
1035 Ga0495636_0357830
1036 Ga0495674_0048747
1037 Ga0495674_0220645
1038 Ga0495674_0226050
1039 Ga0495684_0000048
1040 Ga0495684_0023470
1041 Ga0495614_0197723
1042 Ga0496101_0404503
1043 Ga0496102_0085319
1044 Ga0496102_0437902
1045 Ga0496104_0095753
1046 Ga0496104_0608078
1047 Ga0496104_1304621
1048 Ga0496105_0777978
1049 Ga0496106_0151145
1050 Ga0496106_0814880
1051 Ga0496108_0025799
1052 Ga0496109_0082392
1053 Ga0496110_0299381
1054 Ga0496112_0053726
1055 Ga0496112_0364031
1056 Ga0496112_1034786
1057 Ga0496113_0012946
1058 Ga0496114_0036474
1059 Ga0496114_0226158
1060 Ga0496114_0279661
1061 Ga0501042_0821270
1062 Ga0501047_0438861
1063 Ga0501079_0472748
1064 Ga0501045_0670544
1065 nmdc:mga05p37_10193_c1
1066 nmdc:mga05p37_20692_c1
1067 nmdc:mga05p37_34136_c1
1068 nmdc:mga05p37_399879_c1
1069 nmdc:mga05p37_40625_c1
1070 nmdc:mga05p37_425827_c1
1071 nmdc:mga05p37_435691_c1
1072 nmdc:mga05p37_44189_c1
1073 nmdc:mga05p37_46925_c1
1074 nmdc:mga09592_162416_c1
1075 nmdc:mga09592_56031_c1
1076 nmdc:mga06r32_836617_c1
1077 nmdc:mga08y16_213618_c1
1078 nmdc:mga08y16_629522_c1
1079 nmdc:mga08y16_8390_c1
1080 nmdc:mga0n895_137285_c1
1081 nmdc:mga0n895_151717_c1
1082 nmdc:mga0n895_18382_c1
1083 nmdc:mga0n895_1868_c1
1084 nmdc:mga0n895_219530_c1
1085 nmdc:mga0n895_367993_c1
1086 nmdc:mga0n895_53336_c1
1087 nmdc:mga0n895_552145_c1
1088 nmdc:mga0rr50_127636_c1
1089 nmdc:mga0rr50_1325636_c1
1090 nmdc:mga0rr50_18905_c1
1091 nmdc:mga0rr50_26949_c1
1092 nmdc:mga0rr50_3197_c1
1093 nmdc:mga0rr50_408714_c1
1094 nmdc:mga0rr50_45651_c1
1095 nmdc:mga0rr50_56723_c1
1096 nmdc:mga0rr50_57_c1
1097 nmdc:mga0rr50_66682_c1
1098 nmdc:mga08x19_30497_c1
1099 nmdc:mga08x19_35582_c1
1100 nmdc:mga08x19_560_c1
1101 nmdc:mga08x19_580987_c1
1102 nmdc:mga08x19_828285_c1
1103 nmdc:mga08x19_92872_c1
1104 nmdc:mga0a205_15028_c1
1105 nmdc:mga0a205_150569_c1
1106 nmdc:mga0a205_155837_c1
1107 nmdc:mga0a205_28689_c1
1108 nmdc:mga0a205_303147_c1
1109 nmdc:mga0a205_318103_c1
1110 nmdc:mga0a205_90572_c1
1111 Ga0495601_0005324
1112 Ga0495601_0504035
1113 Ga0495595_0212153
1114 Ga0495619_0017311
1115 Ga0500658_0192797
1116 Ga0530510_0728081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

35

141

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

16

118

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

43

120

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ib0-assembly1.cif.gz_A pa4534: acetyl coa complex 0.8313 10 123
2ree-assembly2.cif.gz_B crystal structure of the loading gnatl domain of cura from lyngbya majuscula 0.829 7 113
2fxf-assembly1.cif.gz_B human spermidine/spermine n1-acetyltransferase 0.8257 7 111
3e0k-assembly1.cif.gz_A-2 crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus 0.8247 9 138
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8243 10 111
ID Description Score Start End Superfamily
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8973 59 105 3.40.630.30
af_O33289_11_146_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8907 10 125 3.40.630.30
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8899 52 104 3.40.630.30
af_Q54U46_65_201_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8853 59 103 3.40.630.30
af_P34548_48_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8639 90 113 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A838T1Z5-F1-model_v4 GNAT family N-acetyltransferase 0.9748 6 109 GO:0016747
AF-A0A2S8PH68-F1-model_v4 GNAT family N-acetyltransferase (EC 2.3.1.1) 0.9568 7 114 GO:0004042
GO:0005737
GO:0006526
AF-A0A3D5W7D6-F1-model_v4 Amino-acid acetyltransferase (N-acetylglutamate synthase) 0.9561 9 109 GO:0004042
GO:0005737
GO:0006526
AF-A0A660XZ53-F1-model_v4 GNAT family N-acetyltransferase 0.9497 7 97 GO:0004042
GO:0005737
GO:0006526
AF-A0A7V2IM06-F1-model_v4 GNAT family N-acetyltransferase 0.9451 9 95 GO:0016747

Map