F463484

General Info

Members Datasets Scaffolds Average Seq Length
558 324 421 585

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0005014|Ga0495607_0005014_3042_4973
Length 643
Sequence LSRDLPETGSKFSACVGPDTPHAQGYDDYVAARGTSHAPTRDRIWFDYLIQEPTMSEVSLNGRCLVAGAAQGELLYADVGLSFWGGVEPFSGEVIDRHHPLSGQIITGRVLAIPSGRGSCTGSSVLLELILNGHAPAALVFERVEDILTLGVLVAEQMFGHSIPVISLGEAGFAALRPVKFLRVDGARVTAFDSAPPALPAQSPRQASRVSQTINLNEMDQSFLDGAYGKAAQVAMGIILRMAELQGATELLDITQAHIDGCIYTGPASLRFARQLVEWGAKVRVPTTLNSISVDKRRWRELGVDPALGEPASQLGDAYLDMGARVSFTCAPYLLDSAPELGDQIVWAESNAVVYANSVIGARTLKYPDYLDICIALTGRAPNIGCHLTQQRLAALRIDIAALDRLDDSFYPLLGYHIGLLCGAEIPXXXXLEHKGPTLDDLKAFGAAFATTSAAPMFHIAGITPEATTVELALGGHSPARALSVSETDLLHSWRELNSAQSPEVDAVTLGNPHFSLSECASLAALCQGKRKHERVAIVITCGRATLERAQQAGYVATLEDFGVQFVTDTCWCMLAEPVIPPTARTLMTNSGKYAHYAPGLVGRRVHFASLAECVESACTGVASGLLPAWLHAAARAEAAANV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231007 Pseudomonas sp. GM18 Isolate Nodule
10 2511231008 Pseudomonas sp. GM21 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
19 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
20 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
21 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
22 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
23 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
24 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
25 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
26 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
27 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
28 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
29 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
30 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
31 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
32 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
33 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
34 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
35 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
36 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
37 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
38 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
39 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
40 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
41 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
42 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
43 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
44 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
45 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
46 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
47 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
48 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
49 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
50 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
51 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
52 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
53 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
54 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
55 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
56 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
57 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
58 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
59 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
60 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
61 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
62 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
63 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
64 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
65 2643221719 Rhizobium sp. Root274 Isolate Unclassified
66 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
67 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
68 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
69 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
70 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
71 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
72 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
73 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
74 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
75 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
76 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
77 2773857670 Pseudomonas sp. 478 Isolate Unclassified
78 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
79 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
80 2784132072 Pseudomonas sp. 460 Isolate Unclassified
81 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
82 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
83 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
84 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
85 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
86 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
87 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
88 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
89 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
90 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
91 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
92 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
93 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
94 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
95 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
96 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
97 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
98 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
99 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
100 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
101 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
102 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
103 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
104 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
105 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
106 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
107 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
108 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
109 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
110 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
111 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
112 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
113 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
114 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
115 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
116 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
117 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
118 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
119 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
120 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
121 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
122 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
123 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
124 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
125 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
126 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
127 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
128 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
129 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
130 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
131 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
132 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
135 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
152 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
180 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
184 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
191 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
192 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
193 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
194 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
195 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
196 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
197 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
203 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
204 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
290 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
308 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
309 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
310 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
314 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
315 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
316 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
317 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
318 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
319 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
320 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
321 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
322 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
323 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
324 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.27
Metatranscriptomes 0.18
Isolates 24.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 4.84
Nodule 7.89
Rhizoplane 6.45
Rhizosphere 69
Stem 0
Stem Tuber 0
Unclassified 11.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_8 2124908027 Bacteria 21551
2 JGI25151J46595_10000124 3300003187 Bacteria 105038
3 JGI25153J46596_10000047 3300003215 Bacteria 146400
4 Ga0055530_10000010 3300003791 Bacteria 173678
5 Ga0055540_1000032 3300003792 Bacteria 173678
6 Ga0065714_10000390 3300005288 Bacteria 5083
7 Ga0065714_10022393 3300005288 Bacteria 2695
8 Ga0081455_10016351 3300005937 Bacteria 7167
9 Ga0081539_10000699 3300005985 Bacteria 67274
10 Ga0075365_10000563 3300006038 Bacteria 14372
11 Ga0075432_10001954 3300006058 Bacteria 6845
12 Ga0075362_10012743 3300006177 Bacteria 3348
13 Ga0079104_1000184 3300006946 Bacteria 89198
14 Ga0079104_1000253 3300006946 Bacteria 71204
15 Ga0105251_10000092 3300009011 Bacteria 86905
16 Ga0105251_10002447 3300009011 Bacteria 14590
17 Ga0105251_10017825 3300009011 Bacteria 3795
18 Ga0105244_10003182 3300009036 Bacteria 11920
19 Ga0105244_10014051 3300009036 Bacteria 4647
20 Ga0105240_10132010 3300009093 Bacteria 2995
21 Ga0157373_10007665 3300013100 Bacteria 8022
22 Ga0157373_10035633 3300013100 Bacteria 3572
23 Ga0157373_10040879 3300013100 Bacteria 3317
24 Ga0157371_10002965 3300013102 Bacteria 15777
25 Ga0157371_10113911 3300013102 Bacteria 1920
26 Ga0157369_10011869 3300013105 Bacteria 9895
27 Ga0163162_10021559 3300013306 Bacteria 6346
28 Ga0157380_10073380 3300014326 Bacteria 2774
29 Ga0182008_10043854 3300014497 Bacteria 2226
30 Ga0182006_1003311 3300015261 Bacteria 8317
31 Ga0182006_1005944 3300015261 Bacteria 5738
32 Ga0182007_10017641 3300015262 Bacteria 2602
33 Ga0182005_1004865 3300015265 Bacteria 4270
34 Ga0163161_10000744 3300017792 Bacteria 25621
35 Ga0163161_10007564 3300017792 Bacteria 7511
36 Ga0228711_1000005 3300022739 Bacteria 215594
37 Ga0228710_1000141 3300022740 Bacteria 66299
38 Ga0209148_1000875 3300025254 Bacteria 20847
39 Ga0209759_1001955 3300025256 Bacteria 9926
40 Ga0209455_1001068 3300025272 Bacteria 13524
41 Ga0209130_1000270 3300025284 Bacteria 65057
42 Ga0209676_1002537 3300025292 Bacteria 12712
43 Ga0209025_1000705 3300025294 Bacteria 56926
44 Ga0209758_1000070 3300025297 Bacteria 284093
45 Ga0209758_1004138 3300025297 Bacteria 12378
46 Ga0209758_1023043 3300025297 Bacteria 2831
47 Ga0209050_1000043 3300025298 Bacteria 398654
48 Ga0207426_1000370 3300025302 Bacteria 79287
49 Ga0209051_1000030 3300025303 Bacteria 398654
50 Ga0207655_1000006 3300025728 Bacteria 861092
51 Ga0207655_1000610 3300025728 Bacteria 43238
52 Ga0207655_1006859 3300025728 Bacteria 7476
53 Ga0207713_1000074 3300025735 Bacteria 181376
54 Ga0207713_1020055 3300025735 Bacteria 3252
55 Ga0207713_1022205 3300025735 Bacteria 3019
56 Ga0209281_1000009 3300027111 Bacteria 771717
57 Ga0209281_1000046 3300027111 Bacteria 327042
58 Ga0209281_1000111 3300027111 Bacteria 215615
59 Ga0209282_1000012 3300027666 Bacteria 215614
60 Ga0207428_10005093 3300027907 Bacteria 12340
61 Ga0268266_10034106 3300028379 Bacteria 4327
62 Ga0307515_10033455 3300028794 Bacteria 8462
63 Ga0307408_100000085 3300031548 Bacteria 104335
64 Ga0307408_100046381 3300031548 Bacteria 3108
65 Ga0307410_10041742 3300031852 Bacteria 3027
66 Ga0307406_10021812 3300031901 Bacteria 3793
67 Ga0307406_10050272 3300031901 Bacteria 2642
68 Ga0307407_10068593 3300031903 Bacteria 2101
69 Ga0307412_10000750 3300031911 Bacteria 18812
70 Ga0307412_10025157 3300031911 Bacteria 3683
71 Ga0315914_1000007 3300031967 Bacteria 215597
72 Ga0307409_100085359 3300031995 Bacteria 2566
73 Ga0307414_10066295 3300032004 Bacteria 2580
74 Ga0307415_100041845 3300032126 Bacteria 3045
75 Ga0315913_1000003 3300033430 Bacteria 215608
76 Ga0315915_1000011 3300033464 Bacteria 215597
77 Ga0373927_0000147 3300035695 Bacteria 55399
78 Ga0373925_0011078 3300037068 Bacteria 6549
79 Ga0439438_000510 3300041405 Bacteria 17619
80 Ga0439438_001389 3300041405 Bacteria 10666
81 Ga0439438_006689 3300041405 Bacteria 4029
82 Ga0439438_008139 3300041405 Bacteria 3509
83 Ga0439438_008709 3300041405 Bacteria 3338
84 Ga0439438_008896 3300041405 Bacteria 3286
85 Ga0439447_000846 3300041407 Bacteria 11240
86 Ga0439447_002508 3300041407 Bacteria 6674
87 Ga0439447_008868 3300041407 Bacteria 3086
88 Ga0439447_022203 3300041407 Bacteria 1664
89 Ga0439466_0008388 3300041411 Bacteria 3894
90 Ga0451846_07817 3300041502 Bacteria 3419
91 Ga0439432_000404 3300042006 Bacteria 16001
92 Ga0439432_019423 3300042006 Bacteria 2263
93 Ga0439451_013682 3300042009 Bacteria 1639
94 Ga0439452_000147 3300042010 Bacteria 52317
95 Ga0439452_002263 3300042010 Bacteria 7195
96 Ga0439452_004851 3300042010 Bacteria 4420
97 Ga0439452_016880 3300042010 Bacteria 1974
98 Ga0439456_000268 3300042013 Bacteria 12776
99 Ga0439463_005753 3300042016 Bacteria 3076
100 Ga0450911_000054 3300042115 Bacteria 47325
101 Ga0450890_000826 3300042127 Bacteria 4483
102 Ga0450903_004275 3300042138 Bacteria 2445
103 Ga0450904_000204 3300042139 Bacteria 12877
104 Ga0450906_008907 3300042145 Bacteria 1926
105 Ga0450907_000003 3300042146 Bacteria 138102
106 Ga0450907_001617 3300042146 Bacteria 4727
107 Ga0439446_0001677 3300042156 Bacteria 5135
108 Ga0450909_002931 3300042185 Bacteria 2423
109 Ga0439434_0000019 3300042435 Bacteria 41172
110 Ga0439434_0002723 3300042435 Bacteria 5148
111 Ga0439460_0000299 3300042461 Bacteria 10315
112 Ga0450901_001776 3300042533 Bacteria 2417
113 Ga0439440_0001260 3300042993 Bacteria 4581
114 Ga0495617_000064 3300046452 Bacteria 95741
115 Ga0495617_004610 3300046452 Bacteria 4992
116 Ga0495617_023843 3300046452 Bacteria 2066
117 Ga0495627_002598 3300046453 Bacteria 8527
118 Ga0495603_0014222 3300046455 Bacteria 4815
119 Ga0495590_0000184 3300046457 Bacteria 36515
120 Ga0495590_0005294 3300046457 Bacteria 5119
121 Ga0495591_000103 3300046458 Bacteria 98500
122 Ga0495591_000606 3300046458 Bacteria 27134
123 Ga0495591_002805 3300046458 Bacteria 9388
124 Ga0495591_003118 3300046458 Bacteria 8768
125 Ga0495591_003414 3300046458 Bacteria 8228
126 Ga0495591_013381 3300046458 Bacteria 3005
127 Ga0495638_0000196 3300046460 Bacteria 87444
128 Ga0495638_0013281 3300046460 Bacteria 5615
129 Ga0495638_0019248 3300046460 Bacteria 4518
130 Ga0495638_0034074 3300046460 Bacteria 3252
131 Ga0495641_0005891 3300046461 Eukaryota 8093
132 Ga0495651_0038556 3300046462 Eukaryota 3721
133 Ga0495650_0001229 3300046471 Bacteria 26770
134 Ga0495650_0002683 3300046471 Bacteria 13830
135 Ga0495650_0004914 3300046471 Bacteria 8931
136 Ga0495650_0022889 3300046471 Bacteria 2986
137 Ga0495650_0029366 3300046471 Bacteria 2507
138 Ga0495650_0029484 3300046471 Bacteria 2500
139 Ga0495582_0001454 3300046473 Bacteria 13385
140 Ga0495605_0000020 3300046474 Bacteria 254765
141 Ga0495605_0000125 3300046474 Bacteria 101414
142 Ga0495605_0000149 3300046474 Bacteria 90748
143 Ga0495605_0000155 3300046474 Bacteria 88662
144 Ga0495605_0001682 3300046474 Bacteria 14199
145 Ga0495605_0002413 3300046474 Bacteria 11549
146 Ga0495605_0020608 3300046474 Bacteria 3502
147 Ga0495605_0022927 3300046474 Bacteria 3289
148 Ga0495605_0024418 3300046474 Bacteria 3163
149 Ga0495605_0027556 3300046474 Bacteria 2943
150 Ga0495639_0000001 3300046475 Bacteria 204442
151 Ga0495639_0059429 3300046475 Bacteria 1750
152 Ga0495662_0017415 3300046476 Bacteria 3478
153 Ga0495584_0000023 3300046491 Bacteria 123079
154 Ga0495584_0000038 3300046491 Bacteria 93590
155 Ga0495584_0000652 3300046491 Bacteria 23158
156 Ga0495584_0001449 3300046491 Bacteria 14285
157 Ga0495584_0004441 3300046491 Bacteria 7546
158 Ga0495584_0007149 3300046491 Bacteria 5832
159 Ga0495584_0017914 3300046491 Bacteria 3602
160 Ga0495584_0040599 3300046491 Bacteria 2349
161 Ga0495585_0006924 3300046492 Bacteria 6987
162 Ga0495585_0057751 3300046492 Bacteria 2141
163 Ga0495585_0059067 3300046492 Bacteria 2114
164 Ga0495594_0000599 3300046499 Bacteria 18568
165 Ga0495594_0000712 3300046499 Bacteria 17131
166 Ga0495594_0041274 3300046499 Bacteria 2526
167 Ga0495594_0049220 3300046499 Bacteria 2316
168 Ga0495596_0000014 3300046500 Bacteria 121944
169 Ga0495607_0000028 3300046501 Bacteria 155637
170 Ga0495607_0000222 3300046501 Bacteria 60428
171 Ga0495607_0000444 3300046501 Bacteria 41557
172 Ga0495607_0005014 3300046501 Bacteria 9605
173 Ga0495607_0006465 3300046501 Bacteria 8246
174 Ga0495607_0020336 3300046501 Bacteria 4198
175 Ga0495607_0022179 3300046501 Bacteria 3992
176 Ga0495607_0025309 3300046501 Bacteria 3692
177 Ga0495607_0030403 3300046501 Bacteria 3316
178 Ga0495607_0051287 3300046501 Bacteria 2397
179 Ga0495583_0000112 3300046506 Bacteria 138078
180 Ga0495583_0000196 3300046506 Bacteria 101268
181 Ga0495583_0001312 3300046506 Bacteria 25860
182 Ga0495583_0001496 3300046506 Bacteria 23334
183 Ga0495583_0001859 3300046506 Bacteria 19648
184 Ga0495583_0004167 3300046506 Bacteria 10536
185 Ga0495583_0004961 3300046506 Bacteria 9236
186 Ga0495583_0007620 3300046506 Bacteria 6757
187 Ga0495583_0035003 3300046506 Bacteria 2401
188 Ga0495583_0043646 3300046506 Bacteria 2086
189 Ga0495606_0000812 3300046507 Bacteria 47489
190 Ga0495606_0001612 3300046507 Bacteria 29428
191 Ga0495606_0002913 3300046507 Bacteria 18889
192 Ga0495606_0018012 3300046507 Bacteria 5312
193 Ga0495608_0038263 3300046511 Eukaryota 3223
194 Ga0495610_0014127 3300046512 Bacteria 4709
195 Ga0495610_0022503 3300046512 Bacteria 3446
196 Ga0495616_0013836 3300046513 Bacteria 4536
197 Ga0495618_0017243 3300046514 Eukaryota 4425
198 Ga0495620_0000055 3300046515 Bacteria 99544
199 Ga0495620_0000426 3300046515 Bacteria 28068
200 Ga0495620_0000914 3300046515 Bacteria 18126
201 Ga0495620_0004084 3300046515 Eukaryota 8276
202 Ga0495620_0008342 3300046515 Bacteria 5567
203 Ga0495620_0031100 3300046515 Bacteria 2449
204 Ga0495628_0010907 3300046516 Eukaryota 7694
205 Ga0495630_0026903 3300046517 Bacteria 4262
206 Ga0495630_0060046 3300046517 Bacteria 2853
207 Ga0495631_0000005 3300046518 Bacteria 159179
208 Ga0495631_0001443 3300046518 Bacteria 14437
209 Ga0495631_0017658 3300046518 Bacteria 3370
210 Ga0495632_0000058 3300046519 Bacteria 122648
211 Ga0495632_0000064 3300046519 Bacteria 117674
212 Ga0495632_0001013 3300046519 Bacteria 24362
213 Ga0495632_0001744 3300046519 Bacteria 17632
214 Ga0495632_0001944 3300046519 Bacteria 16500
215 Ga0495632_0002826 3300046519 Bacteria 12843
216 Ga0495637_0000204 3300046520 Bacteria 46396
217 Ga0495637_0000844 3300046520 Bacteria 20216
218 Ga0495637_0001432 3300046520 Bacteria 14062
219 Ga0495637_0001736 3300046520 Bacteria 12510
220 Ga0495637_0002702 3300046520 Bacteria 9673
221 Ga0495637_0018600 3300046520 Bacteria 3221
222 Ga0495637_0028138 3300046520 Bacteria 2511
223 Ga0495637_0037210 3300046520 Bacteria 2114
224 Ga0495643_0007840 3300046522 Bacteria 6824
225 Ga0495643_0010419 3300046522 Bacteria 5723
226 Ga0495644_0000033 3300046523 Bacteria 65303
227 Ga0495648_0000392 3300046524 Bacteria 47998
228 Ga0495648_0004015 3300046524 Bacteria 12713
229 Ga0495648_0005599 3300046524 Bacteria 10417
230 Ga0495648_0023152 3300046524 Bacteria 4261
231 Ga0495648_0025133 3300046524 Bacteria 4037
232 Ga0495642_0000003 3300046528 Bacteria 185425
233 Ga0495642_0000507 3300046528 Bacteria 20108
234 Ga0495642_0000689 3300046528 Bacteria 16770
235 Ga0495652_0000137 3300046529 Eukaryota 82110
236 Ga0495654_0000230 3300046530 Bacteria 52176
237 Ga0495654_0004922 3300046530 Bacteria 7858
238 Ga0495654_0023038 3300046530 Bacteria 3227
239 Ga0495586_0006697 3300046535 Bacteria 6153
240 Ga0495587_0008812 3300046536 Bacteria 6474
241 Ga0495609_0000141 3300046538 Bacteria 75953
242 Ga0495609_0000412 3300046538 Bacteria 35828
243 Ga0495609_0000457 3300046538 Bacteria 33276
244 Ga0495609_0000802 3300046538 Bacteria 23493
245 Ga0495609_0002893 3300046538 Bacteria 10237
246 Ga0495609_0045571 3300046538 Bacteria 1965
247 Ga0495597_0001350 3300046542 Bacteria 17809
248 Ga0495597_0003145 3300046542 Bacteria 9885
249 Ga0495597_0017204 3300046542 Bacteria 3406
250 Ga0495597_0029775 3300046542 Bacteria 2491
251 Ga0495622_0000822 3300046557 Bacteria 17210
252 Ga0495633_0000134 3300046558 Bacteria 98658
253 Ga0495656_0005230 3300046615 Bacteria 4470
254 Ga0495656_0017166 3300046615 Bacteria 2758
255 Ga0495668_0003802 3300046616 Bacteria 11063
256 Ga0495634_0043461 3300046642 Bacteria 3045
257 Ga0495611_0000518 3300046648 Bacteria 22917
258 Ga0495611_0001167 3300046648 Bacteria 13700
259 Ga0495611_0010194 3300046648 Bacteria 3976
260 Ga0495611_0010402 3300046648 Bacteria 3937
261 Ga0495625_0000145 3300046660 Bacteria 108480
262 Ga0495625_0002980 3300046660 Bacteria 17561
263 Ga0495625_0016094 3300046660 Bacteria 5893
264 Ga0495625_0048830 3300046660 Bacteria 3045
265 Ga0495625_0071084 3300046660 Bacteria 2442
266 Ga0495635_0001673 3300046663 Bacteria 14917
267 Ga0495659_0000002 3300046664 Bacteria 176698
268 Ga0495659_0001085 3300046664 Bacteria 9476
269 Ga0495659_0018796 3300046664 Bacteria 2306
270 Ga0495661_0000332 3300046665 Bacteria 51357
271 Ga0495661_0000434 3300046665 Bacteria 44139
272 Ga0495661_0001483 3300046665 Bacteria 19584
273 Ga0495661_0018629 3300046665 Bacteria 4560
274 Ga0495661_0034925 3300046665 Bacteria 3159
275 Ga0495661_0035322 3300046665 Bacteria 3137
276 Ga0495588_0008974 3300046674 Bacteria 4604
277 Ga0495623_0002926 3300046679 Bacteria 11229
278 Ga0495646_0000481 3300046680 Bacteria 21225
279 Ga0495669_0010122 3300046684 Bacteria 3982
280 Ga0495669_0035555 3300046684 Bacteria 2199
281 Ga0495670_0000120 3300046691 Bacteria 34491
282 Ga0495670_0001482 3300046691 Bacteria 11457
283 Ga0495670_0009018 3300046691 Bacteria 4907
284 Ga0495671_0000095 3300046692 Bacteria 82836
285 Ga0495671_0003621 3300046692 Bacteria 9418
286 Ga0495671_0019010 3300046692 Bacteria 3637
287 Ga0495649_0000023 3300046694 Bacteria 178544
288 Ga0495649_0003409 3300046694 Bacteria 10742
289 Ga0495649_0006511 3300046694 Bacteria 7266
290 Ga0495649_0018661 3300046694 Bacteria 3899
291 Ga0495589_0000064 3300046794 Bacteria 101999
292 Ga0495589_0000771 3300046794 Bacteria 20448
293 Ga0495589_0012306 3300046794 Bacteria 4433
294 Ga0495660_0000724 3300046810 Bacteria 25215
295 Ga0495660_0005016 3300046810 Bacteria 7964
296 Ga0495660_0005276 3300046810 Bacteria 7746
297 Ga0495660_0007715 3300046810 Bacteria 6322
298 Ga0495660_0022470 3300046810 Bacteria 3602
299 Ga0495604_0001437 3300047317 Bacteria 19546
300 Ga0495604_0014416 3300047317 Bacteria 6305
301 Ga0495604_0060120 3300047317 Bacteria 2911
302 Ga0495636_0011785 3300047318 Bacteria 3463
303 Ga0495672_0000077 3300047320 Bacteria 165019
304 Ga0495672_0000239 3300047320 Bacteria 77885
305 Ga0495672_0000261 3300047320 Bacteria 73207
306 Ga0495672_0005826 3300047320 Bacteria 9668
307 Ga0495672_0012301 3300047320 Bacteria 5980
308 Ga0495672_0013193 3300047320 Bacteria 5712
309 Ga0495672_0013408 3300047320 Bacteria 5656
310 Ga0495672_0018291 3300047320 Bacteria 4658
311 Ga0495672_0022489 3300047320 Bacteria 4096
312 Ga0495672_0060943 3300047320 Bacteria 2176
313 Ga0495672_0062097 3300047320 Bacteria 2150
314 Ga0495676_0000198 3300047321 Bacteria 47538
315 Ga0495680_0001302 3300047322 Bacteria 27175
316 Ga0495680_0009213 3300047322 Bacteria 8900
317 Ga0495680_0047518 3300047322 Eukaryota 3376
318 Ga0495683_0000010 3300047323 Bacteria 223494
319 Ga0495683_0000095 3300047323 Bacteria 89824
320 Ga0495683_0001569 3300047323 Bacteria 14794
321 Ga0495683_0004097 3300047323 Bacteria 8344
322 Ga0495687_003935 3300047443 Bacteria 10400
323 Ga0495687_004121 3300047443 Bacteria 10031
324 Ga0495687_032013 3300047443 Bacteria 2406
325 Ga0495675_0001551 3300047444 Bacteria 13877
326 Ga0495677_0001539 3300047445 Bacteria 9282
327 Ga0495679_000511 3300047446 Bacteria 27627
328 Ga0495679_001029 3300047446 Bacteria 17123
329 Ga0495679_009772 3300047446 Bacteria 3813
330 Ga0495679_011181 3300047446 Bacteria 3480
331 Ga0495679_017660 3300047446 Bacteria 2549
332 Ga0495673_0000242 3300047469 Bacteria 77375
333 Ga0495673_0000309 3300047469 Bacteria 64463
334 Ga0495673_0000407 3300047469 Bacteria 50254
335 Ga0495673_0000979 3300047469 Bacteria 25628
336 Ga0495673_0003142 3300047469 Bacteria 11058
337 Ga0495673_0005694 3300047469 Bacteria 7486
338 Ga0495673_0006796 3300047469 Bacteria 6680
339 Ga0495673_0006989 3300047469 Bacteria 6558
340 Ga0495673_0014837 3300047469 Bacteria 4037
341 Ga0495673_0027681 3300047469 Bacteria 2693
342 Ga0495673_0040821 3300047469 Bacteria 2092
343 Ga0495681_0000134 3300047470 Bacteria 63782
344 Ga0495681_0004407 3300047470 Bacteria 9612
345 Ga0495681_0004485 3300047470 Bacteria 9529
346 Ga0495681_0006296 3300047470 Bacteria 7821
347 Ga0495681_0019683 3300047470 Bacteria 3676
348 Ga0495681_0024226 3300047470 Bacteria 3203
349 Ga0495681_0030645 3300047470 Bacteria 2735
350 Ga0495686_0008943 3300047472 Bacteria 7278
351 Ga0495686_0056648 3300047472 Bacteria 2448
352 Ga0495686_0091447 3300047472 Bacteria 1847
353 Ga0495593_0005954 3300047673 Bacteria 7185
354 Ga0495593_0013428 3300047673 Bacteria 4672
355 Ga0495593_0043881 3300047673 Eukaryota 2394
356 Ga0495602_0000979 3300048088 Eukaryota 27687
357 Ga0495602_0038970 3300048088 Eukaryota 4383
358 Ga0495626_0000031 3300048091 Bacteria 197930
359 Ga0495626_0000032 3300048091 Bacteria 184235
360 Ga0495626_0000372 3300048091 Bacteria 46880
361 Ga0495626_0000801 3300048091 Bacteria 28424
362 Ga0495626_0013444 3300048091 Bacteria 4253
363 Ga0496112_0123439 3300048915 Bacteria 2561
364 Ga0496113_0121361 3300048916 Bacteria 2044
365 Ga0496116_0000231 3300048919 Bacteria 103493
366 Ga0496117_0043056 3300048920 Bacteria 3288
367 Ga0496118_0025642 3300048921 Bacteria 5047
368 Ga0496118_0037522 3300048921 Bacteria 3898
369 Ga0496118_0087995 3300048921 Bacteria 2151
370 Ga0496121_0003161 3300048924 Bacteria 23741
371 Ga0496121_0003745 3300048924 Bacteria 21302
372 Ga0496121_0059789 3300048924 Bacteria 3140
373 Ga0496121_0072776 3300048924 Bacteria 2758
374 Ga0496122_0000214 3300048925 Bacteria 129132
375 Ga0496122_0002278 3300048925 Bacteria 27773
376 Ga0496122_0006850 3300048925 Bacteria 12911
377 Ga0496122_0007575 3300048925 Bacteria 12009
378 Ga0496123_0000289 3300048926 Bacteria 98253
379 Ga0496123_0001853 3300048926 Bacteria 27743
380 Ga0496123_0009399 3300048926 Bacteria 8807
381 Ga0496123_0010150 3300048926 Bacteria 8364
382 Ga0496124_0001189 3300048927 Bacteria 40565
383 Ga0496124_0001964 3300048927 Bacteria 28105
384 Ga0496124_0005797 3300048927 Bacteria 13737
385 Ga0496124_0073175 3300048927 Bacteria 2836
386 Ga0496124_0098757 3300048927 Bacteria 2368
387 Ga0496125_0011582 3300048928 Bacteria 8811
388 Ga0496125_0029072 3300048928 Bacteria 4975
389 Ga0495678_000108 3300049459 Bacteria 99839
390 Ga0495678_000840 3300049459 Bacteria 27428
391 Ga0495678_001381 3300049459 Bacteria 19350
392 Ga0495678_004010 3300049459 Bacteria 8782
393 Ga0495678_009832 3300049459 Bacteria 4695
394 Ga0495678_031107 3300049459 Bacteria 2228
395 Ga0495682_0000326 3300049460 Bacteria 35389
396 Ga0495682_0000455 3300049460 Bacteria 28192
397 Ga0495682_0014370 3300049460 Bacteria 3004
398 Ga0495682_0025394 3300049460 Bacteria 2205
399 Ga0501034_0060106 3300049571 Bacteria 3818
400 Ga0501038_0029108 3300049574 Bacteria 4899
401 Ga0501043_0053937 3300049579 Bacteria 3157
402 Ga0501047_0002640 3300049581 Bacteria 17062
403 Ga0501068_0005097 3300049584 Bacteria 7159
404 Ga0501070_0015384 3300049586 Bacteria 6437
405 Ga0501073_0027131 3300049589 Bacteria 4099
406 Ga0501073_0031934 3300049589 Bacteria 3756
407 Ga0501222_002771 3300049662 Bacteria 2428
408 Ga0501080_0010864 3300049742 Bacteria 8333
409 Ga0501226_000008 3300049853 Bacteria 199119
410 nmdc:mga0yw44_211_c1 3300050492 Bacteria 20687
411 nmdc:mga0n895_14008_c1 3300050512 Bacteria 7263
412 Ga0500651_0007994 3300053093 Bacteria 6191
413 Ga0500641_0012398 3300053096 Bacteria 3112
414 Ga0500555_024792 3300053103 Bacteria 1717
415 Ga0500559_0011963 3300053136 Bacteria 3698
416 Ga0500588_0000242 3300053146 Bacteria 7828
417 Ga0500590_000579 3300053148 Bacteria 12902
418 Ga0500600_0000098 3300053149 Eukaryota 27444
419 Ga0500604_0015076 3300053151 Bacteria 2111
420 Ga0500636_0020156 3300053177 Bacteria 3946
421 Ga0501082_0009208 3300060353 Bacteria 8510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_211_c1 nmdc:mga0yw44_211_c1_13391_14824 474
2 iso_pu_bacteria 2913295892 2913298908 496
3 3300047673 Ga0495593_0043881 Ga0495593_0043881_805_2343 504
4 3300046517 Ga0495630_0060046 Ga0495630_0060046_17_1540 507
5 3300049460 Ga0495682_0025394 Ga0495682_0025394_11_1534 507
6 3300046471 Ga0495650_0029366 Ga0495650_0029366_37_1611 517
7 3300042009 Ga0439451_013682 Ga0439451_013682_15_1574 519
8 3300042145 Ga0450906_008907 Ga0450906_008907_326_1885 519
9 3300046520 Ga0495637_0028138 Ga0495637_0028138_23_1582 519
10 3300047472 Ga0495686_0091447 Ga0495686_0091447_44_1603 519
11 3300041407 Ga0439447_022203 Ga0439447_022203_11_1618 535
12 iso_pu_bacteria 2511231021 2511356774 537
13 iso_pu_bacteria 8016728285 8016732037 537
14 3300053103 Ga0500555_024792 Ga0500555_024792_22_1656 542
15 3300048927 Ga0496124_0098757 Ga0496124_0098757_36_1709 544
16 3300022739 Ga0228711_1000005 Ga0228711_1000005147 545
17 3300022740 Ga0228710_1000141 Ga0228710_10001417 545
18 3300027111 Ga0209281_1000111 Ga0209281_1000111147 545
19 3300027666 Ga0209282_1000012 Ga0209282_1000012147 545
20 3300031967 Ga0315914_1000007 Ga0315914_100000767 545
21 3300033430 Ga0315913_1000003 Ga0315913_1000003147 545
22 3300033464 Ga0315915_1000011 Ga0315915_100001167 545
23 3300009093 Ga0105240_10132010 Ga0105240_101320102 547
24 iso_pu_bacteria 2510461069 2510839634 550
25 iso_pu_bacteria 2643221653 2644296775 552
26 iso_pu_bacteria 2643221719 2644655029 552
27 iso_pu_bacteria 2844533157 2844533559 552
28 iso_pu_bacteria 2989776772 2989778242 552
29 iso_pu_bacteria 2818991272 2819242483 553
30 3300003187 JGI25151J46595_10000124 JGI25151J46595_1000012453 559
31 3300025284 Ga0209130_1000270 Ga0209130_100027041 559
32 3300025294 Ga0209025_1000705 Ga0209025_10007054 559
33 3300025297 Ga0209758_1004138 Ga0209758_10041381 559
34 3300025302 Ga0207426_1000370 Ga0207426_100037014 559
35 iso_pu_bacteria 8005246636 8005251259 559
36 3300053136 Ga0500559_0011963 Ga0500559_0011963_688_2430 561
37 iso_pu_bacteria 2510461076 2510894639 562
38 iso_pu_bacteria 2513237084 2513572331 562
39 iso_pu_bacteria 2513237162 2514021588 562
40 iso_pu_bacteria 2515154113 2515637218 562
41 iso_pu_bacteria 2515154114 2515639733 562
42 iso_pu_bacteria 2515154116 2515657377 562
43 iso_pu_bacteria 2517093000 2517095114 562
44 iso_pu_bacteria 2765235942 2766063128 562
45 iso_pu_bacteria 2842110456 2842110541 562
46 iso_pu_bacteria 2857516855 2857518674 562
47 iso_pu_bacteria 2933586486 2933586570 562
48 iso_pu_bacteria 2936367885 2936372763 562
49 iso_pu_bacteria 2936375103 2936376636 562
50 iso_pu_bacteria 8005376324 8005379154 562
51 iso_pu_bacteria 8005556819 8005557763 562
52 iso_pu_bacteria 8005563573 8005568936 562
53 iso_pu_bacteria 8018163183 8018166849 562
54 3300046476 Ga0495662_0017415 Ga0495662_0017415_635_2392 563
55 3300047317 Ga0495604_0014416 Ga0495604_0014416_2096_3853 563
56 3300053148 Ga0500590_000579 Ga0500590_000579_5659_7416 563
57 3300053177 Ga0500636_0020156 Ga0500636_0020156_1180_2937 563
58 3300053146 Ga0500588_0000242 Ga0500588_0000242_921_2624 564
59 iso_pu_bacteria 2510065053 2510285429 564
60 iso_pu_bacteria 2510065055 2510295928 564
61 iso_pu_bacteria 2510065058 2510313557 564
62 iso_pu_bacteria 2773857672 2774132445 564
63 iso_pu_bacteria 2917832318 2917833952 564
64 iso_pu_bacteria 2974298342 2974302860 564
65 iso_pu_bacteria 2984499530 2984499556 564
66 3300049742 Ga0501080_0010864 Ga0501080_0010864_6432_8138 565
67 3300053151 Ga0500604_0015076 Ga0500604_0015076_90_1796 565
68 iso_pu_bacteria 2844665904 2844671170 565
69 iso_pu_bacteria 2919125081 2919129964 565
70 iso_pu_bacteria 2984504281 2984505997 565
71 3300028794 Ga0307515_10033455 Ga0307515_100334552 566
72 3300041502 Ga0451846_07817 Ga0451846_07817_36_1778 566
73 iso_pu_bacteria 2513237166 2514050499 566
74 3300009011 Ga0105251_10002447 Ga0105251_1000244715 567
75 3300009036 Ga0105244_10014051 Ga0105244_100140513 567
76 3300013102 Ga0157371_10002965 Ga0157371_1000296517 567
77 3300013105 Ga0157369_10011869 Ga0157369_100118698 567
78 3300025735 Ga0207713_1020055 Ga0207713_10200551 567
79 3300027907 Ga0207428_10005093 Ga0207428_100050932 567
80 3300035695 Ga0373927_0000147 Ga0373927_0000147_26146_27876 567
81 3300037068 Ga0373925_0011078 Ga0373925_0011078_753_2483 567
82 iso_pu_bacteria 2508501122 2509111172 567
83 iso_pu_bacteria 2512047086 2512531401 567
84 iso_pu_bacteria 2775506901 2776259402 567
85 iso_pu_bacteria 2838074704 2838079907 567
86 iso_pu_bacteria 2842922631 2842927385 567
87 iso_pu_bacteria 2894232714 2894240822 567
88 3300048925 Ga0496122_0000214 Ga0496122_0000214_58182_59975 568
89 3300048926 Ga0496123_0000289 Ga0496123_0000289_38279_40072 568
90 iso_pu_bacteria 2738541317 2738945257 568
91 iso_pu_bacteria 2842304105 2842307207 568
92 iso_pu_bacteria 2913308742 2913309959 568
93 iso_pu_bacteria 2933570622 2933572680 568
94 3300003215 JGI25153J46596_10000047 JGI25153J46596_100000475 569
95 3300006038 Ga0075365_10000563 Ga0075365_100005638 569
96 3300014326 Ga0157380_10073380 Ga0157380_100733803 569
97 3300025297 Ga0209758_1000070 Ga0209758_10000706 569
98 3300031852 Ga0307410_10041742 Ga0307410_100417421 569
99 3300031901 Ga0307406_10050272 Ga0307406_100502721 569
100 3300032126 Ga0307415_100041845 Ga0307415_1000418452 569
101 3300049571 Ga0501034_0060106 Ga0501034_0060106_1623_3386 569
102 3300049574 Ga0501038_0029108 Ga0501038_0029108_105_1868 569
103 3300049581 Ga0501047_0002640 Ga0501047_0002640_14641_16404 569
104 3300049584 Ga0501068_0005097 Ga0501068_0005097_5278_7041 569
105 3300049589 Ga0501073_0031934 Ga0501073_0031934_287_2050 569
106 3300060353 Ga0501082_0009208 Ga0501082_0009208_6315_8078 569
107 3300046474 Ga0495605_0020608 Ga0495605_0020608_1296_3008 570
108 3300047469 Ga0495673_0040821 Ga0495673_0040821_21_1733 570
109 3300025297 Ga0209758_1023043 Ga0209758_10230432 571
110 3300046475 Ga0495639_0059429 Ga0495639_0059429_19_1734 571
111 3300046501 Ga0495607_0000444 Ga0495607_0000444_30053_31768 571
112 3300046515 Ga0495620_0000426 Ga0495620_0000426_13650_15365 571
113 3300049460 Ga0495682_0000455 Ga0495682_0000455_21506_23221 571
114 3300053096 Ga0500641_0012398 Ga0500641_0012398_141_1865 571
115 3300046452 Ga0495617_004610 Ga0495617_004610_1333_3111 572
116 3300046684 Ga0495669_0035555 Ga0495669_0035555_149_1927 572
117 3300047322 Ga0495680_0009213 Ga0495680_0009213_1127_2845 572
118 3300049589 Ga0501073_0027131 Ga0501073_0027131_2098_3837 573
119 3300053093 Ga0500651_0007994 Ga0500651_0007994_3923_5689 573
120 3300028379 Ga0268266_10034106 Ga0268266_100341065 574
121 3300046691 Ga0495670_0000120 Ga0495670_0000120_31330_33117 574
122 3300046810 Ga0495660_0005016 Ga0495660_0005016_4790_6577 574
123 3300053149 Ga0500600_0000098 Ga0500600_0000098_6242_8017 574
124 3300005937 Ga0081455_10016351 Ga0081455_100163514 575
125 3300049579 Ga0501043_0053937 Ga0501043_0053937_762_2510 575
126 3300049586 Ga0501070_0015384 Ga0501070_0015384_77_1825 575
127 3300005985 Ga0081539_10000699 Ga0081539_1000069937 576
128 3300046460 Ga0495638_0013281 Ga0495638_0013281_2295_4079 576
129 3300046461 Ga0495641_0005891 Ga0495641_0005891_3741_5504 576
130 3300046462 Ga0495651_0038556 Ga0495651_0038556_1099_2862 576
131 3300046501 Ga0495607_0000222 Ga0495607_0000222_27515_29302 576
132 3300046511 Ga0495608_0038263 Ga0495608_0038263_335_2098 576
133 3300046514 Ga0495618_0017243 Ga0495618_0017243_1257_3020 576
134 3300046515 Ga0495620_0004084 Ga0495620_0004084_5780_7543 576
135 3300046516 Ga0495628_0010907 Ga0495628_0010907_4460_6223 576
136 3300046529 Ga0495652_0000137 Ga0495652_0000137_39982_41745 576
137 3300047322 Ga0495680_0047518 Ga0495680_0047518_53_1816 576
138 3300048088 Ga0495602_0000979 Ga0495602_0000979_4531_6294 576
139 3300048088 Ga0495602_0038970 Ga0495602_0038970_954_2717 576
140 3300050512 nmdc:mga0n895_14008_c1 nmdc:mga0n895_14008_c1_82_1911 576
141 iso_pu_bacteria 2606217733 2608380223 576
142 3300047472 Ga0495686_0008943 Ga0495686_0008943_1756_3501 577
143 3300048924 Ga0496121_0072776 Ga0496121_0072776_423_2234 577
144 3300025254 Ga0209148_1000875 Ga0209148_100087513 578
145 3300025272 Ga0209455_1001068 Ga0209455_10010683 578
146 3300046474 Ga0495605_0024418 Ga0495605_0024418_980_2749 578
147 3300041405 Ga0439438_001389 Ga0439438_001389_1499_3238 579
148 3300047469 Ga0495673_0000979 Ga0495673_0000979_18682_20421 579
149 3300041407 Ga0439447_000846 Ga0439447_000846_648_2396 580
150 3300042006 Ga0439432_000404 Ga0439432_000404_2484_4232 580
151 3300042010 Ga0439452_004851 Ga0439452_004851_1347_3095 580
152 3300042156 Ga0439446_0001677 Ga0439446_0001677_1953_3701 580
153 3300042435 Ga0439434_0002723 Ga0439434_0002723_2961_4709 580
154 3300047469 Ga0495673_0000407 Ga0495673_0000407_1270_3048 580
155 3300009011 Ga0105251_10000092 Ga0105251_1000009220 581
156 3300025735 Ga0207713_1000074 Ga0207713_100007473 581
157 3300047673 Ga0495593_0005954 Ga0495593_0005954_4479_6224 581
158 iso_pu_bacteria 3007419365 3007422345 581
159 iso_pu_bacteria 8011350971 8011355822 581
160 3300046501 Ga0495607_0020336 Ga0495607_0020336_1058_2809 582
161 3300046501 Ga0495607_0051287 Ga0495607_0051287_393_2159 583
162 3300046538 Ga0495609_0000457 Ga0495609_0000457_10945_12711 583
163 iso_pu_bacteria 2808606373 2808906042 583
164 3300009036 Ga0105244_10003182 Ga0105244_100031826 584
165 3300025728 Ga0207655_1000006 Ga0207655_1000006304 584
166 3300047320 Ga0495672_0000261 Ga0495672_0000261_9121_10899 584
167 iso_pu_bacteria 2791355520 2794594816 584
168 3300009011 Ga0105251_10017825 Ga0105251_100178254 585
169 3300015262 Ga0182007_10017641 Ga0182007_100176412 585
170 3300046453 Ga0495627_002598 Ga0495627_002598_1566_3323 585
171 3300046458 Ga0495591_013381 Ga0495591_013381_790_2547 585
172 3300046474 Ga0495605_0000125 Ga0495605_0000125_80366_82123 585
173 3300046499 Ga0495594_0000599 Ga0495594_0000599_15798_17555 585
174 3300046506 Ga0495583_0000196 Ga0495583_0000196_80300_82057 585
175 3300046515 Ga0495620_0000055 Ga0495620_0000055_19126_20883 585
176 3300046518 Ga0495631_0001443 Ga0495631_0001443_6805_8562 585
177 3300046538 Ga0495609_0000412 Ga0495609_0000412_14799_16556 585
178 3300046542 Ga0495597_0017204 Ga0495597_0017204_257_2014 585
179 3300046558 Ga0495633_0000134 Ga0495633_0000134_78761_80518 585
180 3300046648 Ga0495611_0001167 Ga0495611_0001167_11773_13530 585
181 3300046665 Ga0495661_0000434 Ga0495661_0000434_19256_21013 585
182 3300046692 Ga0495671_0019010 Ga0495671_0019010_730_2487 585
183 3300046794 Ga0495589_0000771 Ga0495589_0000771_17374_19131 585
184 3300046810 Ga0495660_0005276 Ga0495660_0005276_5241_6998 585
185 3300047323 Ga0495683_0000095 Ga0495683_0000095_18694_20451 585
186 3300047446 Ga0495679_000511 Ga0495679_000511_1460_3217 585
187 3300047469 Ga0495673_0005694 Ga0495673_0005694_1592_3349 585
188 3300047470 Ga0495681_0004407 Ga0495681_0004407_267_2024 585
189 3300048926 Ga0496123_0009399 Ga0496123_0009399_5530_7287 585
190 3300049459 Ga0495678_000108 Ga0495678_000108_19284_21041 585
191 iso_pu_bacteria 2599185302 2599943410 585
192 iso_pu_bacteria 2599185304 2599954521 585
193 iso_pu_bacteria 2599185307 2599974914 585
194 iso_pu_bacteria 2599185309 2599983834 585
195 iso_pu_bacteria 2599185310 2599988660 585
196 iso_pu_bacteria 2599185312 2600001436 585
197 iso_pu_bacteria 2599185320 2600048639 585
198 3300042146 Ga0450907_001617 Ga0450907_001617_1649_3409 586
199 3300046524 Ga0495648_0000392 Ga0495648_0000392_44908_46668 586
200 iso_pu_bacteria 2511231008 2511275208 586
201 iso_pu_bacteria 2738541271 2738689211 586
202 iso_pu_bacteria 2738543016 2739264598 586
203 3300042115 Ga0450911_000054 Ga0450911_000054_10371_12143 587
204 3300042139 Ga0450904_000204 Ga0450904_000204_9721_11493 587
205 iso_pu_bacteria 2599185212 2599611977 587
206 iso_pu_bacteria 2599185248 2599773140 587
207 iso_pu_bacteria 2599185289 2599884913 587
208 iso_pu_bacteria 2599185291 2599899638 587
209 iso_pu_bacteria 2599185305 2599960729 587
210 iso_pu_bacteria 2599185306 2599968568 587
211 iso_pu_bacteria 2599185308 2599976467 587
212 iso_pu_bacteria 2599185311 2599992533 587
213 iso_pu_bacteria 2599185313 2600007549 587
214 iso_pu_bacteria 2599185314 2600010789 587
215 iso_pu_bacteria 2599185315 2600018223 587
216 iso_pu_bacteria 2599185318 2600033804 587
217 iso_pu_bacteria 2599185319 2600040987 587
218 iso_pu_bacteria 2599185321 2600052743 587
219 iso_pu_bacteria 2599185322 2600058829 587
220 iso_pu_bacteria 2599185323 2600067334 587
221 iso_pu_bacteria 2599185324 2600070663 587
222 iso_pu_bacteria 2667528170 2671092788 587
223 iso_pu_bacteria 2808606379 2808943409 587
224 iso_pu_bacteria 2913036834 2913039641 587
225 iso_pu_bacteria 2919456309 2919461194 587
226 3300042006 Ga0439432_019423 Ga0439432_019423_322_2088 588
227 3300042010 Ga0439452_002263 Ga0439452_002263_1625_3391 588
228 3300042138 Ga0450903_004275 Ga0450903_004275_431_2197 588
229 3300042461 Ga0439460_0000299 Ga0439460_0000299_1193_2959 588
230 3300046474 Ga0495605_0000149 Ga0495605_0000149_1607_3373 588
231 3300046491 Ga0495584_0007149 Ga0495584_0007149_3671_5437 588
232 3300046506 Ga0495583_0001859 Ga0495583_0001859_357_2123 588
233 3300046506 Ga0495583_0004167 Ga0495583_0004167_1339_3105 588
234 3300046515 Ga0495620_0031100 Ga0495620_0031100_362_2128 588
235 3300046660 Ga0495625_0071084 Ga0495625_0071084_231_1997 588
236 3300046674 Ga0495588_0008974 Ga0495588_0008974_1583_3349 588
237 3300046694 Ga0495649_0006511 Ga0495649_0006511_390_2156 588
238 3300047323 Ga0495683_0001569 Ga0495683_0001569_1621_3387 588
239 3300047469 Ga0495673_0006989 Ga0495673_0006989_305_2071 588
240 3300047470 Ga0495681_0030645 Ga0495681_0030645_520_2286 588
241 3300047472 Ga0495686_0056648 Ga0495686_0056648_264_2030 588
242 3300049853 Ga0501226_000008 Ga0501226_000008_166905_168680 588
243 iso_pu_bacteria 2511231004 2511256664 588
244 iso_pu_bacteria 2511231007 2511270419 588
245 iso_pu_bacteria 2511231015 2511320056 588
246 iso_pu_bacteria 2511231016 2511324853 588
247 iso_pu_bacteria 2511231017 2511332448 588
248 iso_pu_bacteria 2511231018 2511336068 588
249 iso_pu_bacteria 2511231019 2511346196 588
250 iso_pu_bacteria 2511231022 2511362990 588
251 iso_pu_bacteria 2511231156 2511825709 588
252 iso_pu_bacteria 2599185188 2599502283 588
253 iso_pu_bacteria 2599185300 2599932654 588
254 iso_pu_bacteria 2599185316 2600023232 588
255 iso_pu_bacteria 2599185317 2600030900 588
256 iso_pu_bacteria 2599185325 2600076980 588
257 iso_pu_bacteria 2600254930 2600360704 588
258 iso_pu_bacteria 2623620446 2624491184 588
259 iso_pu_bacteria 2643221589 2643954405 588
260 iso_pu_bacteria 2643221602 2644023214 588
261 iso_pu_bacteria 2643221633 2644189448 588
262 iso_pu_bacteria 2643221650 2644286424 588
263 iso_pu_bacteria 2651869719 2652545494 588
264 iso_pu_bacteria 2667528176 2671125099 588
265 iso_pu_bacteria 2675903515 2678262108 588
266 iso_pu_bacteria 2738543015 2739257279 588
267 iso_pu_bacteria 2744054620 2745008456 588
268 iso_pu_bacteria 2773857670 2774118730 588
269 iso_pu_bacteria 2784132072 2784312367 588
270 iso_pu_bacteria 2808606361 2808856307 588
271 iso_pu_bacteria 2808606376 2808924673 588
272 iso_pu_bacteria 2808606378 2808936855 588
273 iso_pu_bacteria 2808606380 2808946745 588
274 iso_pu_bacteria 2808606382 2808961190 588
275 iso_pu_bacteria 2808606383 2808964725 588
276 iso_pu_bacteria 2808606389 2809000405 588
277 iso_pu_bacteria 2825651385 2825657485 588
278 iso_pu_bacteria 2919481497 2919484733 588
279 iso_pu_bacteria 2919697872 2919702989 588
280 iso_pu_bacteria 2923586266 2923586405 588
281 iso_pu_bacteria 2929144301 2929147069 588
282 iso_pu_bacteria 2931369376 2931369588 588
283 iso_pu_bacteria 2988728565 2988728821 588
284 iso_pu_bacteria 3007866637 3007869099 588
285 iso_pu_bacteria 8019775933 8019778071 588
286 iso_pu_bacteria 8055878733 8055881010 588
287 iso_pu_bacteria 8056125926 8056128791 588
288 iso_pu_bacteria 8056143049 8056146237 588
289 iso_pu_bacteria 8056155041 8056155707 588
290 3300003791 Ga0055530_10000010 Ga0055530_1000001050 589
291 3300003792 Ga0055540_1000032 Ga0055540_100003250 589
292 3300006946 Ga0079104_1000253 Ga0079104_100025341 589
293 3300013100 Ga0157373_10007665 Ga0157373_100076655 589
294 3300025292 Ga0209676_1002537 Ga0209676_100253710 589
295 3300025298 Ga0209050_1000043 Ga0209050_1000043101 589
296 3300025303 Ga0209051_1000030 Ga0209051_1000030248 589
297 3300027111 Ga0209281_1000009 Ga0209281_1000009483 589
298 3300031548 Ga0307408_100000085 Ga0307408_10000008579 589
299 3300031548 Ga0307408_100046381 Ga0307408_1000463812 589
300 3300031901 Ga0307406_10021812 Ga0307406_100218122 589
301 3300031903 Ga0307407_10068593 Ga0307407_100685932 589
302 3300031911 Ga0307412_10000750 Ga0307412_100007506 589
303 3300031911 Ga0307412_10025157 Ga0307412_100251573 589
304 3300031995 Ga0307409_100085359 Ga0307409_1000853593 589
305 3300032004 Ga0307414_10066295 Ga0307414_100662952 589
306 3300041405 Ga0439438_008709 Ga0439438_008709_285_2063 589
307 3300041405 Ga0439438_008896 Ga0439438_008896_320_2098 589
308 3300042010 Ga0439452_016880 Ga0439452_016880_142_1920 589
309 3300042016 Ga0439463_005753 Ga0439463_005753_1226_3007 589
310 3300046458 Ga0495591_002805 Ga0495591_002805_2464_4233 589
311 3300046471 Ga0495650_0001229 Ga0495650_0001229_7603_9372 589
312 3300046474 Ga0495605_0002413 Ga0495605_0002413_8501_10270 589
313 3300046491 Ga0495584_0004441 Ga0495584_0004441_1104_2873 589
314 3300046492 Ga0495585_0006924 Ga0495585_0006924_4853_6622 589
315 3300046501 Ga0495607_0005014 Ga0495607_0005014_3042_4973 589
316 3300046501 Ga0495607_0006465 Ga0495607_0006465_5334_7103 589
317 3300046501 Ga0495607_0022179 Ga0495607_0022179_884_2653 589
318 3300046506 Ga0495583_0001496 Ga0495583_0001496_16799_18568 589
319 3300046506 Ga0495583_0004961 Ga0495583_0004961_1329_3098 589
320 3300046507 Ga0495606_0001612 Ga0495606_0001612_7097_8866 589
321 3300046507 Ga0495606_0018012 Ga0495606_0018012_2297_4066 589
322 3300046518 Ga0495631_0017658 Ga0495631_0017658_287_2056 589
323 3300046519 Ga0495632_0001944 Ga0495632_0001944_2149_3918 589
324 3300046520 Ga0495637_0000204 Ga0495637_0000204_20049_21818 589
325 3300046520 Ga0495637_0000844 Ga0495637_0000844_17123_18892 589
326 3300046524 Ga0495648_0004015 Ga0495648_0004015_9605_11374 589
327 3300046524 Ga0495648_0005599 Ga0495648_0005599_7311_9080 589
328 3300046538 Ga0495609_0000141 Ga0495609_0000141_69343_71112 589
329 3300046648 Ga0495611_0000518 Ga0495611_0000518_11911_13680 589
330 3300046648 Ga0495611_0010402 Ga0495611_0010402_1200_2969 589
331 3300046660 Ga0495625_0000145 Ga0495625_0000145_21499_23268 589
332 3300046665 Ga0495661_0000332 Ga0495661_0000332_48251_50020 589
333 3300046665 Ga0495661_0034925 Ga0495661_0034925_1340_3109 589
334 3300047320 Ga0495672_0018291 Ga0495672_0018291_51_1820 589
335 3300047320 Ga0495672_0022489 Ga0495672_0022489_1005_2774 589
336 3300047321 Ga0495676_0000198 Ga0495676_0000198_20936_22705 589
337 3300047446 Ga0495679_001029 Ga0495679_001029_9859_11628 589
338 3300047469 Ga0495673_0014837 Ga0495673_0014837_929_2698 589
339 3300047470 Ga0495681_0006296 Ga0495681_0006296_1390_3159 589
340 3300048091 Ga0495626_0000372 Ga0495626_0000372_20039_21808 589
341 3300049459 Ga0495678_000840 Ga0495678_000840_8531_10300 589
342 3300049459 Ga0495678_009832 Ga0495678_009832_2887_4656 589
343 3300049459 Ga0495678_031107 Ga0495678_031107_358_2127 589
344 3300049662 Ga0501222_002771 Ga0501222_002771_526_2304 589
345 iso_pu_bacteria 2600255283 2601625535 589
346 iso_pu_bacteria 2912963787 2912966913 589
347 iso_pu_bacteria 2939651529 2939655586 589
348 3300005288 Ga0065714_10022393 Ga0065714_100223932 590
349 3300014497 Ga0182008_10043854 Ga0182008_100438542 590
350 3300015265 Ga0182005_1004865 Ga0182005_10048654 590
351 3300017792 Ga0163161_10000744 Ga0163161_100007447 590
352 3300042013 Ga0439456_000268 Ga0439456_000268_9596_11377 590
353 3300046455 Ga0495603_0014222 Ga0495603_0014222_1326_3107 590
354 3300046458 Ga0495591_000606 Ga0495591_000606_3327_5099 590
355 3300046471 Ga0495650_0004914 Ga0495650_0004914_1672_3462 590
356 3300046474 Ga0495605_0000155 Ga0495605_0000155_20981_22753 590
357 3300046491 Ga0495584_0000652 Ga0495584_0000652_14666_16447 590
358 3300046506 Ga0495583_0001312 Ga0495583_0001312_13848_15620 590
359 3300046506 Ga0495583_0007620 Ga0495583_0007620_4391_6175 590
360 3300046507 Ga0495606_0000812 Ga0495606_0000812_24846_26618 590
361 3300046512 Ga0495610_0014127 Ga0495610_0014127_2308_4089 590
362 3300046519 Ga0495632_0001013 Ga0495632_0001013_13968_15740 590
363 3300046520 Ga0495637_0018600 Ga0495637_0018600_1351_3123 590
364 3300046616 Ga0495668_0003802 Ga0495668_0003802_8045_9829 590
365 3300046665 Ga0495661_0001483 Ga0495661_0001483_7548_9320 590
366 3300046665 Ga0495661_0035322 Ga0495661_0035322_1274_3046 590
367 3300046810 Ga0495660_0000724 Ga0495660_0000724_16600_18378 590
368 3300047320 Ga0495672_0000077 Ga0495672_0000077_103354_105144 590
369 3300047320 Ga0495672_0013193 Ga0495672_0013193_1919_3691 590
370 3300047469 Ga0495673_0003142 Ga0495673_0003142_4431_6215 590
371 3300047470 Ga0495681_0004485 Ga0495681_0004485_1353_3125 590
372 3300047470 Ga0495681_0024226 Ga0495681_0024226_1083_2864 590
373 3300048915 Ga0496112_0123439 Ga0496112_0123439_699_2471 590
374 3300048924 Ga0496121_0003161 Ga0496121_0003161_4560_6332 590
375 3300048925 Ga0496122_0006850 Ga0496122_0006850_7446_9218 590
376 3300048926 Ga0496123_0010150 Ga0496123_0010150_6255_8027 590
377 3300048927 Ga0496124_0001189 Ga0496124_0001189_20395_22167 590
378 3300048927 Ga0496124_0001964 Ga0496124_0001964_6446_8218 590
379 3300017792 Ga0163161_10007564 Ga0163161_100075643 591
380 3300025728 Ga0207655_1000610 Ga0207655_100061013 591
381 3300042533 Ga0450901_001776 Ga0450901_001776_420_2195 591
382 3300046458 Ga0495591_003118 Ga0495591_003118_3314_5089 591
383 3300046460 Ga0495638_0034074 Ga0495638_0034074_211_1986 591
384 3300046471 Ga0495650_0022889 Ga0495650_0022889_1045_2820 591
385 3300046492 Ga0495585_0059067 Ga0495585_0059067_318_2093 591
386 3300046501 Ga0495607_0030403 Ga0495607_0030403_1203_2978 591
387 3300046515 Ga0495620_0008342 Ga0495620_0008342_347_2122 591
388 3300046518 Ga0495631_0000005 Ga0495631_0000005_149781_151556 591
389 3300046520 Ga0495637_0001432 Ga0495637_0001432_8274_10058 591
390 3300046520 Ga0495637_0037210 Ga0495637_0037210_67_1842 591
391 3300046530 Ga0495654_0004922 Ga0495654_0004922_1294_3069 591
392 3300046530 Ga0495654_0023038 Ga0495654_0023038_154_1929 591
393 3300046660 Ga0495625_0002980 Ga0495625_0002980_7611_9386 591
394 3300046694 Ga0495649_0018661 Ga0495649_0018661_1301_3085 591
395 3300047323 Ga0495683_0000010 Ga0495683_0000010_185078_186853 591
396 3300047469 Ga0495673_0000242 Ga0495673_0000242_63638_65413 591
397 3300048916 Ga0496113_0121361 Ga0496113_0121361_77_1852 591
398 3300048921 Ga0496118_0025642 Ga0496118_0025642_3210_4985 591
399 3300048924 Ga0496121_0003745 Ga0496121_0003745_19222_20997 591
400 3300048925 Ga0496122_0002278 Ga0496122_0002278_6066_7841 591
401 3300048926 Ga0496123_0001853 Ga0496123_0001853_6039_7814 591
402 3300048928 Ga0496125_0011582 Ga0496125_0011582_4934_6709 591
403 iso_pu_bacteria 2738543004 2739199530 591
404 iso_pu_bacteria 3007315729 3007316319 591
405 2124908027 MRS2a_Contig_8 MRS2a_00655280 592
406 3300005288 Ga0065714_10000390 Ga0065714_100003904 592
407 3300006058 Ga0075432_10001954 Ga0075432_100019542 592
408 3300006177 Ga0075362_10012743 Ga0075362_100127433 592
409 3300006946 Ga0079104_1000184 Ga0079104_100018429 592
410 3300013100 Ga0157373_10035633 Ga0157373_100356332 592
411 3300013100 Ga0157373_10040879 Ga0157373_100408793 592
412 3300013102 Ga0157371_10113911 Ga0157371_101139112 592
413 3300013306 Ga0163162_10021559 Ga0163162_100215595 592
414 3300015261 Ga0182006_1003311 Ga0182006_10033113 592
415 3300015261 Ga0182006_1005944 Ga0182006_10059443 592
416 3300025256 Ga0209759_1001955 Ga0209759_10019554 592
417 3300025728 Ga0207655_1006859 Ga0207655_10068593 592
418 3300025735 Ga0207713_1022205 Ga0207713_10222052 592
419 3300027111 Ga0209281_1000046 Ga0209281_1000046197 592
420 3300041405 Ga0439438_000510 Ga0439438_000510_6688_8466 592
421 3300041405 Ga0439438_006689 Ga0439438_006689_1254_3041 592
422 3300041405 Ga0439438_008139 Ga0439438_008139_1116_2894 592
423 3300041407 Ga0439447_002508 Ga0439447_002508_1913_3691 592
424 3300041407 Ga0439447_008868 Ga0439447_008868_323_2101 592
425 3300041411 Ga0439466_0008388 Ga0439466_0008388_774_2561 592
426 3300042010 Ga0439452_000147 Ga0439452_000147_25213_26991 592
427 3300042127 Ga0450890_000826 Ga0450890_000826_1254_3032 592
428 3300042146 Ga0450907_000003 Ga0450907_000003_35466_37244 592
429 3300042185 Ga0450909_002931 Ga0450909_002931_110_1888 592
430 3300042435 Ga0439434_0000019 Ga0439434_0000019_4213_5991 592
431 3300042993 Ga0439440_0001260 Ga0439440_0001260_910_2688 592
432 3300046452 Ga0495617_000064 Ga0495617_000064_30988_32766 592
433 3300046452 Ga0495617_023843 Ga0495617_023843_149_1927 592
434 3300046457 Ga0495590_0000184 Ga0495590_0000184_21118_22896 592
435 3300046457 Ga0495590_0005294 Ga0495590_0005294_1132_2910 592
436 3300046458 Ga0495591_000103 Ga0495591_000103_8446_10233 592
437 3300046458 Ga0495591_003414 Ga0495591_003414_5199_6977 592
438 3300046460 Ga0495638_0000196 Ga0495638_0000196_9613_11391 592
439 3300046460 Ga0495638_0019248 Ga0495638_0019248_523_2310 592
440 3300046471 Ga0495650_0002683 Ga0495650_0002683_2279_4066 592
441 3300046471 Ga0495650_0029484 Ga0495650_0029484_203_1981 592
442 3300046473 Ga0495582_0001454 Ga0495582_0001454_1131_2909 592
443 3300046474 Ga0495605_0000020 Ga0495605_0000020_56038_57816 592
444 3300046474 Ga0495605_0001682 Ga0495605_0001682_8626_10413 592
445 3300046474 Ga0495605_0022927 Ga0495605_0022927_1253_3031 592
446 3300046474 Ga0495605_0027556 Ga0495605_0027556_538_2316 592
447 3300046475 Ga0495639_0000001 Ga0495639_0000001_50196_51974 592
448 3300046491 Ga0495584_0000023 Ga0495584_0000023_61712_63490 592
449 3300046491 Ga0495584_0000038 Ga0495584_0000038_53649_55427 592
450 3300046491 Ga0495584_0001449 Ga0495584_0001449_1227_3005 592
451 3300046491 Ga0495584_0017914 Ga0495584_0017914_1380_3158 592
452 3300046491 Ga0495584_0040599 Ga0495584_0040599_267_2045 592
453 3300046492 Ga0495585_0057751 Ga0495585_0057751_134_1912 592
454 3300046499 Ga0495594_0000712 Ga0495594_0000712_15118_16905 592
455 3300046499 Ga0495594_0041274 Ga0495594_0041274_457_2235 592
456 3300046499 Ga0495594_0049220 Ga0495594_0049220_400_2178 592
457 3300046500 Ga0495596_0000014 Ga0495596_0000014_43537_45324 592
458 3300046501 Ga0495607_0000028 Ga0495607_0000028_87835_89613 592
459 3300046501 Ga0495607_0025309 Ga0495607_0025309_920_2698 592
460 3300046506 Ga0495583_0000112 Ga0495583_0000112_52266_54044 592
461 3300046506 Ga0495583_0035003 Ga0495583_0035003_267_2045 592
462 3300046506 Ga0495583_0043646 Ga0495583_0043646_18_1796 592
463 3300046507 Ga0495606_0002913 Ga0495606_0002913_12734_14512 592
464 3300046512 Ga0495610_0022503 Ga0495610_0022503_288_2066 592
465 3300046513 Ga0495616_0013836 Ga0495616_0013836_1375_3153 592
466 3300046515 Ga0495620_0000914 Ga0495620_0000914_5462_7240 592
467 3300046517 Ga0495630_0026903 Ga0495630_0026903_862_2640 592
468 3300046519 Ga0495632_0000058 Ga0495632_0000058_72163_73941 592
469 3300046519 Ga0495632_0000064 Ga0495632_0000064_51122_52900 592
470 3300046519 Ga0495632_0001744 Ga0495632_0001744_11709_13487 592
471 3300046519 Ga0495632_0002826 Ga0495632_0002826_9227_11014 592
472 3300046520 Ga0495637_0001736 Ga0495637_0001736_671_2458 592
473 3300046520 Ga0495637_0002702 Ga0495637_0002702_4272_6050 592
474 3300046522 Ga0495643_0007840 Ga0495643_0007840_1642_3420 592
475 3300046522 Ga0495643_0010419 Ga0495643_0010419_2769_4547 592
476 3300046523 Ga0495644_0000033 Ga0495644_0000033_42189_43967 592
477 3300046524 Ga0495648_0023152 Ga0495648_0023152_1258_3036 592
478 3300046524 Ga0495648_0025133 Ga0495648_0025133_844_2631 592
479 3300046528 Ga0495642_0000003 Ga0495642_0000003_68073_69851 592
480 3300046528 Ga0495642_0000507 Ga0495642_0000507_5502_7280 592
481 3300046528 Ga0495642_0000689 Ga0495642_0000689_6784_8571 592
482 3300046530 Ga0495654_0000230 Ga0495654_0000230_11629_13407 592
483 3300046535 Ga0495586_0006697 Ga0495586_0006697_2947_4725 592
484 3300046536 Ga0495587_0008812 Ga0495587_0008812_1433_3211 592
485 3300046538 Ga0495609_0000802 Ga0495609_0000802_18900_20678 592
486 3300046538 Ga0495609_0002893 Ga0495609_0002893_1261_3048 592
487 3300046538 Ga0495609_0045571 Ga0495609_0045571_49_1827 592
488 3300046542 Ga0495597_0001350 Ga0495597_0001350_11855_13633 592
489 3300046542 Ga0495597_0003145 Ga0495597_0003145_6841_8619 592
490 3300046542 Ga0495597_0029775 Ga0495597_0029775_549_2327 592
491 3300046557 Ga0495622_0000822 Ga0495622_0000822_6799_8577 592
492 3300046615 Ga0495656_0005230 Ga0495656_0005230_1144_2922 592
493 3300046615 Ga0495656_0017166 Ga0495656_0017166_71_1849 592
494 3300046642 Ga0495634_0043461 Ga0495634_0043461_1235_3013 592
495 3300046648 Ga0495611_0010194 Ga0495611_0010194_1178_2956 592
496 3300046660 Ga0495625_0016094 Ga0495625_0016094_3258_5036 592
497 3300046660 Ga0495625_0048830 Ga0495625_0048830_109_1887 592
498 3300046663 Ga0495635_0001673 Ga0495635_0001673_1432_3210 592
499 3300046664 Ga0495659_0000002 Ga0495659_0000002_44771_46549 592
500 3300046664 Ga0495659_0001085 Ga0495659_0001085_6243_8021 592
501 3300046664 Ga0495659_0018796 Ga0495659_0018796_380_2158 592
502 3300046665 Ga0495661_0018629 Ga0495661_0018629_2135_3913 592
503 3300046679 Ga0495623_0002926 Ga0495623_0002926_8530_10308 592
504 3300046680 Ga0495646_0000481 Ga0495646_0000481_1263_3041 592
505 3300046684 Ga0495669_0010122 Ga0495669_0010122_207_1994 592
506 3300046691 Ga0495670_0001482 Ga0495670_0001482_1326_3104 592
507 3300046691 Ga0495670_0009018 Ga0495670_0009018_927_2705 592
508 3300046692 Ga0495671_0000095 Ga0495671_0000095_59537_61315 592
509 3300046692 Ga0495671_0003621 Ga0495671_0003621_1043_2821 592
510 3300046694 Ga0495649_0000023 Ga0495649_0000023_59992_61770 592
511 3300046694 Ga0495649_0003409 Ga0495649_0003409_1307_3085 592
512 3300046794 Ga0495589_0000064 Ga0495589_0000064_56684_58462 592
513 3300046794 Ga0495589_0012306 Ga0495589_0012306_1305_3083 592
514 3300046810 Ga0495660_0007715 Ga0495660_0007715_1212_2990 592
515 3300046810 Ga0495660_0022470 Ga0495660_0022470_1346_3124 592
516 3300047317 Ga0495604_0001437 Ga0495604_0001437_16873_18651 592
517 3300047317 Ga0495604_0060120 Ga0495604_0060120_78_1856 592
518 3300047318 Ga0495636_0011785 Ga0495636_0011785_768_2546 592
519 3300047320 Ga0495672_0000239 Ga0495672_0000239_60683_62461 592
520 3300047320 Ga0495672_0005826 Ga0495672_0005826_5439_7217 592
521 3300047320 Ga0495672_0012301 Ga0495672_0012301_3445_5223 592
522 3300047320 Ga0495672_0013408 Ga0495672_0013408_3718_5496 592
523 3300047320 Ga0495672_0060943 Ga0495672_0060943_51_1829 592
524 3300047320 Ga0495672_0062097 Ga0495672_0062097_293_2071 592
525 3300047322 Ga0495680_0001302 Ga0495680_0001302_22661_24439 592
526 3300047323 Ga0495683_0004097 Ga0495683_0004097_437_2215 592
527 3300047443 Ga0495687_003935 Ga0495687_003935_7782_9560 592
528 3300047443 Ga0495687_004121 Ga0495687_004121_907_2685 592
529 3300047443 Ga0495687_032013 Ga0495687_032013_426_2213 592
530 3300047444 Ga0495675_0001551 Ga0495675_0001551_5840_7618 592
531 3300047445 Ga0495677_0001539 Ga0495677_0001539_1422_3200 592
532 3300047446 Ga0495679_009772 Ga0495679_009772_1750_3528 592
533 3300047446 Ga0495679_011181 Ga0495679_011181_584_2362 592
534 3300047446 Ga0495679_017660 Ga0495679_017660_535_2313 592
535 3300047469 Ga0495673_0000309 Ga0495673_0000309_3455_5233 592
536 3300047469 Ga0495673_0006796 Ga0495673_0006796_1381_3159 592
537 3300047469 Ga0495673_0027681 Ga0495673_0027681_451_2229 592
538 3300047470 Ga0495681_0000134 Ga0495681_0000134_48034_49812 592
539 3300047470 Ga0495681_0019683 Ga0495681_0019683_648_2426 592
540 3300047673 Ga0495593_0013428 Ga0495593_0013428_1435_3213 592
541 3300048091 Ga0495626_0000031 Ga0495626_0000031_54551_56329 592
542 3300048091 Ga0495626_0000032 Ga0495626_0000032_178157_179944 592
543 3300048091 Ga0495626_0000801 Ga0495626_0000801_18969_20747 592
544 3300048091 Ga0495626_0013444 Ga0495626_0013444_1234_3012 592
545 3300048919 Ga0496116_0000231 Ga0496116_0000231_66824_68602 592
546 3300048920 Ga0496117_0043056 Ga0496117_0043056_363_2141 592
547 3300048921 Ga0496118_0037522 Ga0496118_0037522_1520_3307 592
548 3300048921 Ga0496118_0087995 Ga0496118_0087995_208_1989 592
549 3300048924 Ga0496121_0059789 Ga0496121_0059789_1111_2898 592
550 3300048925 Ga0496122_0007575 Ga0496122_0007575_1427_3205 592
551 3300048927 Ga0496124_0005797 Ga0496124_0005797_11683_13461 592
552 3300048927 Ga0496124_0073175 Ga0496124_0073175_404_2185 592
553 3300048928 Ga0496125_0029072 Ga0496125_0029072_1838_3616 592
554 3300049459 Ga0495678_001381 Ga0495678_001381_1347_3134 592
555 3300049459 Ga0495678_004010 Ga0495678_004010_1434_3212 592
556 3300049460 Ga0495682_0000326 Ga0495682_0000326_32188_33969 592
557 3300049460 Ga0495682_0014370 Ga0495682_0014370_83_1861 592
558 iso_pu_bacteria 3007252601 3007254859 592

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04412

AcnX

Aconitase X

214

616

0.99

PF01989

AcnX_swivel_put

Aconitase X swivel domain

81

166

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cnp-assembly1.cif.gz_A crystal structure of agrobacterium tumefaciens aconitase x (apo-form) 0.9405 4 568
7d2r-assembly1.cif.gz_A crystal structure of agrobacterium tumefaciens aconitase x mutant - s449c/c510v 0.9398 5 568
7cnq-assembly4.cif.gz_D crystal structure of agrobacterium tumefaciens aconitase x (holo-form) 0.9398 4 568
7cnp-assembly1.cif.gz_A crystal structure of agrobacterium tumefaciens aconitase x (apo-form) 0.9372 4 568
7d2r-assembly1.cif.gz_A crystal structure of agrobacterium tumefaciens aconitase x mutant - s449c/c510v 0.9365 5 568
ID Description Score Start End Superfamily
af_Q58709_26_277_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9408 188 431 3.30.499.10
af_Q58709_26_277_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9082 188 431 3.30.499.10
af_Q58802_1_129_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8496 5 138 3.50.30.10
af_Q58802_1_129_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8435 5 138 3.50.30.10
2hi6A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8358 5 137 3.50.30.10
ID Description Score Start End GO Terms
AF-A0A3T1DVL1-F1-model_v4 deleted 0.9898 266 573
AF-A0A6M0CYD0-F1-model_v4 DUF521 domain-containing protein 0.9855 152 482 GO:0016829
AF-X0WYE4-F1-model_v4 Phosphomevalonate dehydratase large subunit-like domain-containing protein 0.983 159 339 GO:0016829
AF-A0A1I0I9X5-F1-model_v4 Predicted aconitase subunit 1 0.9816 3 573 GO:0016829
AF-A0A6A6B425-F1-model_v4 Phosphomevalonate dehydratase large subunit-like domain-containing protein 0.9801 189 569 GO:0016829

Feature Viewer

pLDDT pTM Quality
91.26 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map