F462840

General Info

Members Datasets Scaffolds Average Seq Length
553 230 1106 223

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100102829|Ga0068858_1001028292
Length 217
Sequence MEKMPYRMELDVHFPQRTIDPVITTITTDWRQGLPVLTGAMVTLRELKASDATSLCALLTTEEVSRFISPPPTTVDGFERFIAWTLRQRRAGSYACFAVTLDSTDTAIGIFQLRELEAGFGTAEWGFAITGVFHDGADLMIKFAFDVVGVHRLEARAAVKNGRGNGALRKVGAVQEGLLRKSFQKDGEYLDQALWTILKEDWTSKQIWTAADGLIIH

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 4.34
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 29.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100102829 3300005842 Bacteria 2665
2 Ga0065714_10167118 3300005288 Bacteria 1022
3 Ga0065712_10072215 3300005290 Bacteria 4854
4 Ga0070676_10410207 3300005328 Bacteria 944
5 Ga0070683_100357019 3300005329 Bacteria 1392
6 Ga0070683_100367707 3300005329 Bacteria 1370
7 Ga0070690_100029016 3300005330 Unclassified 3429
8 Ga0070690_100125008 3300005330 Unclassified 1730
9 Ga0070690_100188227 3300005330 Unclassified 1430
10 Ga0070677_10147644 3300005333 Bacteria 1091
11 Ga0070666_10079294 3300005335 Unclassified 2243
12 Ga0070680_100448409 3300005336 Unclassified 1102
13 Ga0068868_100042700 3300005338 Unclassified 3540
14 Ga0068868_100267318 3300005338 Bacteria 1444
15 Ga0068868_100447574 3300005338 Bacteria 1123
16 Ga0070689_100199593 3300005340 Bacteria 1633
17 Ga0070689_100458402 3300005340 Bacteria 1086
18 Ga0070691_10004737 3300005341 Bacteria 6190
19 Ga0070687_100299470 3300005343 Bacteria 1020
20 Ga0070668_100070086 3300005347 Unclassified 2729
21 Ga0070668_100446798 3300005347 Bacteria 1111
22 Ga0070668_100710750 3300005347 Bacteria 887
23 Ga0070669_100017598 3300005353 Bacteria 5098
24 Ga0070669_100034146 3300005353 Bacteria 3683
25 Ga0070669_100045272 3300005353 Bacteria 3206
26 Ga0070669_100129291 3300005353 Bacteria 1936
27 Ga0070669_100168417 3300005353 Bacteria 1706
28 Ga0070669_100333746 3300005353 Unclassified 1227
29 Ga0070675_100000044 3300005354 Bacteria 77309
30 Ga0070675_100000147 3300005354 Bacteria 42295
31 Ga0070675_100183180 3300005354 Bacteria 1812
32 Ga0070671_100220533 3300005355 Bacteria 1609
33 Ga0070674_100062548 3300005356 Bacteria 2601
34 Ga0070674_100288865 3300005356 Unclassified 1303
35 Ga0070673_100013947 3300005364 Bacteria 5580
36 Ga0070673_100072210 3300005364 Unclassified 2775
37 Ga0070673_100204871 3300005364 Bacteria 1700
38 Ga0070673_100233832 3300005364 Unclassified 1595
39 Ga0070673_100446198 3300005364 Bacteria 1163
40 Ga0070688_100072563 3300005365 Bacteria 2206
41 Ga0070667_100005401 3300005367 Bacteria 10673
42 Ga0070714_100009284 3300005435 Bacteria 7730
43 Ga0070713_100338391 3300005436 Bacteria 1394
44 Ga0070701_10017386 3300005438 Bacteria 3360
45 Ga0070711_100250787 3300005439 Bacteria 1388
46 Ga0070705_100307453 3300005440 Bacteria 1139
47 Ga0070705_100323817 3300005440 Unclassified 1114
48 Ga0070705_100339154 3300005440 Unclassified 1092
49 Ga0070700_100343819 3300005441 Bacteria 1103
50 Ga0070694_100121235 3300005444 Bacteria 1877
51 Ga0070708_100310236 3300005445 Bacteria 1486
52 Ga0070708_100403506 3300005445 Bacteria 1289
53 Ga0070662_100159071 3300005457 Bacteria 1766
54 Ga0070662_100476070 3300005457 Unclassified 1039
55 Ga0070662_100510014 3300005457 Bacteria 1004
56 Ga0070662_100575369 3300005457 Bacteria 946
57 Ga0068867_100020580 3300005459 Bacteria 4701
58 Ga0068867_100067810 3300005459 Bacteria 2661
59 Ga0068867_100140825 3300005459 Unclassified 1885
60 Ga0068867_100580621 3300005459 Bacteria 975
61 Ga0070707_100477620 3300005468 Bacteria 1208
62 Ga0070698_100562837 3300005471 Bacteria 1080
63 Ga0070699_100194399 3300005518 Bacteria 1803
64 Ga0070699_100216784 3300005518 Bacteria 1705
65 Ga0070699_100520167 3300005518 Bacteria 1082
66 Ga0070699_100525104 3300005518 Bacteria 1076
67 Ga0070699_100870304 3300005518 Bacteria 825
68 Ga0070684_100049839 3300005535 Bacteria 3636
69 Ga0070697_100064798 3300005536 Bacteria 2985
70 Ga0070697_100740567 3300005536 Unclassified 868
71 Ga0070697_100866390 3300005536 Unclassified 800
72 Ga0070672_100033147 3300005543 Bacteria 3908
73 Ga0070672_100838210 3300005543 Bacteria 810
74 Ga0070686_100042958 3300005544 Bacteria 2833
75 Ga0070686_100063769 3300005544 Unclassified 2388
76 Ga0070686_100121696 3300005544 Bacteria 1793
77 Ga0070686_100176328 3300005544 Unclassified 1515
78 Ga0070686_100571622 3300005544 Unclassified 887
79 Ga0070686_100803929 3300005544 Bacteria 758
80 Ga0070696_100098860 3300005546 Bacteria 2087
81 Ga0070693_100144716 3300005547 Bacteria 1500
82 Ga0070693_100175472 3300005547 Bacteria 1376
83 Ga0070665_100009707 3300005548 Bacteria 9727
84 Ga0070665_100022432 3300005548 Bacteria 6353
85 Ga0070665_100029234 3300005548 Bacteria 5546
86 Ga0070704_100091757 3300005549 Unclassified 2266
87 Ga0068855_100917880 3300005563 Bacteria 924
88 Ga0068854_100085859 3300005578 Bacteria 2331
89 Ga0068854_100368122 3300005578 Bacteria 1181
90 Ga0068854_100477229 3300005578 Bacteria 1046
91 Ga0068854_100616547 3300005578 Bacteria 928
92 Ga0070702_100035057 3300005615 Bacteria 2770
93 Ga0070702_100146309 3300005615 Bacteria 1511
94 Ga0068852_100514829 3300005616 Unclassified 1193
95 Ga0068859_100238639 3300005617 Bacteria 1907
96 Ga0068864_100040981 3300005618 Bacteria 3961
97 Ga0068864_100089624 3300005618 Bacteria 2710
98 Ga0068866_10101687 3300005718 Bacteria 1587
99 Ga0068861_100007257 3300005719 Bacteria 7595
100 Ga0068861_100020601 3300005719 Bacteria 4727
101 Ga0068861_100039303 3300005719 Bacteria 3530
102 Ga0068861_100756190 3300005719 Bacteria 908
103 Ga0068863_100003475 3300005841 Bacteria 15542
104 Ga0068863_100277941 3300005841 Unclassified 1622
105 Ga0068863_101250734 3300005841 Bacteria 749
106 Ga0068858_100035798 3300005842 Unclassified 4604
107 Ga0068858_100062094 3300005842 Bacteria 3455
108 Ga0068858_100128903 3300005842 Bacteria 2371
109 Ga0068858_100165238 3300005842 Bacteria 2085
110 Ga0068858_100450300 3300005842 Bacteria 1240
111 Ga0068858_100748576 3300005842 Bacteria 952
112 Ga0068860_100183251 3300005843 Unclassified 2024
113 Ga0068860_100388566 3300005843 Bacteria 1378
114 Ga0068860_100691869 3300005843 Unclassified 1029
115 Ga0068860_100833498 3300005843 Bacteria 936
116 Ga0068862_100002446 3300005844 Bacteria 16474
117 Ga0068862_100004549 3300005844 Bacteria 11691
118 Ga0068862_100266761 3300005844 Bacteria 1564
119 Ga0068862_100635873 3300005844 Unclassified 1028
120 Ga0081455_10040391 3300005937 Bacteria 4114
121 Ga0081538_10174235 3300005981 Unclassified 932
122 Ga0075432_10006892 3300006058 Bacteria 3870
123 Ga0070715_10208230 3300006163 Bacteria 998
124 Ga0070716_100233862 3300006173 Bacteria 1242
125 Ga0075367_10295627 3300006178 Unclassified 1019
126 Ga0097621_100022672 3300006237 Bacteria 4877
127 Ga0097621_100038888 3300006237 Unclassified 3819
128 Ga0097621_100214031 3300006237 Unclassified 1677
129 Ga0097621_100293220 3300006237 Bacteria 1435
130 Ga0068871_100006744 3300006358 Bacteria 8155
131 Ga0068871_100016130 3300006358 Bacteria 5614
132 Ga0068871_100045071 3300006358 Unclassified 3548
133 Ga0068871_100114306 3300006358 Bacteria 2274
134 Ga0068871_100377415 3300006358 Unclassified 1259
135 Ga0075428_100129370 3300006844 Unclassified 2747
136 Ga0075428_100152024 3300006844 Bacteria 2514
137 Ga0075430_100701382 3300006846 Unclassified 834
138 Ga0075431_100246211 3300006847 Unclassified 1817
139 Ga0075431_100308957 3300006847 Unclassified 1596
140 Ga0075433_10043322 3300006852 Bacteria 3906
141 Ga0075433_10226448 3300006852 Bacteria 1661
142 Ga0075433_10380108 3300006852 Unclassified 1247
143 Ga0075433_10457407 3300006852 Bacteria 1125
144 Ga0075433_10482660 3300006852 Unclassified 1092
145 Ga0075433_10631934 3300006852 Bacteria 939
146 Ga0075434_100000167 3300006871 Bacteria 41887
147 Ga0075434_100010002 3300006871 Bacteria 8879
148 Ga0075434_100079263 3300006871 Bacteria 3281
149 Ga0075434_100165929 3300006871 Bacteria 2228
150 Ga0075434_100259682 3300006871 Bacteria 1756
151 Ga0075434_100750030 3300006871 Bacteria 993
152 Ga0075429_100028294 3300006880 Bacteria 4868
153 Ga0075429_100237706 3300006880 Unclassified 1596
154 Ga0075429_100727002 3300006880 Bacteria 869
155 Ga0068865_100001457 3300006881 Bacteria 13780
156 Ga0068865_100053580 3300006881 Bacteria 2799
157 Ga0068865_100118645 3300006881 Unclassified 1963
158 Ga0068865_100301788 3300006881 Unclassified 1282
159 Ga0068865_100619422 3300006881 Bacteria 917
160 Ga0075436_100000240 3300006914 Bacteria 34182
161 Ga0075436_100001602 3300006914 Bacteria 15472
162 Ga0075436_100020808 3300006914 Bacteria 4500
163 Ga0075436_100023724 3300006914 Bacteria 4214
164 Ga0075436_100062398 3300006914 Unclassified 2575
165 Ga0075436_100139820 3300006914 Unclassified 1701
166 Ga0075436_100294672 3300006914 Bacteria 1162
167 Ga0075436_100359077 3300006914 Bacteria 1051
168 Ga0075436_100607831 3300006914 Bacteria 806
169 Ga0097620_100238630 3300006931 Bacteria 1907
170 Ga0075435_100000024 3300007076 Bacteria 88166
171 Ga0075435_100009881 3300007076 Bacteria 6944
172 Ga0075435_100064977 3300007076 Bacteria 2966
173 Ga0075435_100104723 3300007076 Bacteria 2347
174 Ga0105240_10043353 3300009093 Bacteria 5725
175 Ga0105240_10204766 3300009093 Unclassified 2310
176 Ga0111539_10001003 3300009094 Bacteria 36985
177 Ga0111539_10049640 3300009094 Bacteria 5002
178 Ga0111539_10073611 3300009094 Bacteria 4028
179 Ga0111539_10234931 3300009094 Bacteria 2134
180 Ga0111539_10338887 3300009094 Bacteria 1750
181 Ga0111539_10681668 3300009094 Bacteria 1196
182 Ga0111539_11232394 3300009094 Bacteria 869
183 Ga0105245_10016401 3300009098 Bacteria 6462
184 Ga0105245_10058788 3300009098 Unclassified 3461
185 Ga0105245_10626580 3300009098 Unclassified 1104
186 Ga0105245_10665264 3300009098 Unclassified 1072
187 Ga0105245_10696190 3300009098 Unclassified 1049
188 Ga0105247_10004388 3300009101 Bacteria 9006
189 Ga0114129_10001311 3300009147 Bacteria 33246
190 Ga0114129_10003299 3300009147 Bacteria 22658
191 Ga0114129_10005449 3300009147 Bacteria 17981
192 Ga0114129_10008680 3300009147 Bacteria 14487
193 Ga0114129_10018351 3300009147 Bacteria 9964
194 Ga0114129_10137167 3300009147 Bacteria 3356
195 Ga0114129_10168559 3300009147 Bacteria 2987
196 Ga0114129_11020049 3300009147 Unclassified 1041
197 Ga0114129_11142037 3300009147 Bacteria 973
198 Ga0114129_11227035 3300009147 Bacteria 933
199 Ga0114129_11366594 3300009147 Unclassified 875
200 Ga0105243_10048425 3300009148 Bacteria 3350
201 Ga0105243_10057698 3300009148 Unclassified 3092
202 Ga0105243_10164390 3300009148 Unclassified 1916
203 Ga0105243_10416500 3300009148 Unclassified 1252
204 Ga0105243_11084906 3300009148 Bacteria 808
205 Ga0105241_10048253 3300009174 Bacteria 3240
206 Ga0105241_10209838 3300009174 Unclassified 1631
207 Ga0105242_10001219 3300009176 Bacteria 20289
208 Ga0105242_10003981 3300009176 Bacteria 11482
209 Ga0105242_10010164 3300009176 Bacteria 7208
210 Ga0105242_10548544 3300009176 Bacteria 1108
211 Ga0105248_10074247 3300009177 Bacteria 3822
212 Ga0105248_10118980 3300009177 Bacteria 2980
213 Ga0105248_10208956 3300009177 Unclassified 2199
214 Ga0105248_10225524 3300009177 Bacteria 2109
215 Ga0105248_10365108 3300009177 Unclassified 1625
216 Ga0105248_10412849 3300009177 Bacteria 1520
217 Ga0105248_10476488 3300009177 Bacteria 1407
218 Ga0105248_10530303 3300009177 Bacteria 1328
219 Ga0105248_10716657 3300009177 Unclassified 1129
220 Ga0105248_10995503 3300009177 Unclassified 947
221 Ga0105249_10192991 3300009553 Unclassified 1989
222 Ga0105249_10702513 3300009553 Bacteria 1071
223 Ga0105249_10868449 3300009553 Bacteria 968
224 Ga0105246_10484284 3300011119 Unclassified 1047
225 Ga0157374_10035245 3300013296 Unclassified 4578
226 Ga0157374_10087266 3300013296 Bacteria 2969
227 Ga0157374_10837238 3300013296 Unclassified 937
228 Ga0157378_10107192 3300013297 Bacteria 2557
229 Ga0157378_10117872 3300013297 Bacteria 2443
230 Ga0157378_10157715 3300013297 Bacteria 2120
231 Ga0163162_10040067 3300013306 Bacteria 4683
232 Ga0163162_10649446 3300013306 Unclassified 1179
233 Ga0157375_10102832 3300013308 Unclassified 2943
234 Ga0157375_10542377 3300013308 Unclassified 1325
235 Ga0163163_10008222 3300014325 Bacteria 9258
236 Ga0163163_10062690 3300014325 Unclassified 3685
237 Ga0163163_10147523 3300014325 Unclassified 2397
238 Ga0163163_10323855 3300014325 Unclassified 1595
239 Ga0157380_10124481 3300014326 Bacteria 2189
240 Ga0157380_10302230 3300014326 Unclassified 1474
241 Ga0157380_10430171 3300014326 Bacteria 1262
242 Ga0157380_10433225 3300014326 Bacteria 1258
243 Ga0157380_10702935 3300014326 Bacteria 1016
244 Ga0157377_10484548 3300014745 Bacteria 861
245 Ga0157377_10542542 3300014745 Bacteria 820
246 Ga0157379_10029558 3300014968 Bacteria 4872
247 Ga0157379_10086912 3300014968 Bacteria 2803
248 Ga0157379_10197484 3300014968 Unclassified 1818
249 Ga0157379_10372506 3300014968 Unclassified 1309
250 Ga0157379_10691846 3300014968 Unclassified 957
251 Ga0157379_11146652 3300014968 Unclassified 746
252 Ga0157376_10026806 3300014969 Bacteria 4559
253 Ga0157376_10078744 3300014969 Bacteria 2823
254 Ga0182005_1052930 3300015265 Unclassified 1105
255 Ga0207642_10068258 3300025899 Bacteria 1682
256 Ga0207680_10039770 3300025903 Unclassified 2731
257 Ga0207680_10130759 3300025903 Unclassified 1654
258 Ga0207699_10441674 3300025906 Bacteria 932
259 Ga0207645_10074581 3300025907 Bacteria 2172
260 Ga0207684_10430587 3300025910 Bacteria 1133
261 Ga0207707_10436095 3300025912 Bacteria 1122
262 Ga0207695_10096874 3300025913 Unclassified 2951
263 Ga0207695_10121868 3300025913 Unclassified 2574
264 Ga0207695_10245813 3300025913 Bacteria 1689
265 Ga0207695_10255048 3300025913 Unclassified 1653
266 Ga0207660_10280376 3300025917 Bacteria 1322
267 Ga0207662_10108672 3300025918 Bacteria 1727
268 Ga0207646_10114710 3300025922 Unclassified 2419
269 Ga0207681_10019053 3300025923 Unclassified 4332
270 Ga0207681_10526550 3300025923 Unclassified 970
271 Ga0207694_10131863 3300025924 Unclassified 2004
272 Ga0207694_10418302 3300025924 Unclassified 1116
273 Ga0207659_10000075 3300025926 Bacteria 63221
274 Ga0207659_10001942 3300025926 Bacteria 12262
275 Ga0207659_10061879 3300025926 Bacteria 2700
276 Ga0207687_10008890 3300025927 Bacteria 6566
277 Ga0207687_10101086 3300025927 Unclassified 2122
278 Ga0207687_10236856 3300025927 Bacteria 1444
279 Ga0207700_10296458 3300025928 Bacteria 1395
280 Ga0207664_10024825 3300025929 Bacteria 4507
281 Ga0207644_10411948 3300025931 Unclassified 1106
282 Ga0207706_10091152 3300025933 Bacteria 2680
283 Ga0207706_10370575 3300025933 Bacteria 1244
284 Ga0207706_10636028 3300025933 Bacteria 915
285 Ga0207686_10016924 3300025934 Bacteria 4097
286 Ga0207686_10020017 3300025934 Bacteria 3817
287 Ga0207686_10046866 3300025934 Unclassified 2669
288 Ga0207686_10136332 3300025934 Bacteria 1690
289 Ga0207686_10770350 3300025934 Bacteria 769
290 Ga0207709_10115074 3300025935 Bacteria 1806
291 Ga0207709_10219000 3300025935 Bacteria 1371
292 Ga0207709_10312055 3300025935 Bacteria 1174
293 Ga0207670_10232934 3300025936 Bacteria 1415
294 Ga0207670_10312176 3300025936 Bacteria 1235
295 Ga0207670_10799672 3300025936 Bacteria 786
296 Ga0207669_10009728 3300025937 Unclassified 4595
297 Ga0207704_10006627 3300025938 Bacteria 5421
298 Ga0207704_10103167 3300025938 Bacteria 1907
299 Ga0207665_10253394 3300025939 Bacteria 1301
300 Ga0207691_10746878 3300025940 Bacteria 824
301 Ga0207711_10012990 3300025941 Bacteria 6918
302 Ga0207711_10069187 3300025941 Unclassified 3059
303 Ga0207711_10141329 3300025941 Bacteria 2166
304 Ga0207711_10144655 3300025941 Bacteria 2141
305 Ga0207711_10215376 3300025941 Unclassified 1755
306 Ga0207711_10219043 3300025941 Unclassified 1740
307 Ga0207711_10405556 3300025941 Unclassified 1267
308 Ga0207711_10649501 3300025941 Unclassified 984
309 Ga0207689_10243047 3300025942 Unclassified 1488
310 Ga0207661_10873172 3300025944 Bacteria 828
311 Ga0207679_10069811 3300025945 Bacteria 2645
312 Ga0207679_10640062 3300025945 Unclassified 961
313 Ga0207667_10824836 3300025949 Bacteria 923
314 Ga0207651_10038814 3300025960 Unclassified 3133
315 Ga0207651_10129012 3300025960 Unclassified 1932
316 Ga0207651_10507491 3300025960 Bacteria 1043
317 Ga0207712_10252073 3300025961 Unclassified 1427
318 Ga0207668_10259043 3300025972 Bacteria 1416
319 Ga0207668_10368709 3300025972 Unclassified 1205
320 Ga0207640_10007879 3300025981 Bacteria 5878
321 Ga0207640_10036899 3300025981 Bacteria 3071
322 Ga0207640_10147852 3300025981 Bacteria 1722
323 Ga0207658_10619489 3300025986 Bacteria 973
324 Ga0207677_10137184 3300026023 Unclassified 1867
325 Ga0207677_10223400 3300026023 Bacteria 1512
326 Ga0207703_10022839 3300026035 Bacteria 4913
327 Ga0207703_10083027 3300026035 Unclassified 2676
328 Ga0207703_10091337 3300026035 Bacteria 2561
329 Ga0207703_10173852 3300026035 Bacteria 1896
330 Ga0207703_10175350 3300026035 Bacteria 1889
331 Ga0207703_10194836 3300026035 Unclassified 1797
332 Ga0207703_10199945 3300026035 Unclassified 1775
333 Ga0207703_10725952 3300026035 Bacteria 946
334 Ga0207639_10168492 3300026041 Bacteria 1853
335 Ga0207708_10001313 3300026075 Bacteria 18706
336 Ga0207708_10022367 3300026075 Bacteria 4774
337 Ga0207708_10118696 3300026075 Bacteria 2060
338 Ga0207641_10016911 3300026088 Bacteria 5972
339 Ga0207641_10276987 3300026088 Unclassified 1576
340 Ga0207641_10538997 3300026088 Bacteria 1137
341 Ga0207648_10081087 3300026089 Bacteria 2830
342 Ga0207648_10136442 3300026089 Bacteria 2161
343 Ga0207676_10036235 3300026095 Bacteria 3751
344 Ga0207676_10092406 3300026095 Bacteria 2489
345 Ga0207675_100001330 3300026118 Bacteria 24765
346 Ga0207675_100040343 3300026118 Bacteria 4359
347 Ga0207675_100051922 3300026118 Bacteria 3826
348 Ga0207675_100063166 3300026118 Bacteria 3460
349 Ga0207675_100459056 3300026118 Bacteria 1263
350 Ga0207428_10014110 3300027907 Bacteria 6957
351 Ga0207428_10056591 3300027907 Bacteria 3115
352 Ga0207428_10078180 3300027907 Unclassified 2589
353 Ga0268266_10006979 3300028379 Bacteria 10269
354 Ga0268266_10073537 3300028379 Unclassified 2966
355 Ga0268266_10544337 3300028379 Unclassified 1112
356 Ga0268265_10013841 3300028380 Bacteria 5491
357 Ga0268265_10582734 3300028380 Bacteria 1066
358 Ga0268264_10551222 3300028381 Bacteria 1131
359 Ga0268264_10575957 3300028381 Unclassified 1107
360 Ga0268264_10669759 3300028381 Bacteria 1028
361 Ga0268264_10756022 3300028381 Unclassified 969
362 Ga0307408_100330074 3300031548 Unclassified 1288
363 Ga0316576_10349620 3300031727 Unclassified 1100
364 Ga0307405_10119842 3300031731 Bacteria 1799
365 Ga0307405_10683356 3300031731 Bacteria 848
366 Ga0307411_10045106 3300032005 Unclassified 2834
367 Ga0373930_0001203 3300034816 Unclassified 3807
368 Ga0373930_0007340 3300034816 Bacteria 1894
369 Ga0373930_0014812 3300034816 Unclassified 1457
370 Ga0373950_0000745 3300034818 Bacteria 4047
371 Ga0373958_0000131 3300034819 Bacteria 8412
372 Ga0373958_0000974 3300034819 Bacteria 3729
373 Ga0373958_0001333 3300034819 Unclassified 3305
374 Ga0373959_0004368 3300034820 Bacteria 2276
375 Ga0373959_0006460 3300034820 Bacteria 1946
376 Ga0373928_0002383 3300035084 Unclassified 3651
377 Ga0373928_0003318 3300035084 Bacteria 3079
378 Ga0373929_0000679 3300035085 Bacteria 6565
379 Ga0373929_0001724 3300035085 Bacteria 4110
380 Ga0373940_0003081 3300035088 Unclassified 3348
381 Ga0373940_0010332 3300035088 Unclassified 2191
382 Ga0373940_0030715 3300035088 Bacteria 1430
383 Ga0373949_0000538 3300035090 Bacteria 12498
384 Ga0373949_0002296 3300035090 Bacteria 4974
385 Ga0373949_0045716 3300035090 Unclassified 1089
386 Ga0373951_0002318 3300035091 Bacteria 4831
387 Ga0373951_0004499 3300035091 Unclassified 3304
388 Ga0373951_0009749 3300035091 Unclassified 2159
389 Ga0373952_0001426 3300035092 Bacteria 4363
390 Ga0373952_0001646 3300035092 Bacteria 4064
391 Ga0373952_0002784 3300035092 Unclassified 3159
392 Ga0373932_0000234 3300035112 Bacteria 16783
393 Ga0373932_0012318 3300035112 Unclassified 2104
394 Ga0373932_0027094 3300035112 Unclassified 1564
395 Ga0373939_0002425 3300035114 Bacteria 4393
396 Ga0373939_0003130 3300035114 Bacteria 3890
397 Ga0373939_0004366 3300035114 Unclassified 3339
398 Ga0373941_0000120 3300035115 Bacteria 13418
399 Ga0373941_0005201 3300035115 Bacteria 3047
400 Ga0373941_0032100 3300035115 Unclassified 1569
401 Ga0373941_0129556 3300035115 Unclassified 907
402 Ga0373957_0044536 3300035120 Bacteria 1680
403 Ga0373960_0001148 3300035121 Bacteria 5746
404 Ga0373960_0023320 3300035121 Unclassified 1665
405 Ga0373960_0101765 3300035121 Bacteria 932
406 Ga0373943_0239251 3300035170 Bacteria 1017
407 Ga0373943_0349951 3300035170 Unclassified 847
408 Ga0373946_0127974 3300035171 Unclassified 1166
409 Ga0373955_0417269 3300035172 Unclassified 816
410 Ga0373942_0000368 3300035207 Bacteria 12447
411 Ga0373942_0000922 3300035207 Bacteria 8064
412 Ga0373942_0004316 3300035207 Unclassified 3308
413 Ga0373961_0000583 3300035241 Bacteria 13650
414 Ga0373961_0002233 3300035241 Bacteria 5100
415 Ga0373961_0023378 3300035241 Unclassified 1662
416 Ga0373962_0004572 3300035242 Bacteria 3347
417 Ga0373962_0004583 3300035242 Unclassified 3341
418 Ga0373962_0011807 3300035242 Archaea 2194
419 Ga0373962_0097282 3300035242 Bacteria 914
420 Ga0373931_0004385 3300035691 Bacteria 6443
421 Ga0373931_0019588 3300035691 Unclassified 3379
422 Ga0373935_0475132 3300035692 Bacteria 905
423 Ga0373933_0241528 3300035724 Bacteria 1162
424 Ga0373947_0167337 3300035725 Bacteria 1425
425 Ga0373937_0086229 3300036401 Bacteria 2906
426 Ga0373937_0105310 3300036401 Bacteria 2621
427 Ga0373925_0085990 3300037068 Unclassified 2398
428 Ga0373925_0247577 3300037068 Unclassified 1429
429 Ga0451576_0005245 3300045051 Bacteria 16359
430 Ga0451576_0009335 3300045051 Bacteria 11383
431 Ga0451576_0039030 3300045051 Bacteria 5025
432 Ga0451576_0635595 3300045051 Bacteria 1121
433 Ga0466967_0714394 3300045976 Unclassified 993
434 Ga0495603_0332480 3300046455 Bacteria 872
435 Ga0495582_0145593 3300046473 Bacteria 1344
436 Ga0495582_0339540 3300046473 Bacteria 865
437 Ga0495628_0267919 3300046516 Bacteria 1271
438 Ga0495640_0170521 3300046533 Bacteria 1391
439 Ga0495645_0017697 3300046543 Bacteria 5109
440 Ga0495667_0186350 3300046559 Bacteria 1331
441 Ga0495634_0394512 3300046642 Bacteria 823
442 Ga0495635_0051975 3300046663 Unclassified 2823
443 Ga0495647_0089530 3300046681 Bacteria 1260
444 Ga0495647_0173652 3300046681 Bacteria 934
445 Ga0495658_0024772 3300046683 Bacteria 3201
446 Ga0495658_0038005 3300046683 Bacteria 2664
447 Ga0495658_0053579 3300046683 Unclassified 2292
448 Ga0495658_0138773 3300046683 Bacteria 1485
449 Ga0495658_0152013 3300046683 Bacteria 1422
450 Ga0495670_0156074 3300046691 Bacteria 1198
451 Ga0495604_0248121 3300047317 Bacteria 1215
452 Ga0495684_0287768 3300047471 Bacteria 1184
453 Ga0496100_0029675 3300048903 Bacteria 3385
454 Ga0496100_0299173 3300048903 Bacteria 1204
455 Ga0496101_0017661 3300048904 Bacteria 4839
456 Ga0496101_0586212 3300048904 Bacteria 882
457 Ga0496101_0626534 3300048904 Bacteria 850
458 Ga0496102_0026645 3300048905 Bacteria 5159
459 Ga0496102_0425383 3300048905 Bacteria 1247
460 Ga0496104_0056667 3300048907 Unclassified 3707
461 Ga0496104_0112830 3300048907 Unclassified 2607
462 Ga0496104_0267013 3300048907 Unclassified 1624
463 Ga0496106_0127554 3300048909 Unclassified 1993
464 Ga0496106_0245726 3300048909 Bacteria 1430
465 Ga0496106_0261683 3300048909 Unclassified 1384
466 Ga0496106_0342436 3300048909 Bacteria 1201
467 Ga0496108_0120135 3300048911 Bacteria 2253
468 Ga0496110_0117422 3300048913 Bacteria 2396
469 Ga0496110_0411280 3300048913 Bacteria 1233
470 Ga0496112_0062556 3300048915 Bacteria 3671
471 Ga0496112_0089011 3300048915 Bacteria 3055
472 Ga0496112_0319033 3300048915 Bacteria 1498
473 Ga0496113_0036154 3300048916 Bacteria 3617
474 Ga0496114_0001791 3300048917 Bacteria 16303
475 Ga0496115_0156773 3300048918 Unclassified 1881
476 Ga0496115_0228724 3300048918 Bacteria 1534
477 Ga0501033_0362774 3300049570 Bacteria 1013
478 Ga0501036_0004446 3300049572 Bacteria 11329
479 Ga0501038_0113666 3300049574 Unclassified 2240
480 Ga0501039_0240161 3300049575 Unclassified 1424
481 Ga0501040_0011925 3300049576 Bacteria 5686
482 Ga0501040_0551390 3300049576 Bacteria 832
483 Ga0501041_0003414 3300049577 Bacteria 9142
484 Ga0501042_0002403 3300049578 Bacteria 11477
485 Ga0501042_0691045 3300049578 Bacteria 742
486 Ga0501046_0233980 3300049580 Bacteria 1356
487 Ga0501072_0058209 3300049588 Bacteria 3046
488 Ga0501073_0125857 3300049589 Bacteria 1776
489 Ga0501074_0201216 3300049590 Bacteria 1419
490 Ga0501075_0001850 3300049591 Bacteria 13973
491 Ga0501075_0565017 3300049591 Bacteria 868
492 Ga0501076_0000633 3300049592 Bacteria 22451
493 Ga0501079_0063561 3300049741 Bacteria 2847
494 Ga0501080_0010540 3300049742 Bacteria 8466
495 Ga0501081_0003195 3300049743 Bacteria 10409
496 Ga0501081_0383490 3300049743 Unclassified 1039
497 Ga0501045_0013677 3300049824 Bacteria 5736
498 nmdc:mga05p37_118339_c1 3300050507 Bacteria 3255
499 nmdc:mga05p37_14638_c1 3300050507 Bacteria 9423
500 nmdc:mga05p37_170882_c1 3300050507 Bacteria 2651
501 nmdc:mga05p37_172287_c1 3300050507 Bacteria 2639
502 nmdc:mga05p37_20986_c1 3300050507 Bacteria 7907
503 nmdc:mga05p37_28687_c1 3300050507 Bacteria 6789
504 nmdc:mga05p37_537220_c1 3300050507 Unclassified 1334
505 nmdc:mga05p37_5692_c1 3300050507 Bacteria 14646
506 nmdc:mga05p37_60803_c1 3300050507 Bacteria 4651
507 nmdc:mga05p37_8217_c1 3300050507 Bacteria 9077
508 nmdc:mga09592_488072_c1 3300050508 Bacteria 1061
509 nmdc:mga09592_688716_c1 3300050508 Bacteria 871
510 nmdc:mga0qj67_875283_c1 3300050509 Unclassified 709
511 nmdc:mga06r32_315416_c1 3300050510 Unclassified 1549
512 nmdc:mga06r32_355904_c1 3300050510 Unclassified 1448
513 nmdc:mga08y16_11039_c1 3300050511 Bacteria 9484
514 nmdc:mga08y16_202736_c1 3300050511 Bacteria 2056
515 nmdc:mga08y16_266657_c1 3300050511 Bacteria 1768
516 nmdc:mga08y16_388538_c1 3300050511 Bacteria 1430
517 nmdc:mga08y16_66265_c1 3300050511 Bacteria 3769
518 nmdc:mga0n895_29214_c1 3300050512 Bacteria 5256
519 nmdc:mga0n895_2_c1 3300050512 Bacteria 145967
520 nmdc:mga0n895_324467_c1 3300050512 Bacteria 1560
521 nmdc:mga0n895_76236_c1 3300050512 Bacteria 3334
522 nmdc:mga0rr50_35694_c1 3300050513 Bacteria 3573
523 nmdc:mga0rr50_392480_c1 3300050513 Bacteria 1171
524 nmdc:mga0rr50_5010_c1 3300050513 Bacteria 7846
525 nmdc:mga0rr50_625811_c1 3300050513 Bacteria 918
526 nmdc:mga0rr50_752224_c1 3300050513 Unclassified 832
527 nmdc:mga0rr50_80631_c1 3300050513 Bacteria 2510
528 nmdc:mga0rr50_9_c1 3300050513 Bacteria 224716
529 nmdc:mga08x19_1865_c1 3300050514 Bacteria 12917
530 nmdc:mga08x19_23213_c1 3300050514 Bacteria 3847
531 nmdc:mga08x19_271657_c1 3300050514 Unclassified 1173
532 nmdc:mga08x19_31676_c1 3300050514 Bacteria 3329
533 nmdc:mga08x19_317_c1 3300050514 Bacteria 34940
534 nmdc:mga08x19_361630_c1 3300050514 Unclassified 1014
535 nmdc:mga08x19_586668_c1 3300050514 Bacteria 790
536 nmdc:mga0a205_110131_c1 3300050515 Bacteria 2652
537 nmdc:mga0a205_301473_c1 3300050515 Bacteria 1475
538 nmdc:mga0a205_40429_c1 3300050515 Bacteria 4489
539 nmdc:mga0a205_480354_c1 3300050515 Bacteria 1101
540 nmdc:mga0a205_56136_c1 3300050515 Unclassified 3803
541 nmdc:mga0a205_590822_c1 3300050515 Unclassified 964
542 nmdc:mga0a205_83550_c1 3300050515 Bacteria 1387
543 Ga0495601_0029599 3300053077 Bacteria 3398
544 Ga0495595_0258387 3300053084 Bacteria 873
545 Ga0495595_0299298 3300053084 Bacteria 809
546 Ga0495619_0106417 3300053085 Unclassified 1913
547 Ga0495619_0152877 3300053085 Bacteria 1592
548 Ga0500646_0020156 3300053090 Bacteria 1770
549 Ga0500588_0166987 3300053146 Unclassified 804
550 Ga0501084_0101020 3300054114 Unclassified 2422
551 Ga0501082_0004468 3300060353 Bacteria 12216
552 Ga0501082_0562773 3300060353 Unclassified 997
553 Ga0530510_0168063 3300061734 Unclassified 1624
554 Ga0068858_100102829
555 Ga0065714_10167118
556 Ga0065712_10072215
557 Ga0070676_10410207
558 Ga0070683_100357019
559 Ga0070683_100367707
560 Ga0070690_100029016
561 Ga0070690_100125008
562 Ga0070690_100188227
563 Ga0070677_10147644
564 Ga0070666_10079294
565 Ga0070680_100448409
566 Ga0068868_100042700
567 Ga0068868_100267318
568 Ga0068868_100447574
569 Ga0070689_100199593
570 Ga0070689_100458402
571 Ga0070691_10004737
572 Ga0070687_100299470
573 Ga0070668_100070086
574 Ga0070668_100446798
575 Ga0070668_100710750
576 Ga0070669_100017598
577 Ga0070669_100034146
578 Ga0070669_100045272
579 Ga0070669_100129291
580 Ga0070669_100168417
581 Ga0070669_100333746
582 Ga0070675_100000044
583 Ga0070675_100000147
584 Ga0070675_100183180
585 Ga0070671_100220533
586 Ga0070674_100062548
587 Ga0070674_100288865
588 Ga0070673_100013947
589 Ga0070673_100072210
590 Ga0070673_100204871
591 Ga0070673_100233832
592 Ga0070673_100446198
593 Ga0070688_100072563
594 Ga0070667_100005401
595 Ga0070714_100009284
596 Ga0070713_100338391
597 Ga0070701_10017386
598 Ga0070711_100250787
599 Ga0070705_100307453
600 Ga0070705_100323817
601 Ga0070705_100339154
602 Ga0070700_100343819
603 Ga0070694_100121235
604 Ga0070708_100310236
605 Ga0070708_100403506
606 Ga0070662_100159071
607 Ga0070662_100476070
608 Ga0070662_100510014
609 Ga0070662_100575369
610 Ga0068867_100020580
611 Ga0068867_100067810
612 Ga0068867_100140825
613 Ga0068867_100580621
614 Ga0070707_100477620
615 Ga0070698_100562837
616 Ga0070699_100194399
617 Ga0070699_100216784
618 Ga0070699_100520167
619 Ga0070699_100525104
620 Ga0070699_100870304
621 Ga0070684_100049839
622 Ga0070697_100064798
623 Ga0070697_100740567
624 Ga0070697_100866390
625 Ga0070672_100033147
626 Ga0070672_100838210
627 Ga0070686_100042958
628 Ga0070686_100063769
629 Ga0070686_100121696
630 Ga0070686_100176328
631 Ga0070686_100571622
632 Ga0070686_100803929
633 Ga0070696_100098860
634 Ga0070693_100144716
635 Ga0070693_100175472
636 Ga0070665_100009707
637 Ga0070665_100022432
638 Ga0070665_100029234
639 Ga0070704_100091757
640 Ga0068855_100917880
641 Ga0068854_100085859
642 Ga0068854_100368122
643 Ga0068854_100477229
644 Ga0068854_100616547
645 Ga0070702_100035057
646 Ga0070702_100146309
647 Ga0068852_100514829
648 Ga0068859_100238639
649 Ga0068864_100040981
650 Ga0068864_100089624
651 Ga0068866_10101687
652 Ga0068861_100007257
653 Ga0068861_100020601
654 Ga0068861_100039303
655 Ga0068861_100756190
656 Ga0068863_100003475
657 Ga0068863_100277941
658 Ga0068863_101250734
659 Ga0068858_100035798
660 Ga0068858_100062094
661 Ga0068858_100128903
662 Ga0068858_100165238
663 Ga0068858_100450300
664 Ga0068858_100748576
665 Ga0068860_100183251
666 Ga0068860_100388566
667 Ga0068860_100691869
668 Ga0068860_100833498
669 Ga0068862_100002446
670 Ga0068862_100004549
671 Ga0068862_100266761
672 Ga0068862_100635873
673 Ga0081455_10040391
674 Ga0081538_10174235
675 Ga0075432_10006892
676 Ga0070715_10208230
677 Ga0070716_100233862
678 Ga0075367_10295627
679 Ga0097621_100022672
680 Ga0097621_100038888
681 Ga0097621_100214031
682 Ga0097621_100293220
683 Ga0068871_100006744
684 Ga0068871_100016130
685 Ga0068871_100045071
686 Ga0068871_100114306
687 Ga0068871_100377415
688 Ga0075428_100129370
689 Ga0075428_100152024
690 Ga0075430_100701382
691 Ga0075431_100246211
692 Ga0075431_100308957
693 Ga0075433_10043322
694 Ga0075433_10226448
695 Ga0075433_10380108
696 Ga0075433_10457407
697 Ga0075433_10482660
698 Ga0075433_10631934
699 Ga0075434_100000167
700 Ga0075434_100010002
701 Ga0075434_100079263
702 Ga0075434_100165929
703 Ga0075434_100259682
704 Ga0075434_100750030
705 Ga0075429_100028294
706 Ga0075429_100237706
707 Ga0075429_100727002
708 Ga0068865_100001457
709 Ga0068865_100053580
710 Ga0068865_100118645
711 Ga0068865_100301788
712 Ga0068865_100619422
713 Ga0075436_100000240
714 Ga0075436_100001602
715 Ga0075436_100020808
716 Ga0075436_100023724
717 Ga0075436_100062398
718 Ga0075436_100139820
719 Ga0075436_100294672
720 Ga0075436_100359077
721 Ga0075436_100607831
722 Ga0097620_100238630
723 Ga0075435_100000024
724 Ga0075435_100009881
725 Ga0075435_100064977
726 Ga0075435_100104723
727 Ga0105240_10043353
728 Ga0105240_10204766
729 Ga0111539_10001003
730 Ga0111539_10049640
731 Ga0111539_10073611
732 Ga0111539_10234931
733 Ga0111539_10338887
734 Ga0111539_10681668
735 Ga0111539_11232394
736 Ga0105245_10016401
737 Ga0105245_10058788
738 Ga0105245_10626580
739 Ga0105245_10665264
740 Ga0105245_10696190
741 Ga0105247_10004388
742 Ga0114129_10001311
743 Ga0114129_10003299
744 Ga0114129_10005449
745 Ga0114129_10008680
746 Ga0114129_10018351
747 Ga0114129_10137167
748 Ga0114129_10168559
749 Ga0114129_11020049
750 Ga0114129_11142037
751 Ga0114129_11227035
752 Ga0114129_11366594
753 Ga0105243_10048425
754 Ga0105243_10057698
755 Ga0105243_10164390
756 Ga0105243_10416500
757 Ga0105243_11084906
758 Ga0105241_10048253
759 Ga0105241_10209838
760 Ga0105242_10001219
761 Ga0105242_10003981
762 Ga0105242_10010164
763 Ga0105242_10548544
764 Ga0105248_10074247
765 Ga0105248_10118980
766 Ga0105248_10208956
767 Ga0105248_10225524
768 Ga0105248_10365108
769 Ga0105248_10412849
770 Ga0105248_10476488
771 Ga0105248_10530303
772 Ga0105248_10716657
773 Ga0105248_10995503
774 Ga0105249_10192991
775 Ga0105249_10702513
776 Ga0105249_10868449
777 Ga0105246_10484284
778 Ga0157374_10035245
779 Ga0157374_10087266
780 Ga0157374_10837238
781 Ga0157378_10107192
782 Ga0157378_10117872
783 Ga0157378_10157715
784 Ga0163162_10040067
785 Ga0163162_10649446
786 Ga0157375_10102832
787 Ga0157375_10542377
788 Ga0163163_10008222
789 Ga0163163_10062690
790 Ga0163163_10147523
791 Ga0163163_10323855
792 Ga0157380_10124481
793 Ga0157380_10302230
794 Ga0157380_10430171
795 Ga0157380_10433225
796 Ga0157380_10702935
797 Ga0157377_10484548
798 Ga0157377_10542542
799 Ga0157379_10029558
800 Ga0157379_10086912
801 Ga0157379_10197484
802 Ga0157379_10372506
803 Ga0157379_10691846
804 Ga0157379_11146652
805 Ga0157376_10026806
806 Ga0157376_10078744
807 Ga0182005_1052930
808 Ga0207642_10068258
809 Ga0207680_10039770
810 Ga0207680_10130759
811 Ga0207699_10441674
812 Ga0207645_10074581
813 Ga0207684_10430587
814 Ga0207707_10436095
815 Ga0207695_10096874
816 Ga0207695_10121868
817 Ga0207695_10245813
818 Ga0207695_10255048
819 Ga0207660_10280376
820 Ga0207662_10108672
821 Ga0207646_10114710
822 Ga0207681_10019053
823 Ga0207681_10526550
824 Ga0207694_10131863
825 Ga0207694_10418302
826 Ga0207659_10000075
827 Ga0207659_10001942
828 Ga0207659_10061879
829 Ga0207687_10008890
830 Ga0207687_10101086
831 Ga0207687_10236856
832 Ga0207700_10296458
833 Ga0207664_10024825
834 Ga0207644_10411948
835 Ga0207706_10091152
836 Ga0207706_10370575
837 Ga0207706_10636028
838 Ga0207686_10016924
839 Ga0207686_10020017
840 Ga0207686_10046866
841 Ga0207686_10136332
842 Ga0207686_10770350
843 Ga0207709_10115074
844 Ga0207709_10219000
845 Ga0207709_10312055
846 Ga0207670_10232934
847 Ga0207670_10312176
848 Ga0207670_10799672
849 Ga0207669_10009728
850 Ga0207704_10006627
851 Ga0207704_10103167
852 Ga0207665_10253394
853 Ga0207691_10746878
854 Ga0207711_10012990
855 Ga0207711_10069187
856 Ga0207711_10141329
857 Ga0207711_10144655
858 Ga0207711_10215376
859 Ga0207711_10219043
860 Ga0207711_10405556
861 Ga0207711_10649501
862 Ga0207689_10243047
863 Ga0207661_10873172
864 Ga0207679_10069811
865 Ga0207679_10640062
866 Ga0207667_10824836
867 Ga0207651_10038814
868 Ga0207651_10129012
869 Ga0207651_10507491
870 Ga0207712_10252073
871 Ga0207668_10259043
872 Ga0207668_10368709
873 Ga0207640_10007879
874 Ga0207640_10036899
875 Ga0207640_10147852
876 Ga0207658_10619489
877 Ga0207677_10137184
878 Ga0207677_10223400
879 Ga0207703_10022839
880 Ga0207703_10083027
881 Ga0207703_10091337
882 Ga0207703_10173852
883 Ga0207703_10175350
884 Ga0207703_10194836
885 Ga0207703_10199945
886 Ga0207703_10725952
887 Ga0207639_10168492
888 Ga0207708_10001313
889 Ga0207708_10022367
890 Ga0207708_10118696
891 Ga0207641_10016911
892 Ga0207641_10276987
893 Ga0207641_10538997
894 Ga0207648_10081087
895 Ga0207648_10136442
896 Ga0207676_10036235
897 Ga0207676_10092406
898 Ga0207675_100001330
899 Ga0207675_100040343
900 Ga0207675_100051922
901 Ga0207675_100063166
902 Ga0207675_100459056
903 Ga0207428_10014110
904 Ga0207428_10056591
905 Ga0207428_10078180
906 Ga0268266_10006979
907 Ga0268266_10073537
908 Ga0268266_10544337
909 Ga0268265_10013841
910 Ga0268265_10582734
911 Ga0268264_10551222
912 Ga0268264_10575957
913 Ga0268264_10669759
914 Ga0268264_10756022
915 Ga0307408_100330074
916 Ga0316576_10349620
917 Ga0307405_10119842
918 Ga0307405_10683356
919 Ga0307411_10045106
920 Ga0373930_0001203
921 Ga0373930_0007340
922 Ga0373930_0014812
923 Ga0373950_0000745
924 Ga0373958_0000131
925 Ga0373958_0000974
926 Ga0373958_0001333
927 Ga0373959_0004368
928 Ga0373959_0006460
929 Ga0373928_0002383
930 Ga0373928_0003318
931 Ga0373929_0000679
932 Ga0373929_0001724
933 Ga0373940_0003081
934 Ga0373940_0010332
935 Ga0373940_0030715
936 Ga0373949_0000538
937 Ga0373949_0002296
938 Ga0373949_0045716
939 Ga0373951_0002318
940 Ga0373951_0004499
941 Ga0373951_0009749
942 Ga0373952_0001426
943 Ga0373952_0001646
944 Ga0373952_0002784
945 Ga0373932_0000234
946 Ga0373932_0012318
947 Ga0373932_0027094
948 Ga0373939_0002425
949 Ga0373939_0003130
950 Ga0373939_0004366
951 Ga0373941_0000120
952 Ga0373941_0005201
953 Ga0373941_0032100
954 Ga0373941_0129556
955 Ga0373957_0044536
956 Ga0373960_0001148
957 Ga0373960_0023320
958 Ga0373960_0101765
959 Ga0373943_0239251
960 Ga0373943_0349951
961 Ga0373946_0127974
962 Ga0373955_0417269
963 Ga0373942_0000368
964 Ga0373942_0000922
965 Ga0373942_0004316
966 Ga0373961_0000583
967 Ga0373961_0002233
968 Ga0373961_0023378
969 Ga0373962_0004572
970 Ga0373962_0004583
971 Ga0373962_0011807
972 Ga0373962_0097282
973 Ga0373931_0004385
974 Ga0373931_0019588
975 Ga0373935_0475132
976 Ga0373933_0241528
977 Ga0373947_0167337
978 Ga0373937_0086229
979 Ga0373937_0105310
980 Ga0373925_0085990
981 Ga0373925_0247577
982 Ga0451576_0005245
983 Ga0451576_0009335
984 Ga0451576_0039030
985 Ga0451576_0635595
986 Ga0466967_0714394
987 Ga0495603_0332480
988 Ga0495582_0145593
989 Ga0495582_0339540
990 Ga0495628_0267919
991 Ga0495640_0170521
992 Ga0495645_0017697
993 Ga0495667_0186350
994 Ga0495634_0394512
995 Ga0495635_0051975
996 Ga0495647_0089530
997 Ga0495647_0173652
998 Ga0495658_0024772
999 Ga0495658_0038005
1000 Ga0495658_0053579
1001 Ga0495658_0138773
1002 Ga0495658_0152013
1003 Ga0495670_0156074
1004 Ga0495604_0248121
1005 Ga0495684_0287768
1006 Ga0496100_0029675
1007 Ga0496100_0299173
1008 Ga0496101_0017661
1009 Ga0496101_0586212
1010 Ga0496101_0626534
1011 Ga0496102_0026645
1012 Ga0496102_0425383
1013 Ga0496104_0056667
1014 Ga0496104_0112830
1015 Ga0496104_0267013
1016 Ga0496106_0127554
1017 Ga0496106_0245726
1018 Ga0496106_0261683
1019 Ga0496106_0342436
1020 Ga0496108_0120135
1021 Ga0496110_0117422
1022 Ga0496110_0411280
1023 Ga0496112_0062556
1024 Ga0496112_0089011
1025 Ga0496112_0319033
1026 Ga0496113_0036154
1027 Ga0496114_0001791
1028 Ga0496115_0156773
1029 Ga0496115_0228724
1030 Ga0501033_0362774
1031 Ga0501036_0004446
1032 Ga0501038_0113666
1033 Ga0501039_0240161
1034 Ga0501040_0011925
1035 Ga0501040_0551390
1036 Ga0501041_0003414
1037 Ga0501042_0002403
1038 Ga0501042_0691045
1039 Ga0501046_0233980
1040 Ga0501072_0058209
1041 Ga0501073_0125857
1042 Ga0501074_0201216
1043 Ga0501075_0001850
1044 Ga0501075_0565017
1045 Ga0501076_0000633
1046 Ga0501079_0063561
1047 Ga0501080_0010540
1048 Ga0501081_0003195
1049 Ga0501081_0383490
1050 Ga0501045_0013677
1051 nmdc:mga05p37_118339_c1
1052 nmdc:mga05p37_14638_c1
1053 nmdc:mga05p37_170882_c1
1054 nmdc:mga05p37_172287_c1
1055 nmdc:mga05p37_20986_c1
1056 nmdc:mga05p37_28687_c1
1057 nmdc:mga05p37_537220_c1
1058 nmdc:mga05p37_5692_c1
1059 nmdc:mga05p37_60803_c1
1060 nmdc:mga05p37_8217_c1
1061 nmdc:mga09592_488072_c1
1062 nmdc:mga09592_688716_c1
1063 nmdc:mga0qj67_875283_c1
1064 nmdc:mga06r32_315416_c1
1065 nmdc:mga06r32_355904_c1
1066 nmdc:mga08y16_11039_c1
1067 nmdc:mga08y16_202736_c1
1068 nmdc:mga08y16_266657_c1
1069 nmdc:mga08y16_388538_c1
1070 nmdc:mga08y16_66265_c1
1071 nmdc:mga0n895_29214_c1
1072 nmdc:mga0n895_2_c1
1073 nmdc:mga0n895_324467_c1
1074 nmdc:mga0n895_76236_c1
1075 nmdc:mga0rr50_35694_c1
1076 nmdc:mga0rr50_392480_c1
1077 nmdc:mga0rr50_5010_c1
1078 nmdc:mga0rr50_625811_c1
1079 nmdc:mga0rr50_752224_c1
1080 nmdc:mga0rr50_80631_c1
1081 nmdc:mga0rr50_9_c1
1082 nmdc:mga08x19_1865_c1
1083 nmdc:mga08x19_23213_c1
1084 nmdc:mga08x19_271657_c1
1085 nmdc:mga08x19_31676_c1
1086 nmdc:mga08x19_317_c1
1087 nmdc:mga08x19_361630_c1
1088 nmdc:mga08x19_586668_c1
1089 nmdc:mga0a205_110131_c1
1090 nmdc:mga0a205_301473_c1
1091 nmdc:mga0a205_40429_c1
1092 nmdc:mga0a205_480354_c1
1093 nmdc:mga0a205_56136_c1
1094 nmdc:mga0a205_590822_c1
1095 nmdc:mga0a205_83550_c1
1096 Ga0495601_0029599
1097 Ga0495595_0258387
1098 Ga0495595_0299298
1099 Ga0495619_0106417
1100 Ga0495619_0152877
1101 Ga0500646_0020156
1102 Ga0500588_0166987
1103 Ga0501084_0101020
1104 Ga0501082_0004468
1105 Ga0501082_0562773
1106 Ga0530510_0168063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

41

174

0.91

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

44

194

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fbu-assembly2.cif.gz_A the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.9239 40 210
3fbu-assembly2.cif.gz_B-2 the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.9124 40 210
3fbu-assembly2.cif.gz_A the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.9082 40 210
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.8982 40 208
3fbu-assembly2.cif.gz_B-2 the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.8969 40 210
ID Description Score Start End Superfamily
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9479 41 208 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9471 161 211 3.40.630.30
af_Q54VL6_2_179_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.933 40 212 3.40.630.30
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9164 41 208 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.914 135 211 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Y4KKJ6-F1-model_v4 N-acetyltransferase domain-containing protein 0.983 151 215 GO:0005737
GO:0008999
GO:1990189
AF-A0A1F8T0W7-F1-model_v4 N-acetyltransferase domain-containing protein 0.9791 152 217 GO:0005737
GO:0008999
GO:1990189
AF-A0A843SPY4-F1-model_v4 GNAT family N-acetyltransferase 0.9773 40 223 GO:0005737
GO:0008999
GO:1990189
AF-A0A7Y5TZM6-F1-model_v4 GNAT family N-acetyltransferase 0.9628 31 223 GO:0005737
GO:0008999
GO:1990189
AF-A0A5B7SU00-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9528 39 213 GO:0005737
GO:0016747

Map