F462824

General Info

Members Datasets Scaffolds Average Seq Length
553 394 1106 258

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100061045|Ga0070689_1000610452
Length 306
Sequence MVGELDPRRDGLLTRMEKFTASRRRGLLQAAAAWSFTSMFSASAARAKDGPMRQVFITGSTEGLGRGAAVELIDQGHRVVLHARSKERAAALADLAPRAVGVAIGDLASATETRDIADQVNRIGRMDAVIHNAGIFREPNRGSTPEGHAKVLAVNVLAPYMLTALIERPDRLVYLSSSMHRGGEGPLDDIDWSQRPWDTYRAYSESKLYVTALAFAVARHWPKVASNAVDPGWVPTKMGGRGAPDDLEQGHLTQTWLATSDEPAAKSSGSLWFHRAKQQPAPQSLDTRFQDQLMQRLAALTGIKLF

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
180 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
181 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
182 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
183 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
258 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
259 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
260 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
261 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
262 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
263 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
264 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
265 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
266 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
267 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
268 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
269 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
270 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
271 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
272 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
273 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
274 2718217882 Rhizobium sp. N741 Isolate Nodule
275 2718217927 Rhizobium sp. N324 Isolate Nodule
276 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
277 2718218009 Rhizobium sp. N561 Isolate Nodule
278 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
279 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
280 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
281 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
282 2718218363 Rhizobium sp. N113 Isolate Nodule
283 2718218365 Rhizobium sp. N731 Isolate Nodule
284 2718218366 Rhizobium sp. N621 Isolate Nodule
285 2718218423 Rhizobium sp. N941 Isolate Nodule
286 2721755514 Rhizobium sp. N6212 Isolate Nodule
287 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
288 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
289 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
290 2721755809 Rhizobium sp. N541 Isolate Nodule
291 2721755810 Rhizobium sp. N871 Isolate Nodule
292 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
293 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
294 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
295 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
296 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
297 2728369365 Rhizobium sp. N1341 Isolate Nodule
298 2728369397 Rhizobium sp. N1314 Isolate Nodule
299 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
300 2738541293 Rhizobium sp. GV031 Isolate Unclassified
301 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
302 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
303 2791355256 Rhizobium sp. M10 Isolate Nodule
304 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
305 2791355260 Rhizobium sp. L9 Isolate Nodule
306 2791355261 Rhizobium sp. J15 Isolate Nodule
307 2791355263 Rhizobium chutanense C5 Isolate Nodule
308 2791355264 Rhizobium sp. S9 Isolate Nodule
309 2791355265 Rhizobium sp. H4 Isolate Nodule
310 2791355266 Rhizobium sp. L43 Isolate Nodule
311 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
312 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
313 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
314 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
315 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
316 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
317 2838048938 Rhizobium pisi 27/80 Isolate Nodule
318 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
319 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
320 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
321 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
322 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
323 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
324 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
325 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
326 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
327 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
328 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
329 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
330 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
331 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
332 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
333 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
334 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
335 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
336 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
337 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
338 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
339 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
340 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
341 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
342 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
343 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
344 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
345 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
346 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
347 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
348 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
349 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
350 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
351 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
352 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
353 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
354 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
355 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
356 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
357 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
358 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
359 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
360 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
361 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
362 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
363 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
364 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
365 2933599457 Rhizobium phaseoli M3 Isolate Nodule
366 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
367 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
368 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
369 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
370 2936381700 Rhizobium chutanense C16 Isolate Unclassified
371 2996893221 Rhizobium sp. R635 Isolate Nodule
372 8005275841 Rhizobium sp. N4311 Isolate Nodule
373 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
374 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
375 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
376 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
377 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
378 8005382845 Rhizobium sp. R634 Isolate Nodule
379 8005395548 Rhizobium sp. R339 Isolate Nodule
380 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
381 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
382 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
383 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
384 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
385 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
386 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
387 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
388 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
389 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
390 8018176218 Rhizobium sp. N122 Isolate Nodule
391 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
392 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
393 8024501048 Rhizobium sp. H4 Isolate Nodule
394 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 75.05
Metatranscriptomes 0
Isolates 24.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 21.88
Rhizoplane 1.99
Rhizosphere 62.21
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100061045 3300005340 Bacteria 2932
2 JGI25150J39212_1000077 3300002774 Bacteria 59118
3 JGI25151J46595_10000098 3300003187 Bacteria 117930
4 JGI25151J46595_10001603 3300003187 Bacteria 15005
5 JGI25153J46596_10002219 3300003215 Bacteria 11338
6 Ga0055526_1006574 3300003771 Bacteria 6268
7 Ga0065165_1001980 3300005262 Bacteria 19323
8 Ga0065165_1013976 3300005262 Bacteria 3145
9 Ga0065712_10115707 3300005290 Bacteria 1742
10 Ga0070676_10076235 3300005328 Bacteria 2024
11 Ga0070676_10133174 3300005328 Bacteria 1574
12 Ga0070683_100112734 3300005329 Bacteria 2566
13 Ga0070683_100654936 3300005329 Bacteria 1005
14 Ga0070690_100006853 3300005330 Bacteria 6481
15 Ga0070677_10013801 3300005333 Bacteria 2833
16 Ga0068869_100113447 3300005334 Bacteria 2064
17 Ga0070680_100008585 3300005336 Bacteria 7829
18 Ga0070682_100053057 3300005337 Bacteria 2539
19 Ga0070682_100115068 3300005337 Bacteria 1798
20 Ga0070682_100153786 3300005337 Bacteria 1581
21 Ga0070682_100156793 3300005337 Bacteria 1568
22 Ga0070682_100180465 3300005337 Bacteria 1474
23 Ga0068868_100051259 3300005338 Bacteria 3245
24 Ga0068868_100153390 3300005338 Bacteria 1898
25 Ga0070660_100058336 3300005339 Bacteria 2992
26 Ga0070661_100000055 3300005344 Bacteria 88266
27 Ga0070661_100178378 3300005344 Bacteria 1615
28 Ga0070692_10134155 3300005345 Bacteria 1395
29 Ga0070668_100029238 3300005347 Bacteria 4184
30 Ga0070668_100215695 3300005347 Bacteria 1580
31 Ga0070668_100549426 3300005347 Bacteria 1005
32 Ga0070669_100126435 3300005353 Bacteria 1956
33 Ga0070675_100045234 3300005354 Bacteria 3602
34 Ga0070675_100206297 3300005354 Bacteria 1707
35 Ga0070674_100073792 3300005356 Bacteria 2419
36 Ga0070674_100315759 3300005356 Bacteria 1251
37 Ga0070673_100008916 3300005364 Bacteria 6705
38 Ga0070688_100040626 3300005365 Bacteria 2851
39 Ga0070659_100046628 3300005366 Bacteria 3397
40 Ga0070667_100391096 3300005367 Bacteria 1264
41 Ga0070667_100456389 3300005367 Bacteria 1168
42 Ga0070701_10086615 3300005438 Bacteria 1707
43 Ga0070700_100090039 3300005441 Bacteria 2000
44 Ga0070700_100093845 3300005441 Bacteria 1964
45 Ga0070700_100210709 3300005441 Bacteria 1371
46 Ga0070694_100066225 3300005444 Bacteria 2478
47 Ga0070708_100032983 3300005445 Bacteria 4497
48 Ga0070663_100174761 3300005455 Bacteria 1662
49 Ga0070678_100026142 3300005456 Bacteria 3941
50 Ga0070678_100404554 3300005456 Bacteria 1186
51 Ga0070681_10024175 3300005458 Bacteria 6117
52 Ga0070681_10072443 3300005458 Bacteria 3408
53 Ga0070706_100005677 3300005467 Bacteria 11864
54 Ga0070707_100003569 3300005468 Bacteria 14676
55 Ga0070707_100323982 3300005468 Bacteria 1497
56 Ga0070698_100081037 3300005471 Bacteria 3240
57 Ga0070699_100049853 3300005518 Bacteria 3624
58 Ga0070699_100320117 3300005518 Bacteria 1394
59 Ga0070679_100000027 3300005530 Bacteria 114873
60 Ga0070679_100047930 3300005530 Bacteria 4258
61 Ga0070697_100030477 3300005536 Bacteria 4333
62 Ga0068853_100073207 3300005539 Bacteria 2986
63 Ga0068853_100430321 3300005539 Bacteria 1239
64 Ga0070672_100004389 3300005543 Bacteria 9240
65 Ga0070672_100142759 3300005543 Bacteria 1976
66 Ga0070672_100273118 3300005543 Bacteria 1428
67 Ga0070686_100016427 3300005544 Bacteria 4307
68 Ga0070686_100044740 3300005544 Bacteria 2785
69 Ga0070696_100063491 3300005546 Bacteria 2587
70 Ga0070693_100155268 3300005547 Bacteria 1453
71 Ga0070665_100026874 3300005548 Bacteria 5797
72 Ga0070665_100032570 3300005548 Bacteria 5246
73 Ga0070665_100062240 3300005548 Bacteria 3742
74 Ga0070665_100576929 3300005548 Unclassified 1138
75 Ga0070665_100886353 3300005548 Bacteria 905
76 Ga0068855_100181876 3300005563 Bacteria 2376
77 Ga0068855_100295875 3300005563 Bacteria 1793
78 Ga0068855_100459246 3300005563 Bacteria 1389
79 Ga0070664_100055732 3300005564 Bacteria 3357
80 Ga0068857_100708867 3300005577 Bacteria 956
81 Ga0070702_100002834 3300005615 Bacteria 7605
82 Ga0068852_100025063 3300005616 Bacteria 4828
83 Ga0068852_100052007 3300005616 Bacteria 3519
84 Ga0068859_100078691 3300005617 Bacteria 3338
85 Ga0068859_100132285 3300005617 Bacteria 2566
86 Ga0068859_100578591 3300005617 Bacteria 1217
87 Ga0068864_100000113 3300005618 Bacteria 79654
88 Ga0068864_100097930 3300005618 Bacteria 2597
89 Ga0068864_100650436 3300005618 Bacteria 1026
90 Ga0068861_100018230 3300005719 Bacteria 4997
91 Ga0068861_100030226 3300005719 Bacteria 3968
92 Ga0068861_100073548 3300005719 Bacteria 2655
93 Ga0068861_100170451 3300005719 Bacteria 1803
94 Ga0068870_10141466 3300005840 Bacteria 1408
95 Ga0068863_100000036 3300005841 Bacteria 164593
96 Ga0068863_100042296 3300005841 Bacteria 4329
97 Ga0068863_100061210 3300005841 Bacteria 3559
98 Ga0068863_100095321 3300005841 Bacteria 2824
99 Ga0068863_100121738 3300005841 Bacteria 2488
100 Ga0068858_100000030 3300005842 Bacteria 144357
101 Ga0068858_100019444 3300005842 Bacteria 6352
102 Ga0068858_100182751 3300005842 Bacteria 1980
103 Ga0068860_100034286 3300005843 Bacteria 4868
104 Ga0068860_100326201 3300005843 Bacteria 1507
105 Ga0068860_100582894 3300005843 Bacteria 1123
106 Ga0068860_101071960 3300005843 Bacteria 825
107 Ga0068862_100074749 3300005844 Bacteria 2930
108 Ga0068862_100117107 3300005844 Bacteria 2345
109 Ga0068862_100183043 3300005844 Bacteria 1881
110 Ga0081539_10005987 3300005985 Bacteria 11973
111 Ga0070717_10006829 3300006028 Bacteria 8423
112 Ga0070717_10175698 3300006028 Bacteria 1864
113 Ga0070717_10201807 3300006028 Bacteria 1742
114 Ga0075432_10001892 3300006058 Bacteria 6936
115 Ga0097621_100599603 3300006237 Bacteria 1007
116 Ga0068871_100194054 3300006358 Bacteria 1750
117 Ga0068871_100222344 3300006358 Bacteria 1636
118 Ga0075428_100203063 3300006844 Bacteria 2142
119 Ga0075431_100022514 3300006847 Bacteria 6442
120 Ga0068865_100032896 3300006881 Bacteria 3469
121 Ga0068865_100122702 3300006881 Bacteria 1935
122 Ga0068865_100182681 3300006881 Bacteria 1616
123 Ga0075436_100072010 3300006914 Bacteria 2391
124 Ga0097620_100078689 3300006931 Bacteria 3338
125 Ga0097620_100132285 3300006931 Bacteria 2566
126 Ga0097620_100578596 3300006931 Bacteria 1217
127 Ga0075435_100465669 3300007076 Bacteria 1091
128 Ga0111539_10010148 3300009094 Bacteria 11868
129 Ga0111539_10102350 3300009094 Bacteria 3361
130 Ga0111539_10127043 3300009094 Bacteria 2986
131 Ga0111539_10391153 3300009094 Bacteria 1619
132 Ga0111539_11055821 3300009094 Bacteria 944
133 Ga0105245_10005127 3300009098 Bacteria 11513
134 Ga0105245_10043340 3300009098 Bacteria 4013
135 Ga0105245_10065355 3300009098 Bacteria 3290
136 Ga0105247_10017709 3300009101 Bacteria 4272
137 Ga0114129_10033719 3300009147 Bacteria 7233
138 Ga0105243_10005551 3300009148 Bacteria 9824
139 Ga0105243_10366507 3300009148 Bacteria 1328
140 Ga0105243_10595133 3300009148 Bacteria 1064
141 Ga0105242_10072900 3300009176 Bacteria 2853
142 Ga0105248_10134653 3300009177 Bacteria 2788
143 Ga0105248_10474869 3300009177 Bacteria 1409
144 Ga0105238_10103733 3300009551 Bacteria 2825
145 Ga0105238_10221157 3300009551 Bacteria 1870
146 Ga0105249_10028009 3300009553 Bacteria 5086
147 Ga0123342_1015300 3300009766 Bacteria 7019
148 Ga0105239_11046615 3300010375 Bacteria 939
149 Ga0157374_10181905 3300013296 Bacteria 2054
150 Ga0157378_10607185 3300013297 Bacteria 1106
151 Ga0163162_10391256 3300013306 Bacteria 1523
152 Ga0163162_10595023 3300013306 Bacteria 1233
153 Ga0157372_10353400 3300013307 Bacteria 1712
154 Ga0157372_10472725 3300013307 Bacteria 1461
155 Ga0157375_10008060 3300013308 Bacteria 9215
156 Ga0157375_10131627 3300013308 Bacteria 2621
157 Ga0157375_10224364 3300013308 Bacteria 2038
158 Ga0157375_10609174 3300013308 Bacteria 1251
159 Ga0157375_11114074 3300013308 Unclassified 924
160 Ga0163163_10037508 3300014325 Bacteria 4715
161 Ga0163163_10130156 3300014325 Bacteria 2556
162 Ga0163163_10894906 3300014325 Bacteria 951
163 Ga0157380_10033563 3300014326 Bacteria 3953
164 Ga0157380_10087748 3300014326 Bacteria 2558
165 Ga0157380_10171727 3300014326 Bacteria 1895
166 Ga0157377_10002148 3300014745 Bacteria 8661
167 Ga0157379_10096918 3300014968 Bacteria 2647
168 Ga0157376_10210999 3300014969 Bacteria 1793
169 Ga0157376_10567593 3300014969 Bacteria 1125
170 Ga0157376_10573558 3300014969 Bacteria 1119
171 Ga0163161_10112951 3300017792 Bacteria 2033
172 Ga0163161_10367025 3300017792 Bacteria 1148
173 Ga0207425_1000061 3300025245 Bacteria 138680
174 Ga0209129_1000134 3300025258 Bacteria 125870
175 Ga0209129_1003891 3300025258 Bacteria 6211
176 Ga0209673_1002235 3300025273 Bacteria 14001
177 Ga0209673_1004694 3300025273 Bacteria 7204
178 Ga0209673_1016013 3300025273 Bacteria 2820
179 Ga0209025_1000205 3300025294 Bacteria 141452
180 Ga0209025_1000254 3300025294 Bacteria 125870
181 Ga0209564_1001889 3300025295 Bacteria 18834
182 Ga0209758_1001317 3300025297 Bacteria 30179
183 Ga0209758_1003048 3300025297 Bacteria 15950
184 Ga0209758_1008813 3300025297 Bacteria 6425
185 Ga0209050_1017700 3300025298 Bacteria 2819
186 Ga0209256_1006632 3300025299 Bacteria 6040
187 Ga0209256_1007712 3300025299 Bacteria 5216
188 Ga0209256_1044006 3300025299 Bacteria 1117
189 Ga0207426_1000784 3300025302 Bacteria 34742
190 Ga0209051_1000570 3300025303 Bacteria 44783
191 Ga0209257_1001453 3300025304 Bacteria 28002
192 Ga0207682_10010451 3300025893 Bacteria 3639
193 Ga0207682_10013770 3300025893 Bacteria 3149
194 Ga0207692_10005957 3300025898 Bacteria 4922
195 Ga0207710_10052067 3300025900 Unclassified 1840
196 Ga0207688_10008302 3300025901 Bacteria 5645
197 Ga0207685_10069885 3300025905 Bacteria 1420
198 Ga0207699_10006237 3300025906 Bacteria 5756
199 Ga0207645_10057570 3300025907 Bacteria 2482
200 Ga0207645_10089981 3300025907 Bacteria 1974
201 Ga0207643_10008590 3300025908 Bacteria 5478
202 Ga0207643_10057426 3300025908 Bacteria 2215
203 Ga0207684_10006672 3300025910 Bacteria 10487
204 Ga0207684_10157475 3300025910 Bacteria 1955
205 Ga0207684_10372705 3300025910 Bacteria 1228
206 Ga0207654_10148316 3300025911 Bacteria 1503
207 Ga0207707_10042545 3300025912 Bacteria 3964
208 Ga0207707_10087314 3300025912 Bacteria 2725
209 Ga0207660_10003805 3300025917 Bacteria 9825
210 Ga0207662_10066790 3300025918 Bacteria 2167
211 Ga0207657_10023837 3300025919 Bacteria 5687
212 Ga0207657_10067312 3300025919 Bacteria 3046
213 Ga0207649_10000103 3300025920 Bacteria 69885
214 Ga0207649_10165597 3300025920 Bacteria 1535
215 Ga0207652_10000001 3300025921 Bacteria 1006643
216 Ga0207652_10332589 3300025921 Bacteria 1372
217 Ga0207646_10052799 3300025922 Bacteria 3637
218 Ga0207646_10185567 3300025922 Bacteria 1878
219 Ga0207694_10033368 3300025924 Bacteria 3943
220 Ga0207694_10440146 3300025924 Bacteria 1087
221 Ga0207659_10038662 3300025926 Bacteria 3321
222 Ga0207687_10095465 3300025927 Bacteria 2178
223 Ga0207687_10251227 3300025927 Bacteria 1406
224 Ga0207644_10231341 3300025931 Bacteria 1469
225 Ga0207690_10305894 3300025932 Bacteria 1245
226 Ga0207706_10113026 3300025933 Bacteria 2389
227 Ga0207686_10017766 3300025934 Bacteria 4014
228 Ga0207686_10425691 3300025934 Bacteria 1016
229 Ga0207709_10321827 3300025935 Bacteria 1158
230 Ga0207709_10417363 3300025935 Bacteria 1030
231 Ga0207670_10040096 3300025936 Bacteria 3071
232 Ga0207669_10001673 3300025937 Bacteria 9431
233 Ga0207704_10317046 3300025938 Bacteria 1201
234 Ga0207691_10003849 3300025940 Bacteria 14561
235 Ga0207711_10098741 3300025941 Bacteria 2580
236 Ga0207711_10118358 3300025941 Bacteria 2363
237 Ga0207689_10033730 3300025942 Bacteria 4253
238 Ga0207689_10071320 3300025942 Bacteria 2853
239 Ga0207689_10132827 3300025942 Bacteria 2049
240 Ga0207689_10181554 3300025942 Bacteria 1735
241 Ga0207689_10355483 3300025942 Bacteria 1218
242 Ga0207679_10646215 3300025945 Bacteria 956
243 Ga0207667_10233460 3300025949 Bacteria 1883
244 Ga0207667_10283384 3300025949 Bacteria 1693
245 Ga0207667_10465631 3300025949 Bacteria 1284
246 Ga0207712_10394378 3300025961 Bacteria 1162
247 Ga0207658_10128111 3300025986 Bacteria 2035
248 Ga0207658_10442000 3300025986 Bacteria 1150
249 Ga0207677_10323469 3300026023 Bacteria 1282
250 Ga0207703_10000037 3300026035 Bacteria 176167
251 Ga0207703_10000320 3300026035 Bacteria 52127
252 Ga0207703_10594585 3300026035 Bacteria 1046
253 Ga0207639_10138210 3300026041 Bacteria 2027
254 Ga0207639_10576850 3300026041 Bacteria 1035
255 Ga0207678_10079985 3300026067 Bacteria 2798
256 Ga0207708_10131391 3300026075 Bacteria 1958
257 Ga0207708_10132080 3300026075 Bacteria 1953
258 Ga0207708_10160116 3300026075 Bacteria 1777
259 Ga0207708_10160797 3300026075 Bacteria 1773
260 Ga0207708_10339718 3300026075 Bacteria 1229
261 Ga0207702_10224366 3300026078 Bacteria 1752
262 Ga0207641_10000055 3300026088 Bacteria 170796
263 Ga0207641_10108667 3300026088 Bacteria 2455
264 Ga0207641_10345398 3300026088 Bacteria 1417
265 Ga0207641_10694477 3300026088 Bacteria 1002
266 Ga0207648_10072401 3300026089 Bacteria 3004
267 Ga0207648_10183935 3300026089 Bacteria 1850
268 Ga0207648_10201835 3300026089 Bacteria 1764
269 Ga0207648_10202134 3300026089 Bacteria 1762
270 Ga0207676_10000120 3300026095 Bacteria 69298
271 Ga0207676_10080109 3300026095 Bacteria 2650
272 Ga0207676_10174372 3300026095 Bacteria 1876
273 Ga0207676_10215087 3300026095 Bacteria 1708
274 Ga0207674_10093572 3300026116 Bacteria 2994
275 Ga0207675_100000752 3300026118 Bacteria 32270
276 Ga0207675_100005574 3300026118 Bacteria 12049
277 Ga0207675_100107040 3300026118 Bacteria 2636
278 Ga0207675_100113252 3300026118 Bacteria 2561
279 Ga0207683_10004539 3300026121 Bacteria 11968
280 Ga0207683_10239973 3300026121 Bacteria 1653
281 Ga0207698_10410597 3300026142 Bacteria 1297
282 Ga0207428_10006356 3300027907 Bacteria 10928
283 Ga0207428_10248600 3300027907 Bacteria 1327
284 Ga0268266_10013544 3300028379 Bacteria 7022
285 Ga0268266_10309797 3300028379 Unclassified 1475
286 Ga0268265_10050157 3300028380 Bacteria 3143
287 Ga0268265_10081258 3300028380 Bacteria 2559
288 Ga0268265_10213087 3300028380 Bacteria 1685
289 Ga0265318_10071771 3300028577 Unclassified 1283
290 Ga0265330_10092108 3300031235 Bacteria 1301
291 Ga0265325_10079506 3300031241 Bacteria 1632
292 Ga0265339_10020991 3300031249 Bacteria 3808
293 Ga0265331_10000507 3300031250 Bacteria 36469
294 Ga0307408_100025168 3300031548 Bacteria 4074
295 Ga0307413_10003205 3300031824 Bacteria 6845
296 Ga0307410_10011604 3300031852 Bacteria 5047
297 Ga0307406_10243415 3300031901 Bacteria 1350
298 Ga0307407_10165719 3300031903 Bacteria 1451
299 Ga0307409_100090213 3300031995 Bacteria 2508
300 Ga0307416_100094090 3300032002 Bacteria 2583
301 Ga0307416_100279570 3300032002 Bacteria 1645
302 Ga0307416_100314857 3300032002 Bacteria 1564
303 Ga0307411_10010668 3300032005 Bacteria 4912
304 Ga0307415_100011373 3300032126 Bacteria 5090
305 Ga0307507_10087329 3300033179 Bacteria 2697
306 Ga0373949_0008482 3300035090 Bacteria 2249
307 Ga0373932_0015355 3300035112 Bacteria 1940
308 Ga0373939_0033911 3300035114 Bacteria 1495
309 Ga0373925_0160176 3300037068 Bacteria 1772
310 Ga0436365_0733081 3300039437 Bacteria 2149
311 Ga0436365_1028749 3300039437 Bacteria 5833
312 Ga0436360_1279626 3300039438 Bacteria 1245
313 Ga0436363_1486060 3300039450 Bacteria 3092
314 Ga0451807_1803611 3300041486 Bacteria 1092
315 Ga0451837_1803900 3300041494 Bacteria 1555
316 Ga0451839_0776885 3300041496 Bacteria 7352
317 Ga0451839_1243365 3300041496 Bacteria 3201
318 Ga0451841_0426999 3300041498 Bacteria 4880
319 Ga0451845_0276993 3300041501 Bacteria 2324
320 Ga0451845_0374388 3300041501 Bacteria 5792
321 Ga0451847_0322212 3300041503 Bacteria 2070
322 Ga0451849_0430649 3300041505 Bacteria 2074
323 Ga0451849_0678553 3300041505 Bacteria 3059
324 Ga0451851_0009363 3300041507 Bacteria 2137
325 Ga0451851_0052719 3300041507 Bacteria 3731
326 Ga0451843_0200699 3300041509 Bacteria 2168
327 Ga0451843_1362565 3300041509 Bacteria 1506
328 Ga0451853_0785717 3300041512 Bacteria 2743
329 Ga0451853_1289736 3300041512 Bacteria 2747
330 Ga0450923_011745 3300042125 Bacteria 1582
331 Ga0450896_016364 3300042133 Bacteria 1065
332 Ga0466969_0001427 3300044656 Bacteria 12898
333 Ga0466963_0099316 3300044694 Bacteria 1991
334 Ga0466959_0049118 3300045049 Bacteria 3100
335 Ga0451576_0549793 3300045051 Bacteria 1213
336 Ga0495629_0259275 3300046459 Bacteria 1195
337 Ga0495580_0185988 3300046472 Bacteria 1434
338 Ga0495585_0172791 3300046492 Bacteria 1115
339 Ga0495594_0008603 3300046499 Bacteria 5261
340 Ga0495606_0089131 3300046507 Bacteria 1901
341 Ga0495610_0054218 3300046512 Bacteria 1938
342 Ga0495630_0074405 3300046517 Bacteria 2558
343 Ga0495648_0015167 3300046524 Bacteria 5610
344 Ga0495663_0092795 3300046525 Bacteria 986
345 Ga0495666_0060871 3300046526 Bacteria 1804
346 Ga0495633_0135261 3300046558 Bacteria 1140
347 Ga0495656_0147766 3300046615 Unclassified 1133
348 Ga0495611_0177315 3300046648 Bacteria 996
349 Ga0495625_0008124 3300046660 Bacteria 8994
350 Ga0495635_0161268 3300046663 Bacteria 1526
351 Ga0495647_0115334 3300046681 Bacteria 1125
352 Ga0495658_0006679 3300046683 Bacteria 5670
353 Ga0495658_0008720 3300046683 Bacteria 5036
354 Ga0495613_0062694 3300046689 Bacteria 2720
355 Ga0495660_0061925 3300046810 Bacteria 2007
356 Ga0495683_0126340 3300047323 Bacteria 1210
357 Ga0495687_026823 3300047443 Bacteria 2705
358 Ga0495593_0098091 3300047673 Bacteria 1505
359 Ga0495593_0201858 3300047673 Bacteria 999
360 Ga0496101_0063604 3300048904 Bacteria 2686
361 Ga0496101_0179171 3300048904 Bacteria 1631
362 Ga0496104_0681012 3300048907 Bacteria 936
363 Ga0496105_0108798 3300048908 Bacteria 2288
364 Ga0496105_0445866 3300048908 Bacteria 1022
365 Ga0496107_0048336 3300048910 Bacteria 3064
366 Ga0496108_0380781 3300048911 Unclassified 1232
367 Ga0496109_0335681 3300048912 Bacteria 1427
368 Ga0496114_0445618 3300048917 Bacteria 1147
369 Ga0496115_0050093 3300048918 Bacteria 3344
370 Ga0496116_0006916 3300048919 Bacteria 10171
371 Ga0496117_0007922 3300048920 Bacteria 10208
372 Ga0496118_0001534 3300048921 Bacteria 34336
373 Ga0496118_0062376 3300048921 Bacteria 2752
374 Ga0496118_0184525 3300048921 Unclassified 1256
375 Ga0496119_0017997 3300048922 Bacteria 5284
376 Ga0496121_0025278 3300048924 Bacteria 5641
377 Ga0496122_0055866 3300048925 Plasmid 2949
378 Ga0496122_0300602 3300048925 Bacteria 865
379 Ga0496123_0028685 3300048926 Bacteria 4113
380 Ga0496124_0023799 3300048927 Bacteria 5582
381 Ga0496125_0000302 3300048928 Bacteria 96762
382 Ga0496125_0081232 3300048928 Bacteria 2477
383 Ga0496126_0013723 3300048929 Bacteria 8218
384 Ga0496126_0017337 3300048929 Bacteria 7178
385 Ga0496126_0139780 3300048929 Bacteria 2086
386 Ga0501042_0078722 3300049578 Bacteria 2361
387 Ga0501048_0160981 3300049582 Bacteria 1589
388 Ga0501067_0128093 3300049583 Bacteria 1412
389 Ga0501068_0019673 3300049584 Bacteria 3924
390 Ga0501070_0041435 3300049586 Bacteria 3837
391 Ga0501071_0048221 3300049587 Bacteria 3062
392 Ga0501072_0091155 3300049588 Bacteria 2420
393 Ga0501073_0002828 3300049589 Bacteria 13003
394 Ga0501074_0003213 3300049590 Bacteria 11535
395 Ga0501074_0091070 3300049590 Bacteria 2184
396 Ga0501075_0022065 3300049591 Bacteria 4648
397 Ga0501076_0059296 3300049592 Bacteria 3044
398 Ga0501077_0005480 3300049593 Bacteria 7724
399 Ga0501079_0023531 3300049741 Bacteria 4727
400 Ga0501083_0307770 3300049744 Bacteria 1030
401 nmdc:mga00v17_339316_c1 3300050491 Bacteria 977
402 nmdc:mga05p37_547800_c1 3300050507 Bacteria 1318
403 nmdc:mga08y16_182039_c1 3300050511 Bacteria 2182
404 nmdc:mga08y16_247311_c1 3300050511 Bacteria 1843
405 nmdc:mga08y16_321663_c1 3300050511 Bacteria 1593
406 nmdc:mga0n895_22043_c1 3300050512 Bacteria 5969
407 nmdc:mga0rr50_13223_c2 3300050513 Bacteria 1029
408 nmdc:mga0rr50_90494_c1 3300050513 Bacteria 2381
409 nmdc:mga0rr50_94716_c1 3300050513 Bacteria 2332
410 nmdc:mga0a205_220413_c1 3300050515 Bacteria 1783
411 Ga0500608_069281 3300053122 Bacteria 1678
412 Ga0500616_0005582 3300053153 Bacteria 8502
413 Ga0500622_0018868 3300053156 Bacteria 3665
414 Ga0501084_0030512 3300054114 Bacteria 4507
415 Ga0530510_0186543 3300061734 Bacteria 1539
416 2509388100 2509276021 Bacteria 7634384
417 2510131786 2510065019 Bacteria 6903379
418 2510898077 2510461076 Bacteria 8618824
419 2513632448 2513237093 Bacteria 7545552
420 2513711787 2513237103 Bacteria 7647401
421 2514023405 2513237162 Bacteria 7468464
422 2515647000 2515154114 Bacteria 7848616
423 2515660692 2515154116 Bacteria 7552979
424 2515742769 2515154134 Bacteria 7220242
425 2517074961 2516653085 Bacteria 7346596
426 2585267882 2582581306 Bacteria 6450535
427 2585387013 2582581865 Bacteria 6644329
428 2585397358 2582581866 Bacteria 6859583
429 2585525127 2585427526 Bacteria 7258840
430 2585539979 2585427528 Bacteria 6842387
431 2585837961 2585427593 Bacteria 7141551
432 2616295943 2615840624 Bacteria 6557588
433 2719179849 2718217882 Bacteria 6556348
434 2719384471 2718217927 Bacteria 6972593
435 2719664214 2718217997 Bacteria 6740740
436 2719730519 2718218009 Bacteria 6478651
437 2720490633 2718218199 Bacteria 6740745
438 2720612002 2718218232 Bacteria 6720332
439 2720630254 2718218235 Bacteria 6630699
440 2720773949 2718218269 Bacteria 6906114
441 2721145942 2718218363 Bacteria 6524337
442 2721157477 2718218365 Bacteria 6274507
443 2721162822 2718218366 Bacteria 6425255
444 2721398183 2718218423 Bacteria 6438183
445 2722838992 2721755514 Bacteria 6424414
446 2723025617 2721755556 Bacteria 6745503
447 2723559205 2721755684 Bacteria 6859907
448 2723565834 2721755685 Bacteria 6704835
449 2724036993 2721755809 Bacteria 6438790
450 2724043275 2721755810 Bacteria 6479005
451 2724088556 2721755819 Bacteria 6906405
452 2724103099 2721755822 Bacteria 6726041
453 2724108938 2721755823 Bacteria 6752556
454 2725945897 2724679232 Bacteria 7646494
455 2730106553 2728369352 Bacteria 6745171
456 2730163086 2728369365 Bacteria 6555560
457 2730297109 2728369397 Bacteria 6274511
458 2738698266 2738541272 Bacteria 6848551
459 2738802688 2738541293 Bacteria 7065685
460 2739034844 2738541333 Bacteria 7106503
461 2766062306 2765235942 Bacteria 7445910
462 2793299643 2791355256 Bacteria 6798008
463 2793319036 2791355259 Bacteria 7254731
464 2793320000 2791355260 Bacteria 6598818
465 2793328360 2791355261 Bacteria 6661293
466 2793342823 2791355263 Bacteria 6872478
467 2793349392 2791355264 Bacteria 6429314
468 2793353112 2791355265 Bacteria 6539969
469 2793360902 2791355266 Bacteria 7116587
470 2805927293 2802429605 Bacteria 6875453
471 2805937890 2802429606 Bacteria 6346811
472 2806069259 2802429636 Bacteria 7597525
473 2838021715 2838016132 Bacteria 6577831
474 2838026599 2838022645 Bacteria 6494267
475 2838048791 2838042994 Bacteria 6046894
476 2838054629 2838048938 Bacteria 6044578
477 2838073968 2838068647 Bacteria 6208656
478 2838673491 2838668709 Bacteria 6671819
479 2838692502 2838686498 Bacteria 7807632
480 2838695086 2838694306 Bacteria 6853137
481 2838705826 2838701080 Bacteria 6669771
482 2838708462 2838707686 Bacteria 6619912
483 2838736717 2838729681 Bacteria 7400765
484 2838749704 2838742623 Bacteria 7396178
485 2841855040 2841851746 Bacteria 7532261
486 2841866511 2841864319 Bacteria 6742987
487 2842080304 2842077413 Bacteria 6508645
488 2842117902 2842110456 Bacteria 7656360
489 2842120923 2842118031 Bacteria 7033875
490 2842150678 2842146304 Bacteria 5957337
491 2842163619 2842156927 Bacteria 6894975
492 2842169310 2842163707 Bacteria 6916235
493 2842187223 2842180545 Bacteria 6888678
494 2842193186 2842192696 Bacteria 6147454
495 2842203067 2842198810 Bacteria 6608673
496 2842221093 2842217011 Bacteria 7497767
497 2842236902 2842229732 Bacteria 7475766
498 2842237874 2842237096 Bacteria 6620661
499 2842250656 2842243621 Bacteria 7421798
500 2842255701 2842250916 Bacteria 6579627
501 2842264523 2842257432 Bacteria 7401195
502 2842276971 2842271015 Bacteria 7807131
503 2842289608 2842285085 Bacteria 6011953
504 2842293963 2842291075 Bacteria 7076806
505 2842306158 2842304105 Bacteria 7023636
506 2842317653 2842311132 Bacteria 6616990
507 2842342764 2842341865 Bacteria 7003929
508 2842368630 2842363717 Bacteria 6844742
509 2842371344 2842370503 Bacteria 7038661
510 2842380360 2842377471 Bacteria 7140707
511 2842387431 2842384541 Bacteria 7057858
512 2842402259 2842395702 Bacteria 6780583
513 2842406957 2842402390 Bacteria 6681310
514 2842413546 2842409023 Bacteria 6687331
515 2842420491 2842415677 Bacteria 6596907
516 2842427596 2842422224 Bacteria 6239196
517 2842495352 2842489311 Bacteria 6620893
518 2842501788 2842495871 Bacteria 6820686
519 2844455653 2844454524 Bacteria 7952546
520 2857523916 2857516855 Bacteria 7787325
521 2894235126 2894232714 Bacteria 8834183
522 2933573228 2933570622 Bacteria 7023390
523 2933593944 2933586486 Bacteria 7667493
524 2933604520 2933599457 Bacteria 5858799
525 2935895609 2935894831 Bacteria 6620579
526 2935908392 2935901341 Bacteria 7341747
527 2936368631 2936367885 Bacteria 7324495
528 2936377725 2936375103 Bacteria 6652732
529 2936383938 2936381700 Bacteria 7006523
530 2996893723 2996893221 Bacteria 5823108
531 8005279186 8005275841 Bacteria 6929066
532 8005283738 8005282627 Bacteria 6675747
533 8005292260 8005289223 Bacteria 6634003
534 8005304142 8005301065 Bacteria 6614431
535 8005312982 8005307578 Bacteria 7395396
536 8005377136 8005376324 Bacteria 6590079
537 8005386294 8005382845 Bacteria 6732062
538 8005401769 8005395548 Bacteria 6806915
539 8005435260 8005430974 Bacteria 6689030
540 8005498953 8005497431 Bacteria 6477605
541 8005562649 8005556819 Bacteria 6908598
542 8005569922 8005563573 Bacteria 7153261
543 8005620128 8005619151 Bacteria 7030230
544 8005628738 8005626139 Bacteria 6534237
545 8005670367 8005668836 Bacteria 6953162
546 8005690563 8005688590 Bacteria 6610080
547 8005697159 8005695170 Bacteria 6912330
548 8018133414 8018127388 Bacteria 7351159
549 8018179287 8018176218 Bacteria 6896178
550 8023683466 8023680758 Bacteria 7729763
551 8024480592 8024479707 Bacteria 6954785
552 8024502646 8024501048 Bacteria 6427847
553 8047714599 8047710418 Bacteria 11023148
554 Ga0070689_100061045
555 JGI25150J39212_1000077
556 JGI25151J46595_10000098
557 JGI25151J46595_10001603
558 JGI25153J46596_10002219
559 Ga0055526_1006574
560 Ga0065165_1001980
561 Ga0065165_1013976
562 Ga0065712_10115707
563 Ga0070676_10076235
564 Ga0070676_10133174
565 Ga0070683_100112734
566 Ga0070683_100654936
567 Ga0070690_100006853
568 Ga0070677_10013801
569 Ga0068869_100113447
570 Ga0070680_100008585
571 Ga0070682_100053057
572 Ga0070682_100115068
573 Ga0070682_100153786
574 Ga0070682_100156793
575 Ga0070682_100180465
576 Ga0068868_100051259
577 Ga0068868_100153390
578 Ga0070660_100058336
579 Ga0070661_100000055
580 Ga0070661_100178378
581 Ga0070692_10134155
582 Ga0070668_100029238
583 Ga0070668_100215695
584 Ga0070668_100549426
585 Ga0070669_100126435
586 Ga0070675_100045234
587 Ga0070675_100206297
588 Ga0070674_100073792
589 Ga0070674_100315759
590 Ga0070673_100008916
591 Ga0070688_100040626
592 Ga0070659_100046628
593 Ga0070667_100391096
594 Ga0070667_100456389
595 Ga0070701_10086615
596 Ga0070700_100090039
597 Ga0070700_100093845
598 Ga0070700_100210709
599 Ga0070694_100066225
600 Ga0070708_100032983
601 Ga0070663_100174761
602 Ga0070678_100026142
603 Ga0070678_100404554
604 Ga0070681_10024175
605 Ga0070681_10072443
606 Ga0070706_100005677
607 Ga0070707_100003569
608 Ga0070707_100323982
609 Ga0070698_100081037
610 Ga0070699_100049853
611 Ga0070699_100320117
612 Ga0070679_100000027
613 Ga0070679_100047930
614 Ga0070697_100030477
615 Ga0068853_100073207
616 Ga0068853_100430321
617 Ga0070672_100004389
618 Ga0070672_100142759
619 Ga0070672_100273118
620 Ga0070686_100016427
621 Ga0070686_100044740
622 Ga0070696_100063491
623 Ga0070693_100155268
624 Ga0070665_100026874
625 Ga0070665_100032570
626 Ga0070665_100062240
627 Ga0070665_100576929
628 Ga0070665_100886353
629 Ga0068855_100181876
630 Ga0068855_100295875
631 Ga0068855_100459246
632 Ga0070664_100055732
633 Ga0068857_100708867
634 Ga0070702_100002834
635 Ga0068852_100025063
636 Ga0068852_100052007
637 Ga0068859_100078691
638 Ga0068859_100132285
639 Ga0068859_100578591
640 Ga0068864_100000113
641 Ga0068864_100097930
642 Ga0068864_100650436
643 Ga0068861_100018230
644 Ga0068861_100030226
645 Ga0068861_100073548
646 Ga0068861_100170451
647 Ga0068870_10141466
648 Ga0068863_100000036
649 Ga0068863_100042296
650 Ga0068863_100061210
651 Ga0068863_100095321
652 Ga0068863_100121738
653 Ga0068858_100000030
654 Ga0068858_100019444
655 Ga0068858_100182751
656 Ga0068860_100034286
657 Ga0068860_100326201
658 Ga0068860_100582894
659 Ga0068860_101071960
660 Ga0068862_100074749
661 Ga0068862_100117107
662 Ga0068862_100183043
663 Ga0081539_10005987
664 Ga0070717_10006829
665 Ga0070717_10175698
666 Ga0070717_10201807
667 Ga0075432_10001892
668 Ga0097621_100599603
669 Ga0068871_100194054
670 Ga0068871_100222344
671 Ga0075428_100203063
672 Ga0075431_100022514
673 Ga0068865_100032896
674 Ga0068865_100122702
675 Ga0068865_100182681
676 Ga0075436_100072010
677 Ga0097620_100078689
678 Ga0097620_100132285
679 Ga0097620_100578596
680 Ga0075435_100465669
681 Ga0111539_10010148
682 Ga0111539_10102350
683 Ga0111539_10127043
684 Ga0111539_10391153
685 Ga0111539_11055821
686 Ga0105245_10005127
687 Ga0105245_10043340
688 Ga0105245_10065355
689 Ga0105247_10017709
690 Ga0114129_10033719
691 Ga0105243_10005551
692 Ga0105243_10366507
693 Ga0105243_10595133
694 Ga0105242_10072900
695 Ga0105248_10134653
696 Ga0105248_10474869
697 Ga0105238_10103733
698 Ga0105238_10221157
699 Ga0105249_10028009
700 Ga0123342_1015300
701 Ga0105239_11046615
702 Ga0157374_10181905
703 Ga0157378_10607185
704 Ga0163162_10391256
705 Ga0163162_10595023
706 Ga0157372_10353400
707 Ga0157372_10472725
708 Ga0157375_10008060
709 Ga0157375_10131627
710 Ga0157375_10224364
711 Ga0157375_10609174
712 Ga0157375_11114074
713 Ga0163163_10037508
714 Ga0163163_10130156
715 Ga0163163_10894906
716 Ga0157380_10033563
717 Ga0157380_10087748
718 Ga0157380_10171727
719 Ga0157377_10002148
720 Ga0157379_10096918
721 Ga0157376_10210999
722 Ga0157376_10567593
723 Ga0157376_10573558
724 Ga0163161_10112951
725 Ga0163161_10367025
726 Ga0207425_1000061
727 Ga0209129_1000134
728 Ga0209129_1003891
729 Ga0209673_1002235
730 Ga0209673_1004694
731 Ga0209673_1016013
732 Ga0209025_1000205
733 Ga0209025_1000254
734 Ga0209564_1001889
735 Ga0209758_1001317
736 Ga0209758_1003048
737 Ga0209758_1008813
738 Ga0209050_1017700
739 Ga0209256_1006632
740 Ga0209256_1007712
741 Ga0209256_1044006
742 Ga0207426_1000784
743 Ga0209051_1000570
744 Ga0209257_1001453
745 Ga0207682_10010451
746 Ga0207682_10013770
747 Ga0207692_10005957
748 Ga0207710_10052067
749 Ga0207688_10008302
750 Ga0207685_10069885
751 Ga0207699_10006237
752 Ga0207645_10057570
753 Ga0207645_10089981
754 Ga0207643_10008590
755 Ga0207643_10057426
756 Ga0207684_10006672
757 Ga0207684_10157475
758 Ga0207684_10372705
759 Ga0207654_10148316
760 Ga0207707_10042545
761 Ga0207707_10087314
762 Ga0207660_10003805
763 Ga0207662_10066790
764 Ga0207657_10023837
765 Ga0207657_10067312
766 Ga0207649_10000103
767 Ga0207649_10165597
768 Ga0207652_10000001
769 Ga0207652_10332589
770 Ga0207646_10052799
771 Ga0207646_10185567
772 Ga0207694_10033368
773 Ga0207694_10440146
774 Ga0207659_10038662
775 Ga0207687_10095465
776 Ga0207687_10251227
777 Ga0207644_10231341
778 Ga0207690_10305894
779 Ga0207706_10113026
780 Ga0207686_10017766
781 Ga0207686_10425691
782 Ga0207709_10321827
783 Ga0207709_10417363
784 Ga0207670_10040096
785 Ga0207669_10001673
786 Ga0207704_10317046
787 Ga0207691_10003849
788 Ga0207711_10098741
789 Ga0207711_10118358
790 Ga0207689_10033730
791 Ga0207689_10071320
792 Ga0207689_10132827
793 Ga0207689_10181554
794 Ga0207689_10355483
795 Ga0207679_10646215
796 Ga0207667_10233460
797 Ga0207667_10283384
798 Ga0207667_10465631
799 Ga0207712_10394378
800 Ga0207658_10128111
801 Ga0207658_10442000
802 Ga0207677_10323469
803 Ga0207703_10000037
804 Ga0207703_10000320
805 Ga0207703_10594585
806 Ga0207639_10138210
807 Ga0207639_10576850
808 Ga0207678_10079985
809 Ga0207708_10131391
810 Ga0207708_10132080
811 Ga0207708_10160116
812 Ga0207708_10160797
813 Ga0207708_10339718
814 Ga0207702_10224366
815 Ga0207641_10000055
816 Ga0207641_10108667
817 Ga0207641_10345398
818 Ga0207641_10694477
819 Ga0207648_10072401
820 Ga0207648_10183935
821 Ga0207648_10201835
822 Ga0207648_10202134
823 Ga0207676_10000120
824 Ga0207676_10080109
825 Ga0207676_10174372
826 Ga0207676_10215087
827 Ga0207674_10093572
828 Ga0207675_100000752
829 Ga0207675_100005574
830 Ga0207675_100107040
831 Ga0207675_100113252
832 Ga0207683_10004539
833 Ga0207683_10239973
834 Ga0207698_10410597
835 Ga0207428_10006356
836 Ga0207428_10248600
837 Ga0268266_10013544
838 Ga0268266_10309797
839 Ga0268265_10050157
840 Ga0268265_10081258
841 Ga0268265_10213087
842 Ga0265318_10071771
843 Ga0265330_10092108
844 Ga0265325_10079506
845 Ga0265339_10020991
846 Ga0265331_10000507
847 Ga0307408_100025168
848 Ga0307413_10003205
849 Ga0307410_10011604
850 Ga0307406_10243415
851 Ga0307407_10165719
852 Ga0307409_100090213
853 Ga0307416_100094090
854 Ga0307416_100279570
855 Ga0307416_100314857
856 Ga0307411_10010668
857 Ga0307415_100011373
858 Ga0307507_10087329
859 Ga0373949_0008482
860 Ga0373932_0015355
861 Ga0373939_0033911
862 Ga0373925_0160176
863 Ga0436365_0733081
864 Ga0436365_1028749
865 Ga0436360_1279626
866 Ga0436363_1486060
867 Ga0451807_1803611
868 Ga0451837_1803900
869 Ga0451839_0776885
870 Ga0451839_1243365
871 Ga0451841_0426999
872 Ga0451845_0276993
873 Ga0451845_0374388
874 Ga0451847_0322212
875 Ga0451849_0430649
876 Ga0451849_0678553
877 Ga0451851_0009363
878 Ga0451851_0052719
879 Ga0451843_0200699
880 Ga0451843_1362565
881 Ga0451853_0785717
882 Ga0451853_1289736
883 Ga0450923_011745
884 Ga0450896_016364
885 Ga0466969_0001427
886 Ga0466963_0099316
887 Ga0466959_0049118
888 Ga0451576_0549793
889 Ga0495629_0259275
890 Ga0495580_0185988
891 Ga0495585_0172791
892 Ga0495594_0008603
893 Ga0495606_0089131
894 Ga0495610_0054218
895 Ga0495630_0074405
896 Ga0495648_0015167
897 Ga0495663_0092795
898 Ga0495666_0060871
899 Ga0495633_0135261
900 Ga0495656_0147766
901 Ga0495611_0177315
902 Ga0495625_0008124
903 Ga0495635_0161268
904 Ga0495647_0115334
905 Ga0495658_0006679
906 Ga0495658_0008720
907 Ga0495613_0062694
908 Ga0495660_0061925
909 Ga0495683_0126340
910 Ga0495687_026823
911 Ga0495593_0098091
912 Ga0495593_0201858
913 Ga0496101_0063604
914 Ga0496101_0179171
915 Ga0496104_0681012
916 Ga0496105_0108798
917 Ga0496105_0445866
918 Ga0496107_0048336
919 Ga0496108_0380781
920 Ga0496109_0335681
921 Ga0496114_0445618
922 Ga0496115_0050093
923 Ga0496116_0006916
924 Ga0496117_0007922
925 Ga0496118_0001534
926 Ga0496118_0062376
927 Ga0496118_0184525
928 Ga0496119_0017997
929 Ga0496121_0025278
930 Ga0496122_0055866
931 Ga0496122_0300602
932 Ga0496123_0028685
933 Ga0496124_0023799
934 Ga0496125_0000302
935 Ga0496125_0081232
936 Ga0496126_0013723
937 Ga0496126_0017337
938 Ga0496126_0139780
939 Ga0501042_0078722
940 Ga0501048_0160981
941 Ga0501067_0128093
942 Ga0501068_0019673
943 Ga0501070_0041435
944 Ga0501071_0048221
945 Ga0501072_0091155
946 Ga0501073_0002828
947 Ga0501074_0003213
948 Ga0501074_0091070
949 Ga0501075_0022065
950 Ga0501076_0059296
951 Ga0501077_0005480
952 Ga0501079_0023531
953 Ga0501083_0307770
954 nmdc:mga00v17_339316_c1
955 nmdc:mga05p37_547800_c1
956 nmdc:mga08y16_182039_c1
957 nmdc:mga08y16_247311_c1
958 nmdc:mga08y16_321663_c1
959 nmdc:mga0n895_22043_c1
960 nmdc:mga0rr50_13223_c2
961 nmdc:mga0rr50_90494_c1
962 nmdc:mga0rr50_94716_c1
963 nmdc:mga0a205_220413_c1
964 Ga0500608_069281
965 Ga0500616_0005582
966 Ga0500622_0018868
967 Ga0501084_0030512
968 Ga0530510_0186543
969 2509388100
970 2510131786
971 2510898077
972 2513632448
973 2513711787
974 2514023405
975 2515647000
976 2515660692
977 2515742769
978 2517074961
979 2585267882
980 2585387013
981 2585397358
982 2585525127
983 2585539979
984 2585837961
985 2616295943
986 2719179849
987 2719384471
988 2719664214
989 2719730519
990 2720490633
991 2720612002
992 2720630254
993 2720773949
994 2721145942
995 2721157477
996 2721162822
997 2721398183
998 2722838992
999 2723025617
1000 2723559205
1001 2723565834
1002 2724036993
1003 2724043275
1004 2724088556
1005 2724103099
1006 2724108938
1007 2725945897
1008 2730106553
1009 2730163086
1010 2730297109
1011 2738698266
1012 2738802688
1013 2739034844
1014 2766062306
1015 2793299643
1016 2793319036
1017 2793320000
1018 2793328360
1019 2793342823
1020 2793349392
1021 2793353112
1022 2793360902
1023 2805927293
1024 2805937890
1025 2806069259
1026 2838021715
1027 2838026599
1028 2838048791
1029 2838054629
1030 2838073968
1031 2838673491
1032 2838692502
1033 2838695086
1034 2838705826
1035 2838708462
1036 2838736717
1037 2838749704
1038 2841855040
1039 2841866511
1040 2842080304
1041 2842117902
1042 2842120923
1043 2842150678
1044 2842163619
1045 2842169310
1046 2842187223
1047 2842193186
1048 2842203067
1049 2842221093
1050 2842236902
1051 2842237874
1052 2842250656
1053 2842255701
1054 2842264523
1055 2842276971
1056 2842289608
1057 2842293963
1058 2842306158
1059 2842317653
1060 2842342764
1061 2842368630
1062 2842371344
1063 2842380360
1064 2842387431
1065 2842402259
1066 2842406957
1067 2842413546
1068 2842420491
1069 2842427596
1070 2842495352
1071 2842501788
1072 2844455653
1073 2857523916
1074 2894235126
1075 2933573228
1076 2933593944
1077 2933604520
1078 2935895609
1079 2935908392
1080 2936368631
1081 2936377725
1082 2936383938
1083 2996893723
1084 8005279186
1085 8005283738
1086 8005292260
1087 8005304142
1088 8005312982
1089 8005377136
1090 8005386294
1091 8005401769
1092 8005435260
1093 8005498953
1094 8005562649
1095 8005569922
1096 8005620128
1097 8005628738
1098 8005670367
1099 8005690563
1100 8005697159
1101 8018133414
1102 8018179287
1103 8023683466
1104 8024480592
1105 8024502646
1106 8047714599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

53

185

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

59

264

0.86

PF08659

KR

KR domain

54

184

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

55

227

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8817 2 253
6l1h-assembly2.cif.gz_B crystal structure of light-dependent protochlorophyllide oxidoreductase from thermosynechococcus elongatus 0.8777 3 252
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8717 2 253
6rnw-assembly1.cif.gz_A the crystal structure of thermosynechococcus elongatus protochlorophyllide oxidoreductase (por) in complex with nadp. 0.8646 3 251
6l1h-assembly1.cif.gz_A crystal structure of light-dependent protochlorophyllide oxidoreductase from thermosynechococcus elongatus 0.8643 3 252
ID Description Score Start End Superfamily
af_Q9XVS9_38_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9139 3 251 3.40.50.720
af_Q7K0F7_58_350_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9092 3 254 3.40.50.720
af_O74959_28_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9063 3 251 3.40.50.720
af_Q9VE80_46_330_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9029 3 251 3.40.50.720
af_Q54I93_27_313_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9001 3 252 3.40.50.720
ID Description Score Start End GO Terms
AF-K0VSL7-F1-model_v4 Ketoreductase 0.9941 103 253
AF-A0A1S5Y0D6-F1-model_v4 Daunorubicin C-13 ketoreductase 0.9911 1 254
AF-Q2KBF8-F1-model_v4 Probable oxidoreducatse protein 0.9898 1 254
AF-J2ZVK8-F1-model_v4 Short-chain alcohol dehydrogenase 0.9895 1 222 GO:0016491
AF-A0A4Q9QT89-F1-model_v4 Short-chain dehydrogenase 0.9892 2 254

Map