F462752

General Info

Members Datasets Scaffolds Average Seq Length
552 317 1104 221

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0039749|Ga0373927_0039749_744_1529
Length 261
Sequence MHTLYRVPSLRGGARFFIGFEPQGPRAFSPIFRYERLQEDHRERKHVADNKQKQLNIWGRANSVNVQKVLWCLYELDLAYDRIDAGMQFGKNNEAAYLAMNPNGRVPTLVDGDFVLWESNSVMRYLCLAYGQNSPIYPQSPQQRAAVDRWLDWTLSTLQPVDRPVFWALVRTPPEQRDMVQIQKDADAEAVQWRIIDARLATRCFIEGDQFTIADIALGAFARRWFGVEGITKPQLPNLERWFALIAARPGFVRFIAPPMT

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
250 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
296 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
301 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
302 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
303 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
304 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
305 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
306 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
307 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
308 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
309 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
310 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
311 2922425934
312 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
313 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
314 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
315 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
316 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
317 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0.18
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 1.81
Rhizoplane 9.24
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0039749 3300035695 Bacteria 3053
2 JGI25406J46586_10000038 3300003203 Bacteria 59759
3 rootH1_10016145 3300003323 Bacteria 1820
4 JGI25404J52841_10020388 3300003659 Bacteria 1436
5 Ga0070658_10158542 3300005327 Bacteria 1898
6 Ga0070683_100083625 3300005329 Bacteria 2990
7 Ga0068869_100032889 3300005334 Bacteria 3658
8 Ga0070682_100115917 3300005337 Bacteria 1792
9 Ga0068868_100143820 3300005338 Bacteria 1960
10 Ga0068868_100644750 3300005338 Bacteria 942
11 Ga0068868_100871518 3300005338 Bacteria 816
12 Ga0070660_100040748 3300005339 Bacteria 3536
13 Ga0070660_100222581 3300005339 Bacteria 1534
14 Ga0070689_100026322 3300005340 Bacteria 4379
15 Ga0070691_10144222 3300005341 Bacteria 1216
16 Ga0070661_100136621 3300005344 Bacteria 1845
17 Ga0070668_100035347 3300005347 Bacteria 3810
18 Ga0070675_100844509 3300005354 Bacteria 838
19 Ga0070659_100091576 3300005366 Bacteria 2437
20 Ga0070709_10389361 3300005434 Bacteria 1038
21 Ga0070709_10488248 3300005434 Bacteria 934
22 Ga0070714_100018092 3300005435 Bacteria 5717
23 Ga0070710_10514942 3300005437 Bacteria 821
24 Ga0070711_100579911 3300005439 Bacteria 933
25 Ga0070711_100617373 3300005439 Bacteria 906
26 Ga0070708_100022482 3300005445 Bacteria 5350
27 Ga0070663_100015101 3300005455 Bacteria 4972
28 Ga0070663_100123349 3300005455 Bacteria 1959
29 Ga0070663_100345133 3300005455 Bacteria 1204
30 Ga0070678_100163962 3300005456 Bacteria 1803
31 Ga0070678_100275514 3300005456 Bacteria 1421
32 Ga0070678_100277102 3300005456 Bacteria 1417
33 Ga0070662_100093206 3300005457 Bacteria 2265
34 Ga0070681_10047807 3300005458 Bacteria 4277
35 Ga0068867_100637067 3300005459 Bacteria 934
36 Ga0068867_100846584 3300005459 Bacteria 819
37 Ga0070685_10234625 3300005466 Bacteria 1208
38 Ga0070699_100292476 3300005518 Bacteria 1461
39 Ga0070679_100201219 3300005530 Bacteria 1958
40 Ga0070684_100103985 3300005535 Bacteria 2540
41 Ga0070684_100121393 3300005535 Bacteria 2351
42 Ga0070697_100009962 3300005536 Bacteria 7417
43 Ga0070697_100155049 3300005536 Bacteria 1933
44 Ga0068853_100065753 3300005539 Bacteria 3147
45 Ga0070672_100486502 3300005543 Bacteria 1066
46 Ga0070686_100248258 3300005544 Bacteria 1299
47 Ga0070693_100353043 3300005547 Bacteria 1007
48 Ga0070665_100289395 3300005548 Bacteria 1641
49 Ga0070665_100377425 3300005548 Bacteria 1425
50 Ga0070665_100606339 3300005548 Bacteria 1108
51 Ga0070704_100237636 3300005549 Bacteria 1490
52 Ga0068855_100096119 3300005563 Bacteria 3414
53 Ga0068855_100102871 3300005563 Bacteria 3287
54 Ga0068857_100068953 3300005577 Bacteria 3148
55 Ga0068856_100226584 3300005614 Bacteria 1885
56 Ga0068856_100281213 3300005614 Bacteria 1681
57 Ga0068856_100284121 3300005614 Bacteria 1671
58 Ga0068852_100007254 3300005616 Bacteria 8086
59 Ga0068852_100188245 3300005616 Bacteria 1945
60 Ga0068852_100265108 3300005616 Bacteria 1651
61 Ga0068852_100698787 3300005616 Bacteria 1024
62 Ga0068859_100152080 3300005617 Bacteria 2390
63 Ga0068859_100711208 3300005617 Bacteria 1095
64 Ga0068864_100114141 3300005618 Bacteria 2409
65 Ga0068866_10228076 3300005718 Bacteria 1128
66 Ga0068851_10140147 3300005834 Bacteria 1315
67 Ga0068863_100200260 3300005841 Bacteria 1921
68 Ga0068863_100572707 3300005841 Bacteria 1116
69 Ga0068858_100260327 3300005842 Bacteria 1649
70 Ga0068858_100334783 3300005842 Bacteria 1448
71 Ga0068860_100134667 3300005843 Bacteria 2372
72 Ga0068860_100858754 3300005843 Bacteria 922
73 Ga0068862_100006644 3300005844 Bacteria 9594
74 Ga0068862_100058358 3300005844 Bacteria 3310
75 Ga0068862_100060626 3300005844 Bacteria 3250
76 Ga0068862_100134805 3300005844 Bacteria 2187
77 Ga0068862_100233637 3300005844 Bacteria 1669
78 Ga0081455_10028678 3300005937 Bacteria 5082
79 Ga0081540_1001033 3300005983 Bacteria 24932
80 Ga0081540_1002310 3300005983 Bacteria 15637
81 Ga0081540_1002885 3300005983 Bacteria 13875
82 Ga0081540_1079045 3300005983 Bacteria 1488
83 Ga0081539_10000080 3300005985 Bacteria 222745
84 Ga0081539_10000258 3300005985 Bacteria 122213
85 Ga0070715_10267995 3300006163 Bacteria 900
86 Ga0070716_100317205 3300006173 Bacteria 1091
87 Ga0070712_100112327 3300006175 Bacteria 2035
88 Ga0075369_10309016 3300006186 Bacteria 739
89 Ga0097621_100057911 3300006237 Bacteria 3170
90 Ga0068871_100165019 3300006358 Bacteria 1896
91 Ga0068871_100201170 3300006358 Bacteria 1720
92 Ga0075433_10162601 3300006852 Bacteria 1987
93 Ga0075434_100250979 3300006871 Bacteria 1788
94 Ga0068865_100100905 3300006881 Bacteria 2113
95 Ga0068865_100131016 3300006881 Bacteria 1879
96 Ga0097620_100152072 3300006931 Bacteria 2390
97 Ga0097620_100711296 3300006931 Bacteria 1095
98 Ga0099794_10225792 3300007265 Bacteria 963
99 Ga0105240_10012195 3300009093 Bacteria 11889
100 Ga0105240_10033849 3300009093 Bacteria 6598
101 Ga0105240_10310399 3300009093 Bacteria 1801
102 Ga0111539_10167715 3300009094 Bacteria 2566
103 Ga0105245_10019824 3300009098 Bacteria 5894
104 Ga0105245_10963815 3300009098 Bacteria 896
105 Ga0105247_10084530 3300009101 Bacteria 2005
106 Ga0105247_10125843 3300009101 Bacteria 1666
107 Ga0105243_10370882 3300009148 Bacteria 1320
108 Ga0105241_10085547 3300009174 Bacteria 2478
109 Ga0105242_10098124 3300009176 Bacteria 2478
110 Ga0105248_10044661 3300009177 Bacteria 4970
111 Ga0105248_10577739 3300009177 Bacteria 1268
112 Ga0105237_10004878 3300009545 Bacteria 15367
113 Ga0105237_10013989 3300009545 Bacteria 8395
114 Ga0105237_10071297 3300009545 Bacteria 3469
115 Ga0105237_10088955 3300009545 Bacteria 3077
116 Ga0105237_10152724 3300009545 Bacteria 2305
117 Ga0105238_10003890 3300009551 Bacteria 14820
118 Ga0105238_10015016 3300009551 Bacteria 7842
119 Ga0105238_10104297 3300009551 Bacteria 2816
120 Ga0105249_10014298 3300009553 Bacteria 7019
121 Ga0099796_10003591 3300010159 Bacteria 3624
122 Ga0099796_10011111 3300010159 Bacteria 2501
123 Ga0099796_10028859 3300010159 Bacteria 1784
124 Ga0099796_10045833 3300010159 Bacteria 1499
125 Ga0105239_10034591 3300010375 Bacteria 5549
126 Ga0105239_10162253 3300010375 Bacteria 2498
127 Ga0105239_10331803 3300010375 Bacteria 1716
128 Ga0105239_10764674 3300010375 Bacteria 1106
129 Ga0157370_10075288 3300013104 Bacteria 3182
130 Ga0157370_10118118 3300013104 Bacteria 2477
131 Ga0157370_10330404 3300013104 Bacteria 1406
132 Ga0157369_10010385 3300013105 Bacteria 10614
133 Ga0157369_10027399 3300013105 Bacteria 6317
134 Ga0157374_10238825 3300013296 Bacteria 1787
135 Ga0157378_10135002 3300013297 Bacteria 2287
136 Ga0163162_10010128 3300013306 Bacteria 9162
137 Ga0163162_10063678 3300013306 Bacteria 3731
138 Ga0163162_10380988 3300013306 Bacteria 1544
139 Ga0163162_10399699 3300013306 Bacteria 1507
140 Ga0157375_10054134 3300013308 Bacteria 3951
141 Ga0157375_10092749 3300013308 Bacteria 3084
142 Ga0163163_10024410 3300014325 Bacteria 5754
143 Ga0157380_10077984 3300014326 Bacteria 2702
144 Ga0157380_10810786 3300014326 Bacteria 954
145 Ga0157380_11226291 3300014326 Bacteria 795
146 Ga0157379_10099129 3300014968 Bacteria 2616
147 Ga0157379_10235293 3300014968 Bacteria 1661
148 Ga0157379_10374458 3300014968 Bacteria 1306
149 Ga0157376_10075757 3300014969 Bacteria 2872
150 Ga0157376_10106866 3300014969 Bacteria 2456
151 Ga0157376_10591539 3300014969 Bacteria 1103
152 Ga0163161_10575311 3300017792 Bacteria 926
153 Ga0206354_11475256 3300020081 Bacteria 956
154 Ga0213876_10182890 3300021384 Bacteria 1115
155 Ga0209758_1036664 3300025297 Bacteria 1909
156 Ga0207656_10227704 3300025321 Bacteria 908
157 Ga0207642_10097136 3300025899 Bacteria 1470
158 Ga0207710_10014951 3300025900 Bacteria 3278
159 Ga0207710_10038093 3300025900 Bacteria 2125
160 Ga0207688_10045091 3300025901 Bacteria 2459
161 Ga0207688_10242237 3300025901 Bacteria 1091
162 Ga0207647_10226344 3300025904 Bacteria 1077
163 Ga0207685_10031270 3300025905 Bacteria 1904
164 Ga0207699_10590922 3300025906 Bacteria 808
165 Ga0207699_10688500 3300025906 Bacteria 748
166 Ga0207705_10126704 3300025909 Bacteria 1898
167 Ga0207707_10013282 3300025912 Bacteria 7177
168 Ga0207695_10204590 3300025913 Bacteria 1887
169 Ga0207695_10370360 3300025913 Bacteria 1319
170 Ga0207671_10147617 3300025914 Bacteria 1815
171 Ga0207671_10384245 3300025914 Bacteria 1116
172 Ga0207693_10083252 3300025915 Bacteria 2506
173 Ga0207660_10013559 3300025917 Bacteria 5343
174 Ga0207657_10001249 3300025919 Bacteria 27178
175 Ga0207649_10284336 3300025920 Bacteria 1204
176 Ga0207652_10003575 3300025921 Bacteria 12825
177 Ga0207652_10099621 3300025921 Bacteria 2564
178 Ga0207694_10110808 3300025924 Bacteria 2184
179 Ga0207694_10566640 3300025924 Bacteria 954
180 Ga0207687_11000633 3300025927 Bacteria 717
181 Ga0207700_10190758 3300025928 Bacteria 1722
182 Ga0207664_10162522 3300025929 Bacteria 1905
183 Ga0207690_10187308 3300025932 Bacteria 1562
184 Ga0207706_10184987 3300025933 Bacteria 1829
185 Ga0207686_10311248 3300025934 Bacteria 1173
186 Ga0207704_10102068 3300025938 Bacteria 1915
187 Ga0207704_10119376 3300025938 Bacteria 1801
188 Ga0207704_10156642 3300025938 Bacteria 1615
189 Ga0207711_10035242 3300025941 Bacteria 4241
190 Ga0207661_10109666 3300025944 Bacteria 2332
191 Ga0207661_10416476 3300025944 Bacteria 1220
192 Ga0207667_10021436 3300025949 Bacteria 7159
193 Ga0207677_10032047 3300026023 Bacteria 3375
194 Ga0207677_10144544 3300026023 Bacteria 1826
195 Ga0207677_10167361 3300026023 Bacteria 1715
196 Ga0207677_10738630 3300026023 Bacteria 876
197 Ga0207703_10376891 3300026035 Bacteria 1312
198 Ga0207703_10806944 3300026035 Bacteria 896
199 Ga0207639_10058683 3300026041 Bacteria 2961
200 Ga0207639_10412441 3300026041 Bacteria 1219
201 Ga0207639_10679548 3300026041 Bacteria 954
202 Ga0207678_10011365 3300026067 Bacteria 7812
203 Ga0207678_10041267 3300026067 Bacteria 4001
204 Ga0207678_10658937 3300026067 Bacteria 920
205 Ga0207702_10104767 3300026078 Bacteria 2504
206 Ga0207702_10531322 3300026078 Bacteria 1149
207 Ga0207641_10176881 3300026088 Bacteria 1952
208 Ga0207648_10336862 3300026089 Bacteria 1358
209 Ga0207648_10339124 3300026089 Bacteria 1353
210 Ga0207648_10472042 3300026089 Bacteria 1145
211 Ga0207676_10021539 3300026095 Bacteria 4729
212 Ga0207674_10004039 3300026116 Bacteria 17803
213 Ga0207675_100021881 3300026118 Bacteria 5952
214 Ga0207683_10198249 3300026121 Bacteria 1824
215 Ga0207683_10316514 3300026121 Bacteria 1429
216 Ga0207683_11186337 3300026121 Bacteria 708
217 Ga0207698_10412356 3300026142 Bacteria 1294
218 Ga0207698_10442016 3300026142 Bacteria 1253
219 Ga0209179_1027322 3300027512 Bacteria 1150
220 Ga0209588_1036750 3300027671 Bacteria 1577
221 Ga0268266_10238135 3300028379 Bacteria 1679
222 Ga0268264_10444013 3300028381 Bacteria 1255
223 Ga0307517_10000053 3300028786 Bacteria 155723
224 Ga0307515_10019665 3300028794 Bacteria 12126
225 Ga0307515_10295964 3300028794 Bacteria 1309
226 Ga0307511_10065533 3300030521 Bacteria 2717
227 Ga0307511_10092455 3300030521 Bacteria 2040
228 Ga0265330_10008402 3300031235 Bacteria 4971
229 Ga0265330_10021865 3300031235 Bacteria 2914
230 Ga0265330_10033698 3300031235 Bacteria 2289
231 Ga0265332_10015735 3300031238 Bacteria 3340
232 Ga0265332_10040502 3300031238 Bacteria 2017
233 Ga0265325_10006372 3300031241 Bacteria 7166
234 Ga0265340_10039809 3300031247 Bacteria 2316
235 Ga0265339_10001276 3300031249 Bacteria 18841
236 Ga0307508_10047104 3300031616 Bacteria 3847
237 Ga0265314_10063621 3300031711 Bacteria 2502
238 Ga0265314_10089519 3300031711 Bacteria 2007
239 Ga0265314_10204148 3300031711 Bacteria 1166
240 Ga0265342_10031246 3300031712 Bacteria 3293
241 Ga0265342_10063250 3300031712 Bacteria 2176
242 Ga0265342_10189243 3300031712 Bacteria 1124
243 Ga0307516_10136063 3300031730 Bacteria 2231
244 Ga0307516_10193787 3300031730 Bacteria 1756
245 Ga0307507_10054296 3300033179 Bacteria 3815
246 Ga0307510_10212689 3300033180 Bacteria 1454
247 Ga0307510_10399276 3300033180 Bacteria 818
248 Ga0373944_0078977 3300035089 Bacteria 1084
249 Ga0373951_0071689 3300035091 Bacteria 884
250 Ga0373923_0073702 3300035111 Bacteria 1470
251 Ga0373932_0052773 3300035112 Bacteria 1212
252 Ga0373936_0006258 3300035113 Bacteria 4490
253 Ga0373945_0054891 3300035116 Bacteria 1474
254 Ga0373953_0018269 3300035117 Bacteria 2592
255 Ga0373954_0000058 3300035118 Bacteria 39164
256 Ga0373954_0002807 3300035118 Bacteria 7332
257 Ga0373956_0000441 3300035119 Bacteria 16910
258 Ga0373956_0092953 3300035119 Bacteria 1393
259 Ga0373957_0000637 3300035120 Bacteria 8980
260 Ga0373943_0008968 3300035170 Bacteria 4483
261 Ga0373946_0029260 3300035171 Bacteria 2191
262 Ga0373955_0000098 3300035172 Bacteria 34438
263 Ga0373955_0321844 3300035172 Bacteria 934
264 Ga0373962_0063042 3300035242 Bacteria 1093
265 Ga0373962_0069971 3300035242 Bacteria 1047
266 Ga0373924_0002508 3300035410 Bacteria 6181
267 Ga0373924_0247667 3300035410 Bacteria 789
268 Ga0373931_0054589 3300035691 Bacteria 2135
269 Ga0373935_0000342 3300035692 Bacteria 23620
270 Ga0373935_0065875 3300035692 Bacteria 2326
271 Ga0373927_0004725 3300035695 Bacteria 9493
272 Ga0373927_0022138 3300035695 Bacteria 4165
273 Ga0373927_0080608 3300035695 Bacteria 2109
274 Ga0373927_0228909 3300035695 Bacteria 1221
275 Ga0373933_0000309 3300035724 Bacteria 31558
276 Ga0373933_0003802 3300035724 Bacteria 8346
277 Ga0373947_0031884 3300035725 Bacteria 3104
278 Ga0373947_0052695 3300035725 Bacteria 2451
279 Ga0373947_0111956 3300035725 Bacteria 1726
280 Ga0373937_0000742 3300036401 Bacteria 28122
281 Ga0373937_0074049 3300036401 Bacteria 3142
282 Ga0373937_0209550 3300036401 Bacteria 1833
283 Ga0373925_0008158 3300037068 Bacteria 7627
284 Ga0373925_0051636 3300037068 Bacteria 3070
285 Ga0373925_0191693 3300037068 Bacteria 1622
286 Ga0395900_0633899 3300037418 Bacteria 1007
287 Ga0395905_0094725 3300037471 Bacteria 2801
288 Ga0436363_1567841 3300039450 Bacteria 6042
289 Ga0451843_0264963 3300041509 Bacteria 797
290 Ga0439432_056112 3300042006 Bacteria 1221
291 Ga0466957_0048751 3300044842 Bacteria 2574
292 Ga0466957_0065943 3300044842 Bacteria 2231
293 Ga0466959_0302913 3300045049 Bacteria 1094
294 Ga0466967_0122758 3300045976 Bacteria 2403
295 Ga0495617_023322 3300046452 Bacteria 2091
296 Ga0495592_0000316 3300046454 Bacteria 40498
297 Ga0495592_0018781 3300046454 Bacteria 5264
298 Ga0495603_0065609 3300046455 Bacteria 2139
299 Ga0495590_0087393 3300046457 Bacteria 1101
300 Ga0495629_0000257 3300046459 Bacteria 46305
301 Ga0495629_0019762 3300046459 Bacteria 4808
302 Ga0495629_0167706 3300046459 Bacteria 1525
303 Ga0495638_0012987 3300046460 Bacteria 5687
304 Ga0495638_0164801 3300046460 Bacteria 1276
305 Ga0495651_0012365 3300046462 Bacteria 6579
306 Ga0495651_0021189 3300046462 Bacteria 5050
307 Ga0495651_0070898 3300046462 Bacteria 2650
308 Ga0495653_0000137 3300046463 Bacteria 60893
309 Ga0495653_0009307 3300046463 Bacteria 8036
310 Ga0495650_0002899 3300046471 Bacteria 13038
311 Ga0495650_0048405 3300046471 Bacteria 1772
312 Ga0495580_0004724 3300046472 Bacteria 11416
313 Ga0495580_0018850 3300046472 Bacteria 5133
314 Ga0495582_0007209 3300046473 Bacteria 6167
315 Ga0495605_0026319 3300046474 Bacteria 3024
316 Ga0495605_0120783 3300046474 Bacteria 1188
317 Ga0495639_0000404 3300046475 Bacteria 20516
318 Ga0495662_0008078 3300046476 Bacteria 5185
319 Ga0495664_0021381 3300046477 Bacteria 3738
320 Ga0495664_0070046 3300046477 Bacteria 2094
321 Ga0495664_0137378 3300046477 Bacteria 1481
322 Ga0495664_0257719 3300046477 Bacteria 1055
323 Ga0495584_0041262 3300046491 Bacteria 2330
324 Ga0495584_0045138 3300046491 Bacteria 2223
325 Ga0495584_0087151 3300046491 Bacteria 1573
326 Ga0495585_0063952 3300046492 Bacteria 2018
327 Ga0495585_0323052 3300046492 Bacteria 754
328 Ga0495596_0015478 3300046500 Bacteria 3193
329 Ga0495607_0083048 3300046501 Bacteria 1756
330 Ga0495583_0002633 3300046506 Bacteria 14972
331 Ga0495583_0035912 3300046506 Bacteria 2361
332 Ga0495606_0046185 3300046507 Bacteria 2880
333 Ga0495606_0051721 3300046507 Bacteria 2677
334 Ga0495608_0000548 3300046511 Bacteria 25966
335 Ga0495608_0022489 3300046511 Bacteria 4322
336 Ga0495610_0153126 3300046512 Bacteria 981
337 Ga0495616_0058234 3300046513 Bacteria 1903
338 Ga0495618_0035377 3300046514 Bacteria 3135
339 Ga0495618_0082428 3300046514 Bacteria 2054
340 Ga0495620_0011292 3300046515 Bacteria 4662
341 Ga0495628_0016887 3300046516 Bacteria 6084
342 Ga0495630_0010320 3300046517 Bacteria 6742
343 Ga0495630_0050997 3300046517 Bacteria 3096
344 Ga0495630_0369917 3300046517 Bacteria 1098
345 Ga0495631_0039792 3300046518 Bacteria 2084
346 Ga0495631_0050831 3300046518 Bacteria 1812
347 Ga0495632_0036521 3300046519 Bacteria 2499
348 Ga0495648_0023608 3300046524 Bacteria 4205
349 Ga0495648_0188184 3300046524 Bacteria 1043
350 Ga0495666_0110183 3300046526 Bacteria 1293
351 Ga0495642_0044396 3300046528 Bacteria 1814
352 Ga0495652_0003496 3300046529 Bacteria 15468
353 Ga0495652_0139324 3300046529 Bacteria 1909
354 Ga0495652_0385776 3300046529 Bacteria 995
355 Ga0495665_0000170 3300046531 Bacteria 32921
356 Ga0495665_0089587 3300046531 Bacteria 1616
357 Ga0495640_0012115 3300046533 Bacteria 6603
358 Ga0495640_0072407 3300046533 Bacteria 2309
359 Ga0495640_0150432 3300046533 Bacteria 1496
360 Ga0495586_0222340 3300046535 Bacteria 1073
361 Ga0495587_0000584 3300046536 Bacteria 25102
362 Ga0495609_0052813 3300046538 Bacteria 1808
363 Ga0495609_0087567 3300046538 Bacteria 1356
364 Ga0495621_0014659 3300046539 Bacteria 2485
365 Ga0495597_0124981 3300046542 Bacteria 1070
366 Ga0495645_0019707 3300046543 Bacteria 4859
367 Ga0495645_0304147 3300046543 Bacteria 1041
368 Ga0495645_0435021 3300046543 Bacteria 830
369 Ga0495622_0066267 3300046557 Bacteria 1669
370 Ga0495667_0002581 3300046559 Bacteria 12104
371 Ga0495667_0081073 3300046559 Bacteria 2109
372 Ga0495656_0006028 3300046615 Bacteria 4222
373 Ga0495656_0025830 3300046615 Bacteria 2332
374 Ga0495634_0004236 3300046642 Bacteria 11320
375 Ga0495634_0053185 3300046642 Bacteria 2713
376 Ga0495611_0048352 3300046648 Bacteria 1911
377 Ga0495611_0055025 3300046648 Bacteria 1799
378 Ga0495625_0061667 3300046660 Bacteria 2653
379 Ga0495625_0134068 3300046660 Bacteria 1675
380 Ga0495625_0179324 3300046660 Bacteria 1410
381 Ga0495635_0000040 3300046663 Bacteria 86519
382 Ga0495635_0128365 3300046663 Bacteria 1728
383 Ga0495659_0037915 3300046664 Bacteria 1709
384 Ga0495661_0012838 3300046665 Bacteria 5648
385 Ga0495661_0159558 3300046665 Bacteria 1212
386 Ga0495588_0055783 3300046674 Bacteria 2039
387 Ga0495657_0006463 3300046675 Bacteria 9169
388 Ga0495657_0159680 3300046675 Bacteria 1395
389 Ga0495599_0000120 3300046678 Bacteria 53081
390 Ga0495599_0082399 3300046678 Bacteria 2009
391 Ga0495599_0141768 3300046678 Bacteria 1491
392 Ga0495623_0030123 3300046679 Bacteria 3491
393 Ga0495646_0000362 3300046680 Bacteria 23481
394 Ga0495646_0018197 3300046680 Bacteria 4450
395 Ga0495646_0059995 3300046680 Bacteria 2270
396 Ga0495647_0000715 3300046681 Bacteria 9875
397 Ga0495658_0000406 3300046683 Bacteria 24119
398 Ga0495658_0373950 3300046683 Bacteria 907
399 Ga0495669_0100606 3300046684 Bacteria 1342
400 Ga0495613_0022329 3300046689 Bacteria 4716
401 Ga0495624_0001212 3300046690 Bacteria 20358
402 Ga0495624_0006844 3300046690 Bacteria 8045
403 Ga0495624_0167148 3300046690 Bacteria 1342
404 Ga0495671_0039157 3300046692 Bacteria 2394
405 Ga0495649_0106828 3300046694 Bacteria 1485
406 Ga0495649_0108007 3300046694 Bacteria 1476
407 Ga0495600_0000074 3300046809 Bacteria 55182
408 Ga0495600_0008918 3300046809 Bacteria 6177
409 Ga0495581_0000575 3300047315 Bacteria 19167
410 Ga0495581_0525810 3300047315 Bacteria 687
411 Ga0495604_0057595 3300047317 Bacteria 2987
412 Ga0495604_0081699 3300047317 Bacteria 2418
413 Ga0495604_0190600 3300047317 Bacteria 1429
414 Ga0495674_0014062 3300047319 Bacteria 7503
415 Ga0495674_0016121 3300047319 Bacteria 6974
416 Ga0495674_0018643 3300047319 Bacteria 6458
417 Ga0495674_0031908 3300047319 Bacteria 4780
418 Ga0495672_0062593 3300047320 Bacteria 2139
419 Ga0495672_0062788 3300047320 Bacteria 2135
420 Ga0495676_0042370 3300047321 Bacteria 3738
421 Ga0495676_0133770 3300047321 Bacteria 1786
422 Ga0495680_0002899 3300047322 Bacteria 17241
423 Ga0495680_0053568 3300047322 Bacteria 3138
424 Ga0495683_0009585 3300047323 Bacteria 5155
425 Ga0495675_0005505 3300047444 Bacteria 7726
426 Ga0495675_0008115 3300047444 Bacteria 6497
427 Ga0495679_000026 3300047446 Bacteria 196639
428 Ga0495685_080251 3300047447 Bacteria 1087
429 Ga0495673_0013276 3300047469 Bacteria 4334
430 Ga0495673_0029028 3300047469 Bacteria 2614
431 Ga0495684_0000023 3300047471 Bacteria 133626
432 Ga0495684_0058566 3300047471 Bacteria 2934
433 Ga0495686_0047105 3300047472 Bacteria 2723
434 Ga0495593_0000093 3300047673 Bacteria 39845
435 Ga0495593_0000328 3300047673 Bacteria 26353
436 Ga0495602_0020925 3300048088 Bacteria 6452
437 Ga0495626_0005566 3300048091 Bacteria 7312
438 Ga0495626_0096953 3300048091 Bacteria 1290
439 Ga0496100_0045019 3300048903 Bacteria 2830
440 Ga0496100_0082965 3300048903 Bacteria 2169
441 Ga0496100_0092264 3300048903 Bacteria 2069
442 Ga0496100_0115165 3300048903 Bacteria 1874
443 Ga0496101_0038886 3300048904 Bacteria 3380
444 Ga0496101_0091214 3300048904 Bacteria 2267
445 Ga0496101_0097834 3300048904 Bacteria 2192
446 Ga0496101_0563067 3300048904 Bacteria 901
447 Ga0496102_0020909 3300048905 Bacteria 5785
448 Ga0496102_0040379 3300048905 Bacteria 4221
449 Ga0496102_0047922 3300048905 Bacteria 3885
450 Ga0496102_0308603 3300048905 Bacteria 1491
451 Ga0496102_0324510 3300048905 Bacteria 1450
452 Ga0496103_0019681 3300048906 Bacteria 4053
453 Ga0496103_0213407 3300048906 Bacteria 1241
454 Ga0496104_0015957 3300048907 Bacteria 6818
455 Ga0496104_0055476 3300048907 Bacteria 3747
456 Ga0496104_0122837 3300048907 Bacteria 2493
457 Ga0496104_0567707 3300048907 Bacteria 1045
458 Ga0496104_0804897 3300048907 Bacteria 846
459 Ga0496105_0017745 3300048908 Bacteria 5710
460 Ga0496106_0011526 3300048909 Bacteria 6538
461 Ga0496106_0128190 3300048909 Bacteria 1988
462 Ga0496106_0324370 3300048909 Bacteria 1236
463 Ga0496107_0009609 3300048910 Bacteria 6707
464 Ga0496107_0035201 3300048910 Bacteria 3589
465 Ga0496107_0424681 3300048910 Bacteria 988
466 Ga0496108_0054049 3300048911 Bacteria 3370
467 Ga0496109_0037874 3300048912 Bacteria 4358
468 Ga0496109_0141902 3300048912 Bacteria 2246
469 Ga0496109_0382907 3300048912 Bacteria 1329
470 Ga0496109_0390900 3300048912 Bacteria 1314
471 Ga0496109_0578863 3300048912 Bacteria 1058
472 Ga0496110_0054557 3300048913 Bacteria 3515
473 Ga0496110_0199702 3300048913 Bacteria 1817
474 Ga0496110_0265884 3300048913 Bacteria 1561
475 Ga0496110_0281862 3300048913 Bacteria 1513
476 Ga0496111_0071783 3300048914 Bacteria 2520
477 Ga0496111_0568445 3300048914 Bacteria 831
478 Ga0496112_0000031 3300048915 Bacteria 120022
479 Ga0496112_0120835 3300048915 Bacteria 2589
480 Ga0496112_0222597 3300048915 Bacteria 1842
481 Ga0496112_0319986 3300048915 Bacteria 1496
482 Ga0496112_0385571 3300048915 Bacteria 1342
483 Ga0496113_0023682 3300048916 Bacteria 4356
484 Ga0496113_0249958 3300048916 Bacteria 1415
485 Ga0496114_0005966 3300048917 Bacteria 9583
486 Ga0496114_0020114 3300048917 Bacteria 5416
487 Ga0496114_0204797 3300048917 Bacteria 1729
488 Ga0496115_0050456 3300048918 Bacteria 3333
489 Ga0496115_0215474 3300048918 Bacteria 1585
490 Ga0496117_0039873 3300048920 Bacteria 3461
491 Ga0496118_0069164 3300048921 Bacteria 2559
492 Ga0496119_0184922 3300048922 Bacteria 1090
493 Ga0496120_0119199 3300048923 Bacteria 1367
494 Ga0496121_0012338 3300048924 Bacteria 9343
495 Ga0496122_0104364 3300048925 Bacteria 1883
496 Ga0496123_0135569 3300048926 Bacteria 1355
497 Ga0496124_0032988 3300048927 Bacteria 4563
498 Ga0496124_0245273 3300048927 Bacteria 1329
499 Ga0496124_0245770 3300048927 Bacteria 1327
500 Ga0496126_0020686 3300048929 Bacteria 6445
501 Ga0496126_0298339 3300048929 Bacteria 1330
502 Ga0496126_0398893 3300048929 Bacteria 1116
503 Ga0496126_0449931 3300048929 Bacteria 1037
504 Ga0496126_0487274 3300048929 Bacteria 987
505 Ga0495678_030331 3300049459 Bacteria 2264
506 Ga0495678_038439 3300049459 Bacteria 1936
507 Ga0501031_0313056 3300049568 Bacteria 1017
508 Ga0501036_0227976 3300049572 Bacteria 1564
509 Ga0501048_0215846 3300049582 Bacteria 1360
510 nmdc:mga00v17_303816_c1 3300050491 Bacteria 1036
511 nmdc:mga0yw44_204524_c1 3300050492 Bacteria 1305
512 nmdc:mga0k408_125070_c1 3300050493 Bacteria 1525
513 nmdc:mga0k408_137248_c1 3300050493 Bacteria 1453
514 nmdc:mga04h51_251861_c1 3300050495 Bacteria 708
515 nmdc:mga04h51_68924_c1 3300050495 Bacteria 1230
516 nmdc:mga08y16_69423_c1 3300050511 Bacteria 3673
517 Ga0495601_0047397 3300053077 Bacteria 2705
518 Ga0495601_0071143 3300053077 Bacteria 2221
519 Ga0495601_0202919 3300053077 Bacteria 1295
520 Ga0495612_0049971 3300053078 Bacteria 1716
521 Ga0495612_0078364 3300053078 Bacteria 1386
522 Ga0495595_0000064 3300053084 Bacteria 54079
523 Ga0495595_0068638 3300053084 Bacteria 1672
524 Ga0495595_0254541 3300053084 Bacteria 879
525 Ga0495619_0000395 3300053085 Bacteria 29741
526 Ga0495619_0008949 3300053085 Bacteria 6317
527 Ga0495619_0041289 3300053085 Bacteria 3017
528 Ga0495619_0125186 3300053085 Bacteria 1763
529 Ga0500641_0011388 3300053096 Bacteria 3226
530 Ga0500641_0030008 3300053096 Bacteria 2133
531 Ga0500554_003006 3300053102 Bacteria 3392
532 Ga0500562_050923 3300053108 Bacteria 1107
533 Ga0500658_0051006 3300053134 Bacteria 1690
534 Ga0500559_0308264 3300053136 Bacteria 743
535 Ga0500590_143416 3300053148 Bacteria 1088
536 Ga0500604_0077790 3300053151 Bacteria 1067
537 Ga0500627_0042034 3300053158 Bacteria 1966
538 Ga0500634_0080167 3300053161 Bacteria 1684
539 Ga0500638_134820 3300053162 Bacteria 1115
540 Ga0500637_0066557 3300053178 Bacteria 2068
541 2723845252 2721755755 Bacteria 8322773
542 2900641277 2900634093 Bacteria 10263517
543 2903751273 2903748898 Bacteria 9972761
544 2908742864 2908739725 Bacteria 8628932
545 2922365185 2922361189 Bacteria 7436256
546 2922429637
547 3005480059 3005474847 Bacteria 9259049
548 8006965570 8006964411 Bacteria 8966052
549 8006980519 8006973647 Bacteria 10679141
550 8006998894 8006994254 Bacteria 8309700
551 8019556938 8019555841 Bacteria 9642137
552 8019568361 8019565922 Bacteria 9639779
553 Ga0373927_0039749
554 JGI25406J46586_10000038
555 rootH1_10016145
556 JGI25404J52841_10020388
557 Ga0070658_10158542
558 Ga0070683_100083625
559 Ga0068869_100032889
560 Ga0070682_100115917
561 Ga0068868_100143820
562 Ga0068868_100644750
563 Ga0068868_100871518
564 Ga0070660_100040748
565 Ga0070660_100222581
566 Ga0070689_100026322
567 Ga0070691_10144222
568 Ga0070661_100136621
569 Ga0070668_100035347
570 Ga0070675_100844509
571 Ga0070659_100091576
572 Ga0070709_10389361
573 Ga0070709_10488248
574 Ga0070714_100018092
575 Ga0070710_10514942
576 Ga0070711_100579911
577 Ga0070711_100617373
578 Ga0070708_100022482
579 Ga0070663_100015101
580 Ga0070663_100123349
581 Ga0070663_100345133
582 Ga0070678_100163962
583 Ga0070678_100275514
584 Ga0070678_100277102
585 Ga0070662_100093206
586 Ga0070681_10047807
587 Ga0068867_100637067
588 Ga0068867_100846584
589 Ga0070685_10234625
590 Ga0070699_100292476
591 Ga0070679_100201219
592 Ga0070684_100103985
593 Ga0070684_100121393
594 Ga0070697_100009962
595 Ga0070697_100155049
596 Ga0068853_100065753
597 Ga0070672_100486502
598 Ga0070686_100248258
599 Ga0070693_100353043
600 Ga0070665_100289395
601 Ga0070665_100377425
602 Ga0070665_100606339
603 Ga0070704_100237636
604 Ga0068855_100096119
605 Ga0068855_100102871
606 Ga0068857_100068953
607 Ga0068856_100226584
608 Ga0068856_100281213
609 Ga0068856_100284121
610 Ga0068852_100007254
611 Ga0068852_100188245
612 Ga0068852_100265108
613 Ga0068852_100698787
614 Ga0068859_100152080
615 Ga0068859_100711208
616 Ga0068864_100114141
617 Ga0068866_10228076
618 Ga0068851_10140147
619 Ga0068863_100200260
620 Ga0068863_100572707
621 Ga0068858_100260327
622 Ga0068858_100334783
623 Ga0068860_100134667
624 Ga0068860_100858754
625 Ga0068862_100006644
626 Ga0068862_100058358
627 Ga0068862_100060626
628 Ga0068862_100134805
629 Ga0068862_100233637
630 Ga0081455_10028678
631 Ga0081540_1001033
632 Ga0081540_1002310
633 Ga0081540_1002885
634 Ga0081540_1079045
635 Ga0081539_10000080
636 Ga0081539_10000258
637 Ga0070715_10267995
638 Ga0070716_100317205
639 Ga0070712_100112327
640 Ga0075369_10309016
641 Ga0097621_100057911
642 Ga0068871_100165019
643 Ga0068871_100201170
644 Ga0075433_10162601
645 Ga0075434_100250979
646 Ga0068865_100100905
647 Ga0068865_100131016
648 Ga0097620_100152072
649 Ga0097620_100711296
650 Ga0099794_10225792
651 Ga0105240_10012195
652 Ga0105240_10033849
653 Ga0105240_10310399
654 Ga0111539_10167715
655 Ga0105245_10019824
656 Ga0105245_10963815
657 Ga0105247_10084530
658 Ga0105247_10125843
659 Ga0105243_10370882
660 Ga0105241_10085547
661 Ga0105242_10098124
662 Ga0105248_10044661
663 Ga0105248_10577739
664 Ga0105237_10004878
665 Ga0105237_10013989
666 Ga0105237_10071297
667 Ga0105237_10088955
668 Ga0105237_10152724
669 Ga0105238_10003890
670 Ga0105238_10015016
671 Ga0105238_10104297
672 Ga0105249_10014298
673 Ga0099796_10003591
674 Ga0099796_10011111
675 Ga0099796_10028859
676 Ga0099796_10045833
677 Ga0105239_10034591
678 Ga0105239_10162253
679 Ga0105239_10331803
680 Ga0105239_10764674
681 Ga0157370_10075288
682 Ga0157370_10118118
683 Ga0157370_10330404
684 Ga0157369_10010385
685 Ga0157369_10027399
686 Ga0157374_10238825
687 Ga0157378_10135002
688 Ga0163162_10010128
689 Ga0163162_10063678
690 Ga0163162_10380988
691 Ga0163162_10399699
692 Ga0157375_10054134
693 Ga0157375_10092749
694 Ga0163163_10024410
695 Ga0157380_10077984
696 Ga0157380_10810786
697 Ga0157380_11226291
698 Ga0157379_10099129
699 Ga0157379_10235293
700 Ga0157379_10374458
701 Ga0157376_10075757
702 Ga0157376_10106866
703 Ga0157376_10591539
704 Ga0163161_10575311
705 Ga0206354_11475256
706 Ga0213876_10182890
707 Ga0209758_1036664
708 Ga0207656_10227704
709 Ga0207642_10097136
710 Ga0207710_10014951
711 Ga0207710_10038093
712 Ga0207688_10045091
713 Ga0207688_10242237
714 Ga0207647_10226344
715 Ga0207685_10031270
716 Ga0207699_10590922
717 Ga0207699_10688500
718 Ga0207705_10126704
719 Ga0207707_10013282
720 Ga0207695_10204590
721 Ga0207695_10370360
722 Ga0207671_10147617
723 Ga0207671_10384245
724 Ga0207693_10083252
725 Ga0207660_10013559
726 Ga0207657_10001249
727 Ga0207649_10284336
728 Ga0207652_10003575
729 Ga0207652_10099621
730 Ga0207694_10110808
731 Ga0207694_10566640
732 Ga0207687_11000633
733 Ga0207700_10190758
734 Ga0207664_10162522
735 Ga0207690_10187308
736 Ga0207706_10184987
737 Ga0207686_10311248
738 Ga0207704_10102068
739 Ga0207704_10119376
740 Ga0207704_10156642
741 Ga0207711_10035242
742 Ga0207661_10109666
743 Ga0207661_10416476
744 Ga0207667_10021436
745 Ga0207677_10032047
746 Ga0207677_10144544
747 Ga0207677_10167361
748 Ga0207677_10738630
749 Ga0207703_10376891
750 Ga0207703_10806944
751 Ga0207639_10058683
752 Ga0207639_10412441
753 Ga0207639_10679548
754 Ga0207678_10011365
755 Ga0207678_10041267
756 Ga0207678_10658937
757 Ga0207702_10104767
758 Ga0207702_10531322
759 Ga0207641_10176881
760 Ga0207648_10336862
761 Ga0207648_10339124
762 Ga0207648_10472042
763 Ga0207676_10021539
764 Ga0207674_10004039
765 Ga0207675_100021881
766 Ga0207683_10198249
767 Ga0207683_10316514
768 Ga0207683_11186337
769 Ga0207698_10412356
770 Ga0207698_10442016
771 Ga0209179_1027322
772 Ga0209588_1036750
773 Ga0268266_10238135
774 Ga0268264_10444013
775 Ga0307517_10000053
776 Ga0307515_10019665
777 Ga0307515_10295964
778 Ga0307511_10065533
779 Ga0307511_10092455
780 Ga0265330_10008402
781 Ga0265330_10021865
782 Ga0265330_10033698
783 Ga0265332_10015735
784 Ga0265332_10040502
785 Ga0265325_10006372
786 Ga0265340_10039809
787 Ga0265339_10001276
788 Ga0307508_10047104
789 Ga0265314_10063621
790 Ga0265314_10089519
791 Ga0265314_10204148
792 Ga0265342_10031246
793 Ga0265342_10063250
794 Ga0265342_10189243
795 Ga0307516_10136063
796 Ga0307516_10193787
797 Ga0307507_10054296
798 Ga0307510_10212689
799 Ga0307510_10399276
800 Ga0373944_0078977
801 Ga0373951_0071689
802 Ga0373923_0073702
803 Ga0373932_0052773
804 Ga0373936_0006258
805 Ga0373945_0054891
806 Ga0373953_0018269
807 Ga0373954_0000058
808 Ga0373954_0002807
809 Ga0373956_0000441
810 Ga0373956_0092953
811 Ga0373957_0000637
812 Ga0373943_0008968
813 Ga0373946_0029260
814 Ga0373955_0000098
815 Ga0373955_0321844
816 Ga0373962_0063042
817 Ga0373962_0069971
818 Ga0373924_0002508
819 Ga0373924_0247667
820 Ga0373931_0054589
821 Ga0373935_0000342
822 Ga0373935_0065875
823 Ga0373927_0004725
824 Ga0373927_0022138
825 Ga0373927_0080608
826 Ga0373927_0228909
827 Ga0373933_0000309
828 Ga0373933_0003802
829 Ga0373947_0031884
830 Ga0373947_0052695
831 Ga0373947_0111956
832 Ga0373937_0000742
833 Ga0373937_0074049
834 Ga0373937_0209550
835 Ga0373925_0008158
836 Ga0373925_0051636
837 Ga0373925_0191693
838 Ga0395900_0633899
839 Ga0395905_0094725
840 Ga0436363_1567841
841 Ga0451843_0264963
842 Ga0439432_056112
843 Ga0466957_0048751
844 Ga0466957_0065943
845 Ga0466959_0302913
846 Ga0466967_0122758
847 Ga0495617_023322
848 Ga0495592_0000316
849 Ga0495592_0018781
850 Ga0495603_0065609
851 Ga0495590_0087393
852 Ga0495629_0000257
853 Ga0495629_0019762
854 Ga0495629_0167706
855 Ga0495638_0012987
856 Ga0495638_0164801
857 Ga0495651_0012365
858 Ga0495651_0021189
859 Ga0495651_0070898
860 Ga0495653_0000137
861 Ga0495653_0009307
862 Ga0495650_0002899
863 Ga0495650_0048405
864 Ga0495580_0004724
865 Ga0495580_0018850
866 Ga0495582_0007209
867 Ga0495605_0026319
868 Ga0495605_0120783
869 Ga0495639_0000404
870 Ga0495662_0008078
871 Ga0495664_0021381
872 Ga0495664_0070046
873 Ga0495664_0137378
874 Ga0495664_0257719
875 Ga0495584_0041262
876 Ga0495584_0045138
877 Ga0495584_0087151
878 Ga0495585_0063952
879 Ga0495585_0323052
880 Ga0495596_0015478
881 Ga0495607_0083048
882 Ga0495583_0002633
883 Ga0495583_0035912
884 Ga0495606_0046185
885 Ga0495606_0051721
886 Ga0495608_0000548
887 Ga0495608_0022489
888 Ga0495610_0153126
889 Ga0495616_0058234
890 Ga0495618_0035377
891 Ga0495618_0082428
892 Ga0495620_0011292
893 Ga0495628_0016887
894 Ga0495630_0010320
895 Ga0495630_0050997
896 Ga0495630_0369917
897 Ga0495631_0039792
898 Ga0495631_0050831
899 Ga0495632_0036521
900 Ga0495648_0023608
901 Ga0495648_0188184
902 Ga0495666_0110183
903 Ga0495642_0044396
904 Ga0495652_0003496
905 Ga0495652_0139324
906 Ga0495652_0385776
907 Ga0495665_0000170
908 Ga0495665_0089587
909 Ga0495640_0012115
910 Ga0495640_0072407
911 Ga0495640_0150432
912 Ga0495586_0222340
913 Ga0495587_0000584
914 Ga0495609_0052813
915 Ga0495609_0087567
916 Ga0495621_0014659
917 Ga0495597_0124981
918 Ga0495645_0019707
919 Ga0495645_0304147
920 Ga0495645_0435021
921 Ga0495622_0066267
922 Ga0495667_0002581
923 Ga0495667_0081073
924 Ga0495656_0006028
925 Ga0495656_0025830
926 Ga0495634_0004236
927 Ga0495634_0053185
928 Ga0495611_0048352
929 Ga0495611_0055025
930 Ga0495625_0061667
931 Ga0495625_0134068
932 Ga0495625_0179324
933 Ga0495635_0000040
934 Ga0495635_0128365
935 Ga0495659_0037915
936 Ga0495661_0012838
937 Ga0495661_0159558
938 Ga0495588_0055783
939 Ga0495657_0006463
940 Ga0495657_0159680
941 Ga0495599_0000120
942 Ga0495599_0082399
943 Ga0495599_0141768
944 Ga0495623_0030123
945 Ga0495646_0000362
946 Ga0495646_0018197
947 Ga0495646_0059995
948 Ga0495647_0000715
949 Ga0495658_0000406
950 Ga0495658_0373950
951 Ga0495669_0100606
952 Ga0495613_0022329
953 Ga0495624_0001212
954 Ga0495624_0006844
955 Ga0495624_0167148
956 Ga0495671_0039157
957 Ga0495649_0106828
958 Ga0495649_0108007
959 Ga0495600_0000074
960 Ga0495600_0008918
961 Ga0495581_0000575
962 Ga0495581_0525810
963 Ga0495604_0057595
964 Ga0495604_0081699
965 Ga0495604_0190600
966 Ga0495674_0014062
967 Ga0495674_0016121
968 Ga0495674_0018643
969 Ga0495674_0031908
970 Ga0495672_0062593
971 Ga0495672_0062788
972 Ga0495676_0042370
973 Ga0495676_0133770
974 Ga0495680_0002899
975 Ga0495680_0053568
976 Ga0495683_0009585
977 Ga0495675_0005505
978 Ga0495675_0008115
979 Ga0495679_000026
980 Ga0495685_080251
981 Ga0495673_0013276
982 Ga0495673_0029028
983 Ga0495684_0000023
984 Ga0495684_0058566
985 Ga0495686_0047105
986 Ga0495593_0000093
987 Ga0495593_0000328
988 Ga0495602_0020925
989 Ga0495626_0005566
990 Ga0495626_0096953
991 Ga0496100_0045019
992 Ga0496100_0082965
993 Ga0496100_0092264
994 Ga0496100_0115165
995 Ga0496101_0038886
996 Ga0496101_0091214
997 Ga0496101_0097834
998 Ga0496101_0563067
999 Ga0496102_0020909
1000 Ga0496102_0040379
1001 Ga0496102_0047922
1002 Ga0496102_0308603
1003 Ga0496102_0324510
1004 Ga0496103_0019681
1005 Ga0496103_0213407
1006 Ga0496104_0015957
1007 Ga0496104_0055476
1008 Ga0496104_0122837
1009 Ga0496104_0567707
1010 Ga0496104_0804897
1011 Ga0496105_0017745
1012 Ga0496106_0011526
1013 Ga0496106_0128190
1014 Ga0496106_0324370
1015 Ga0496107_0009609
1016 Ga0496107_0035201
1017 Ga0496107_0424681
1018 Ga0496108_0054049
1019 Ga0496109_0037874
1020 Ga0496109_0141902
1021 Ga0496109_0382907
1022 Ga0496109_0390900
1023 Ga0496109_0578863
1024 Ga0496110_0054557
1025 Ga0496110_0199702
1026 Ga0496110_0265884
1027 Ga0496110_0281862
1028 Ga0496111_0071783
1029 Ga0496111_0568445
1030 Ga0496112_0000031
1031 Ga0496112_0120835
1032 Ga0496112_0222597
1033 Ga0496112_0319986
1034 Ga0496112_0385571
1035 Ga0496113_0023682
1036 Ga0496113_0249958
1037 Ga0496114_0005966
1038 Ga0496114_0020114
1039 Ga0496114_0204797
1040 Ga0496115_0050456
1041 Ga0496115_0215474
1042 Ga0496117_0039873
1043 Ga0496118_0069164
1044 Ga0496119_0184922
1045 Ga0496120_0119199
1046 Ga0496121_0012338
1047 Ga0496122_0104364
1048 Ga0496123_0135569
1049 Ga0496124_0032988
1050 Ga0496124_0245273
1051 Ga0496124_0245770
1052 Ga0496126_0020686
1053 Ga0496126_0298339
1054 Ga0496126_0398893
1055 Ga0496126_0449931
1056 Ga0496126_0487274
1057 Ga0495678_030331
1058 Ga0495678_038439
1059 Ga0501031_0313056
1060 Ga0501036_0227976
1061 Ga0501048_0215846
1062 nmdc:mga00v17_303816_c1
1063 nmdc:mga0yw44_204524_c1
1064 nmdc:mga0k408_125070_c1
1065 nmdc:mga0k408_137248_c1
1066 nmdc:mga04h51_251861_c1
1067 nmdc:mga04h51_68924_c1
1068 nmdc:mga08y16_69423_c1
1069 Ga0495601_0047397
1070 Ga0495601_0071143
1071 Ga0495601_0202919
1072 Ga0495612_0049971
1073 Ga0495612_0078364
1074 Ga0495595_0000064
1075 Ga0495595_0068638
1076 Ga0495595_0254541
1077 Ga0495619_0000395
1078 Ga0495619_0008949
1079 Ga0495619_0041289
1080 Ga0495619_0125186
1081 Ga0500641_0011388
1082 Ga0500641_0030008
1083 Ga0500554_003006
1084 Ga0500562_050923
1085 Ga0500658_0051006
1086 Ga0500559_0308264
1087 Ga0500590_143416
1088 Ga0500604_0077790
1089 Ga0500627_0042034
1090 Ga0500634_0080167
1091 Ga0500638_134820
1092 Ga0500637_0066557
1093 2723845252
1094 2900641277
1095 2903751273
1096 2908742864
1097 2922365185
1098 2922429637
1099 3005480059
1100 8006965570
1101 8006980519
1102 8006998894
1103 8019556938
1104 8019568361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

53

127

0.96

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

62

129

0.89

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

59

134

0.88

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

192

245

0.86

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

159

250

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nxv-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9548 5 212
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9527 5 212
6nxv-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9401 5 212
6nv6-assembly3.cif.gz_C crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.9383 4 212
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9382 5 212
ID Description Score Start End Superfamily
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9375 6 82 3.40.30.10
4kh7A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9357 89 207 1.20.1050.10
4kh7A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.928 89 207 1.20.1050.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9124 6 84 3.40.30.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9075 6 82 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3M2WTL5-F1-model_v4 Glutathione S-transferase protein 0.9648 85 212 GO:0016740
AF-A0A2S6QGV9-F1-model_v4 Glutathione S-transferase GstB (EC 2.5.1.18) 0.9635 6 212 GO:0004364
AF-A0A537R9W3-F1-model_v4 Glutathione S-transferase family protein 0.9589 6 212 GO:0016740
AF-A0A2E8KUP3-F1-model_v4 Glutathione S-transferase 0.9577 6 206 GO:0016740
AF-A0A4T0V3B4-F1-model_v4 Glutathione S-transferase family protein 0.9566 6 212 GO:0016740

Map