F462583

General Info

Members Datasets Scaffolds Average Seq Length
551 243 1102 134

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100824709|Ga0070697_1008247092
Length 148
Sequence MDGPAILRVSVMPNLHWEIAPMSEAVTNGIRVEVLCRYAPENSRPLHREWVFQYTVRITNQGSETVQLVSRHWIITDALEHVEEVKGPGVVGEQPVLAPGESFKYSSWCPLPTPSGMMRGTYQMIRVGGDQFDIEIAPFALRAKQTVH

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
177 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.17
Nodule 0
Rhizoplane 1.45
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 15.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100824709 3300005536 Bacteria 821
2 Ga0070658_10143834 3300005327 Unclassified 1993
3 Ga0070683_100001260 3300005329 Bacteria 19270
4 Ga0070683_100025252 3300005329 Bacteria 5333
5 Ga0070683_100025268 3300005329 Bacteria 5332
6 Ga0070683_100094744 3300005329 Unclassified 2806
7 Ga0070683_100152052 3300005329 Bacteria 2194
8 Ga0070683_100227601 3300005329 Bacteria 1772
9 Ga0070683_101161289 3300005329 Unclassified 742
10 Ga0068869_100299012 3300005334 Bacteria 1299
11 Ga0070666_10248538 3300005335 Bacteria 1259
12 Ga0070680_100004314 3300005336 Bacteria 10688
13 Ga0070680_100245254 3300005336 Bacteria 1514
14 Ga0070682_101207922 3300005337 Unclassified 638
15 Ga0068868_100072340 3300005338 Unclassified 2751
16 Ga0068868_101946779 3300005338 Bacteria 557
17 Ga0070660_100010614 3300005339 Bacteria 6511
18 Ga0070660_100014607 3300005339 Bacteria 5663
19 Ga0070689_100298669 3300005340 Bacteria 1340
20 Ga0070689_100540277 3300005340 Bacteria 1003
21 Ga0070689_100598877 3300005340 Unclassified 954
22 Ga0070691_10000025 3300005341 Bacteria 41015
23 Ga0070691_10556646 3300005341 Bacteria 671
24 Ga0070687_100202848 3300005343 Bacteria 1203
25 Ga0070661_100030539 3300005344 Unclassified 3893
26 Ga0070661_100318012 3300005344 Bacteria 1215
27 Ga0070668_101058626 3300005347 Bacteria 731
28 Ga0070671_100376077 3300005355 Bacteria 1214
29 Ga0070674_101399108 3300005356 Bacteria 626
30 Ga0070673_100151860 3300005364 Bacteria 1962
31 Ga0070673_100485070 3300005364 Bacteria 1116
32 Ga0070688_100160701 3300005365 Bacteria 1543
33 Ga0070709_11208761 3300005434 Unclassified 608
34 Ga0070714_100158771 3300005435 Unclassified 2044
35 Ga0070714_100803468 3300005435 Unclassified 911
36 Ga0070713_100248222 3300005436 Bacteria 1623
37 Ga0070713_100296908 3300005436 Unclassified 1486
38 Ga0070713_101026057 3300005436 Bacteria 796
39 Ga0070710_10195969 3300005437 Bacteria 1273
40 Ga0070711_100190930 3300005439 Unclassified 1574
41 Ga0070711_100951870 3300005439 Unclassified 735
42 Ga0070708_101586616 3300005445 Bacteria 609
43 Ga0070678_100090231 3300005456 Bacteria 2348
44 Ga0070681_10003240 3300005458 Bacteria 15176
45 Ga0070681_10118597 3300005458 Bacteria 2583
46 Ga0070681_10237942 3300005458 Bacteria 1734
47 Ga0070681_10242554 3300005458 Bacteria 1715
48 Ga0068867_100060797 3300005459 Bacteria 2803
49 Ga0068867_100851232 3300005459 Bacteria 817
50 Ga0068867_101328309 3300005459 Unclassified 665
51 Ga0068867_101516818 3300005459 Unclassified 624
52 Ga0070698_100337259 3300005471 Bacteria 1439
53 Ga0070679_100010938 3300005530 Bacteria 8623
54 Ga0070684_100000569 3300005535 Bacteria 25491
55 Ga0070684_100015714 3300005535 Bacteria 6175
56 Ga0070684_100087251 3300005535 Bacteria 2770
57 Ga0070684_100328313 3300005535 Bacteria 1406
58 Ga0068853_100026329 3300005539 Bacteria 4883
59 Ga0068853_100075304 3300005539 Bacteria 2946
60 Ga0068853_100099435 3300005539 Bacteria 2570
61 Ga0068853_100109652 3300005539 Bacteria 2450
62 Ga0068853_100249119 3300005539 Bacteria 1629
63 Ga0068853_100530971 3300005539 Bacteria 1113
64 Ga0070672_100230389 3300005543 Bacteria 1556
65 Ga0070686_100252877 3300005544 Bacteria 1288
66 Ga0070695_100385090 3300005545 Bacteria 1059
67 Ga0070693_100540071 3300005547 Bacteria 833
68 Ga0070693_100706236 3300005547 Bacteria 739
69 Ga0070693_100780088 3300005547 Bacteria 707
70 Ga0070693_100971786 3300005547 Bacteria 641
71 Ga0070665_100048671 3300005548 Bacteria 4255
72 Ga0070665_100063674 3300005548 Bacteria 3698
73 Ga0070704_100807548 3300005549 Bacteria 839
74 Ga0068855_100005936 3300005563 Bacteria 14890
75 Ga0068855_100006084 3300005563 Bacteria 14714
76 Ga0068855_100011824 3300005563 Bacteria 10552
77 Ga0068855_100063333 3300005563 Unclassified 4315
78 Ga0068855_100144611 3300005563 Bacteria 2708
79 Ga0068855_100276187 3300005563 Unclassified 1867
80 Ga0068855_100581942 3300005563 Unclassified 1209
81 Ga0068857_100000789 3300005577 Bacteria 23683
82 Ga0068857_100007458 3300005577 Bacteria 9413
83 Ga0068857_101201712 3300005577 Unclassified 734
84 Ga0068856_100003209 3300005614 Bacteria 16654
85 Ga0068856_100008072 3300005614 Bacteria 10275
86 Ga0068856_100110352 3300005614 Bacteria 2748
87 Ga0068856_100110762 3300005614 Bacteria 2742
88 Ga0068856_100207887 3300005614 Bacteria 1972
89 Ga0068856_100296163 3300005614 Bacteria 1635
90 Ga0068856_100318290 3300005614 Unclassified 1573
91 Ga0068856_100888262 3300005614 Bacteria 910
92 Ga0070702_100354169 3300005615 Bacteria 1035
93 Ga0068852_100016724 3300005616 Bacteria 5731
94 Ga0068852_100112590 3300005616 Bacteria 2477
95 Ga0068859_100026683 3300005617 Bacteria 5793
96 Ga0068859_100048138 3300005617 Unclassified 4283
97 Ga0068859_101235239 3300005617 Bacteria 823
98 Ga0068864_100032952 3300005618 Bacteria 4403
99 Ga0068864_100928959 3300005618 Bacteria 860
100 Ga0068864_101330918 3300005618 Bacteria 719
101 Ga0068866_10383025 3300005718 Bacteria 902
102 Ga0068866_10698786 3300005718 Unclassified 695
103 Ga0068866_10717818 3300005718 Bacteria 687
104 Ga0068866_11350851 3300005718 Bacteria 519
105 Ga0068861_100497720 3300005719 Bacteria 1101
106 Ga0068851_10238732 3300005834 Bacteria 1027
107 Ga0068863_100131081 3300005841 Bacteria 2394
108 Ga0068863_100168745 3300005841 Bacteria 2099
109 Ga0068858_100295697 3300005842 Bacteria 1544
110 Ga0068858_100399866 3300005842 Bacteria 1320
111 Ga0068860_100389126 3300005843 Bacteria 1377
112 Ga0068860_100567590 3300005843 Bacteria 1138
113 Ga0068862_100217604 3300005844 Bacteria 1728
114 Ga0068862_100849680 3300005844 Bacteria 894
115 Ga0081540_1043873 3300005983 Bacteria 2288
116 Ga0081539_10000588 3300005985 Bacteria 74345
117 Ga0070717_10027107 3300006028 Bacteria 4577
118 Ga0075365_10093707 3300006038 Bacteria 2049
119 Ga0075365_10411881 3300006038 Bacteria 954
120 Ga0075368_10007404 3300006042 Bacteria 3873
121 Ga0075368_10056388 3300006042 Bacteria 1568
122 Ga0075363_100129185 3300006048 Bacteria 1416
123 Ga0075363_100502851 3300006048 Bacteria 720
124 Ga0075364_10083466 3300006051 Bacteria 2115
125 Ga0075362_10100349 3300006177 Bacteria 1353
126 Ga0075362_10326374 3300006177 Bacteria 765
127 Ga0075362_10488029 3300006177 Bacteria 629
128 Ga0075367_10001118 3300006178 Bacteria 11121
129 Ga0075367_10060864 3300006178 Bacteria 2252
130 Ga0075369_10200571 3300006186 Bacteria 920
131 Ga0075366_10022361 3300006195 Bacteria 3678
132 Ga0075366_10147160 3300006195 Bacteria 1425
133 Ga0097621_100009037 3300006237 Bacteria 7216
134 Ga0097621_100011693 3300006237 Bacteria 6478
135 Ga0097621_100125704 3300006237 Bacteria 2178
136 Ga0097621_100327987 3300006237 Bacteria 1357
137 Ga0097621_102267810 3300006237 Unclassified 519
138 Ga0075370_10126664 3300006353 Bacteria 1489
139 Ga0068871_100129817 3300006358 Unclassified 2136
140 Ga0068871_100142464 3300006358 Bacteria 2039
141 Ga0068871_101088047 3300006358 Bacteria 747
142 Ga0075428_100188265 3300006844 Unclassified 2232
143 Ga0075431_100683045 3300006847 Bacteria 1005
144 Ga0075431_100942969 3300006847 Unclassified 831
145 Ga0075433_10858154 3300006852 Unclassified 792
146 Ga0075434_100959837 3300006871 Bacteria 869
147 Ga0068865_100440274 3300006881 Unclassified 1075
148 Ga0068865_100587418 3300006881 Bacteria 940
149 Ga0068865_100913222 3300006881 Bacteria 764
150 Ga0068865_101158803 3300006881 Bacteria 683
151 Ga0097620_100026683 3300006931 Bacteria 5793
152 Ga0097620_100048136 3300006931 Unclassified 4283
153 Ga0097620_101234914 3300006931 Bacteria 823
154 Ga0097620_102455653 3300006931 Bacteria 574
155 Ga0105240_10009670 3300009093 Bacteria 13626
156 Ga0105240_10015036 3300009093 Bacteria 10537
157 Ga0105240_10040771 3300009093 Bacteria 5933
158 Ga0105240_10300129 3300009093 Bacteria 1838
159 Ga0105240_10332035 3300009093 Unclassified 1730
160 Ga0105240_10590210 3300009093 Unclassified 1224
161 Ga0105240_10935260 3300009093 Bacteria 931
162 Ga0111539_10041519 3300009094 Bacteria 5530
163 Ga0105245_10002996 3300009098 Bacteria 15143
164 Ga0105245_10018833 3300009098 Bacteria 6040
165 Ga0105245_10071967 3300009098 Bacteria 3140
166 Ga0105245_10296333 3300009098 Unclassified 1585
167 Ga0105245_10319613 3300009098 Bacteria 1529
168 Ga0105245_10475102 3300009098 Bacteria 1262
169 Ga0105245_11698690 3300009098 Bacteria 684
170 Ga0105247_10178873 3300009101 Bacteria 1414
171 Ga0105247_10209962 3300009101 Unclassified 1313
172 Ga0114129_10049946 3300009147 Bacteria 5876
173 Ga0114129_10170765 3300009147 Bacteria 2965
174 Ga0114129_10667081 3300009147 Bacteria 1340
175 Ga0105243_10028524 3300009148 Bacteria 4286
176 Ga0105241_10007982 3300009174 Bacteria 7784
177 Ga0105241_10073886 3300009174 Unclassified 2654
178 Ga0105241_10948058 3300009174 Bacteria 802
179 Ga0105241_11365502 3300009174 Bacteria 677
180 Ga0105241_12329666 3300009174 Bacteria 533
181 Ga0105242_10026951 3300009176 Bacteria 4558
182 Ga0105242_10105282 3300009176 Unclassified 2396
183 Ga0105242_10131770 3300009176 Bacteria 2159
184 Ga0105242_10149016 3300009176 Unclassified 2038
185 Ga0105242_10619476 3300009176 Bacteria 1048
186 Ga0105242_10655205 3300009176 Bacteria 1021
187 Ga0105242_11154379 3300009176 Bacteria 791
188 Ga0105248_10002915 3300009177 Bacteria 18984
189 Ga0105248_10351396 3300009177 Bacteria 1660
190 Ga0105248_10892891 3300009177 Bacteria 1003
191 Ga0105248_11116374 3300009177 Bacteria 891
192 Ga0105237_10001547 3300009545 Bacteria 30034
193 Ga0105237_10004813 3300009545 Bacteria 15509
194 Ga0105237_10128310 3300009545 Bacteria 2530
195 Ga0105237_10132040 3300009545 Unclassified 2491
196 Ga0105237_10394057 3300009545 Bacteria 1389
197 Ga0105237_10460085 3300009545 Bacteria 1278
198 Ga0105237_11045507 3300009545 Unclassified 823
199 Ga0105237_12664379 3300009545 Bacteria 511
200 Ga0105238_10005456 3300009551 Bacteria 12564
201 Ga0105238_10007325 3300009551 Bacteria 11049
202 Ga0105238_10020539 3300009551 Bacteria 6725
203 Ga0105238_10027893 3300009551 Bacteria 5754
204 Ga0105238_10070598 3300009551 Bacteria 3491
205 Ga0105238_10108329 3300009551 Bacteria 2759
206 Ga0105238_10338304 3300009551 Bacteria 1493
207 Ga0105238_10622520 3300009551 Unclassified 1088
208 Ga0105238_11270111 3300009551 Unclassified 762
209 Ga0105249_10010247 3300009553 Bacteria 8232
210 Ga0105249_10238691 3300009553 Unclassified 1796
211 Ga0105249_10400300 3300009553 Bacteria 1403
212 Ga0105249_10609050 3300009553 Unclassified 1147
213 Ga0105249_10969607 3300009553 Bacteria 918
214 Ga0105239_10000502 3300010375 Bacteria 56682
215 Ga0105239_10006356 3300010375 Bacteria 13729
216 Ga0105239_10059219 3300010375 Bacteria 4203
217 Ga0105239_10083721 3300010375 Bacteria 3513
218 Ga0105239_10087236 3300010375 Bacteria 3440
219 Ga0105239_10760309 3300010375 Bacteria 1109
220 Ga0105239_11311940 3300010375 Bacteria 835
221 Ga0105246_10028383 3300011119 Bacteria 3676
222 Ga0105246_10041023 3300011119 Bacteria 3127
223 Ga0105246_10173718 3300011119 Bacteria 1652
224 Ga0105246_10528839 3300011119 Bacteria 1006
225 Ga0105246_11334196 3300011119 Bacteria 666
226 Ga0157373_10547210 3300013100 Unclassified 839
227 Ga0157371_10037744 3300013102 Unclassified 3457
228 Ga0157370_10002436 3300013104 Bacteria 22439
229 Ga0157370_10011795 3300013104 Bacteria 9120
230 Ga0157370_10019394 3300013104 Bacteria 6823
231 Ga0157370_11939885 3300013104 Bacteria 528
232 Ga0157369_10004384 3300013105 Bacteria 16662
233 Ga0157369_10006115 3300013105 Bacteria 13970
234 Ga0157369_10029909 3300013105 Bacteria 6013
235 Ga0157369_10115265 3300013105 Bacteria 2854
236 Ga0157369_11348270 3300013105 Bacteria 727
237 Ga0157374_10039786 3300013296 Unclassified 4328
238 Ga0157374_10112219 3300013296 Bacteria 2623
239 Ga0157374_10365524 3300013296 Bacteria 1435
240 Ga0157374_10400363 3300013296 Bacteria 1369
241 Ga0157374_11800888 3300013296 Bacteria 638
242 Ga0157378_10007616 3300013297 Bacteria 9452
243 Ga0157378_10129396 3300013297 Bacteria 2335
244 Ga0157378_10807713 3300013297 Archaea 964
245 Ga0163162_10006158 3300013306 Bacteria 11616
246 Ga0163162_10378440 3300013306 Bacteria 1549
247 Ga0163162_10787991 3300013306 Bacteria 1068
248 Ga0163162_10820296 3300013306 Bacteria 1047
249 Ga0163162_12134690 3300013306 Bacteria 643
250 Ga0157372_10003874 3300013307 Bacteria 16078
251 Ga0157372_10020404 3300013307 Bacteria 7149
252 Ga0157372_10045771 3300013307 Bacteria 4856
253 Ga0157372_10084606 3300013307 Bacteria 3596
254 Ga0157372_10135742 3300013307 Bacteria 2833
255 Ga0157372_10810758 3300013307 Bacteria 1087
256 Ga0157375_10004952 3300013308 Bacteria 11586
257 Ga0157375_10203566 3300013308 Bacteria 2135
258 Ga0157375_11391849 3300013308 Unclassified 826
259 Ga0157375_11494080 3300013308 Bacteria 797
260 Ga0163163_10020543 3300014325 Bacteria 6221
261 Ga0163163_10027352 3300014325 Bacteria 5462
262 Ga0163163_10032293 3300014325 Bacteria 5056
263 Ga0163163_10084987 3300014325 Bacteria 3172
264 Ga0163163_10261084 3300014325 Bacteria 1783
265 Ga0163163_10392653 3300014325 Bacteria 1445
266 Ga0163163_10901998 3300014325 Bacteria 947
267 Ga0163163_12817913 3300014325 Unclassified 542
268 Ga0157380_10376764 3300014326 Bacteria 1338
269 Ga0157380_10859836 3300014326 Bacteria 929
270 Ga0157379_10068236 3300014968 Unclassified 3179
271 Ga0157379_10970607 3300014968 Bacteria 809
272 Ga0157376_10227010 3300014969 Bacteria 1733
273 Ga0157376_12085638 3300014969 Bacteria 605
274 Ga0157376_12185901 3300014969 Bacteria 592
275 Ga0207682_10101536 3300025893 Bacteria 1258
276 Ga0207642_10581716 3300025899 Unclassified 695
277 Ga0207642_10801383 3300025899 Bacteria 599
278 Ga0207642_10983775 3300025899 Bacteria 543
279 Ga0207710_10413525 3300025900 Bacteria 693
280 Ga0207680_10154708 3300025903 Bacteria 1532
281 Ga0207680_10306913 3300025903 Bacteria 1107
282 Ga0207699_10698100 3300025906 Unclassified 743
283 Ga0207699_11163105 3300025906 Bacteria 571
284 Ga0207705_10917116 3300025909 Bacteria 678
285 Ga0207654_10004807 3300025911 Bacteria 6841
286 Ga0207654_10179026 3300025911 Bacteria 1382
287 Ga0207654_10182620 3300025911 Bacteria 1369
288 Ga0207654_10993217 3300025911 Unclassified 610
289 Ga0207707_10002582 3300025912 Bacteria 16226
290 Ga0207707_10120584 3300025912 Unclassified 2293
291 Ga0207695_10000808 3300025913 Bacteria 58272
292 Ga0207695_10016168 3300025913 Bacteria 8750
293 Ga0207695_10031900 3300025913 Bacteria 5771
294 Ga0207695_10053242 3300025913 Unclassified 4234
295 Ga0207695_10146909 3300025913 Bacteria 2301
296 Ga0207695_10246473 3300025913 Bacteria 1687
297 Ga0207671_10014312 3300025914 Bacteria 6276
298 Ga0207671_10015464 3300025914 Bacteria 5972
299 Ga0207671_10490168 3300025914 Bacteria 980
300 Ga0207671_10501205 3300025914 Bacteria 968
301 Ga0207671_11169165 3300025914 Unclassified 603
302 Ga0207671_11356416 3300025914 Bacteria 552
303 Ga0207660_10004175 3300025917 Bacteria 9398
304 Ga0207660_11367228 3300025917 Unclassified 574
305 Ga0207657_10000194 3300025919 Bacteria 63233
306 Ga0207657_10025559 3300025919 Bacteria 5442
307 Ga0207649_10111720 3300025920 Bacteria 1827
308 Ga0207652_10015507 3300025921 Bacteria 6196
309 Ga0207694_10001951 3300025924 Bacteria 17065
310 Ga0207694_10004319 3300025924 Bacteria 11104
311 Ga0207694_10045601 3300025924 Bacteria 3386
312 Ga0207694_10125254 3300025924 Bacteria 2055
313 Ga0207694_10214357 3300025924 Bacteria 1569
314 Ga0207687_10005071 3300025927 Bacteria 8720
315 Ga0207687_10006316 3300025927 Bacteria 7834
316 Ga0207687_10032457 3300025927 Bacteria 3536
317 Ga0207687_10088565 3300025927 Bacteria 2252
318 Ga0207687_10243875 3300025927 Bacteria 1425
319 Ga0207687_10607459 3300025927 Bacteria 922
320 Ga0207687_11462312 3300025927 Bacteria 587
321 Ga0207700_10062972 3300025928 Unclassified 2819
322 Ga0207644_10735967 3300025931 Bacteria 823
323 Ga0207644_10899633 3300025931 Bacteria 742
324 Ga0207686_10077562 3300025934 Bacteria 2158
325 Ga0207686_10165863 3300025934 Unclassified 1553
326 Ga0207686_10444456 3300025934 Bacteria 996
327 Ga0207686_10522354 3300025934 Bacteria 924
328 Ga0207686_10911304 3300025934 Bacteria 710
329 Ga0207709_10061021 3300025935 Unclassified 2354
330 Ga0207709_10411323 3300025935 Bacteria 1037
331 Ga0207670_10051094 3300025936 Bacteria 2774
332 Ga0207670_10914676 3300025936 Bacteria 735
333 Ga0207704_10065138 3300025938 Bacteria 2280
334 Ga0207704_10864617 3300025938 Bacteria 759
335 Ga0207704_11177030 3300025938 Bacteria 653
336 Ga0207711_10009342 3300025941 Bacteria 8189
337 Ga0207711_10095732 3300025941 Bacteria 2619
338 Ga0207711_10897917 3300025941 Bacteria 824
339 Ga0207689_10029232 3300025942 Bacteria 4604
340 Ga0207689_11068654 3300025942 Bacteria 680
341 Ga0207661_10001243 3300025944 Bacteria 17032
342 Ga0207661_10038812 3300025944 Bacteria 3735
343 Ga0207661_10147069 3300025944 Bacteria 2034
344 Ga0207661_10152256 3300025944 Bacteria 2000
345 Ga0207661_10285772 3300025944 Bacteria 1475
346 Ga0207661_10465583 3300025944 Unclassified 1153
347 Ga0207661_11618909 3300025944 Bacteria 592
348 Ga0207679_10249667 3300025945 Bacteria 1508
349 Ga0207667_10000673 3300025949 Bacteria 44277
350 Ga0207667_10058817 3300025949 Unclassified 4029
351 Ga0207667_10079460 3300025949 Bacteria 3399
352 Ga0207667_10203204 3300025949 Bacteria 2032
353 Ga0207667_10463450 3300025949 Unclassified 1287
354 Ga0207651_10152005 3300025960 Bacteria 1803
355 Ga0207712_10016691 3300025961 Bacteria 4758
356 Ga0207712_10044901 3300025961 Bacteria 3057
357 Ga0207712_10076779 3300025961 Bacteria 2419
358 Ga0207712_10306871 3300025961 Bacteria 1305
359 Ga0207712_10727862 3300025961 Unclassified 868
360 Ga0207658_10091745 3300025986 Bacteria 2358
361 Ga0207677_10049591 3300026023 Bacteria 2834
362 Ga0207677_10529685 3300026023 Unclassified 1023
363 Ga0207703_10093127 3300026035 Bacteria 2537
364 Ga0207703_10095180 3300026035 Bacteria 2512
365 Ga0207703_10164718 3300026035 Bacteria 1944
366 Ga0207703_10265226 3300026035 Bacteria 1554
367 Ga0207639_10019509 3300026041 Bacteria 4838
368 Ga0207639_10070909 3300026041 Bacteria 2724
369 Ga0207639_10080767 3300026041 Bacteria 2573
370 Ga0207639_10112306 3300026041 Bacteria 2223
371 Ga0207639_10244434 3300026041 Bacteria 1562
372 Ga0207639_10421544 3300026041 Bacteria 1207
373 Ga0207702_10014215 3300026078 Bacteria 6611
374 Ga0207702_10182161 3300026078 Unclassified 1935
375 Ga0207702_10205122 3300026078 Bacteria 1830
376 Ga0207702_10470090 3300026078 Bacteria 1222
377 Ga0207702_10821361 3300026078 Bacteria 919
378 Ga0207641_10003903 3300026088 Bacteria 13047
379 Ga0207641_10200316 3300026088 Bacteria 1840
380 Ga0207648_10075998 3300026089 Bacteria 2928
381 Ga0207648_10391187 3300026089 Bacteria 1258
382 Ga0207648_10609372 3300026089 Bacteria 1007
383 Ga0207648_10791039 3300026089 Bacteria 883
384 Ga0207676_10098778 3300026095 Bacteria 2414
385 Ga0207676_10658883 3300026095 Bacteria 1011
386 Ga0207676_11403768 3300026095 Bacteria 694
387 Ga0207674_10000109 3300026116 Bacteria 94920
388 Ga0207674_10003144 3300026116 Bacteria 20353
389 Ga0207675_100541537 3300026118 Bacteria 1162
390 Ga0207683_10174773 3300026121 Bacteria 1946
391 Ga0207698_10018022 3300026142 Bacteria 4802
392 Ga0207698_11436559 3300026142 Bacteria 705
393 Ga0209813_10026159 3300027866 Bacteria 1685
394 Ga0209813_10083244 3300027866 Bacteria 1062
395 Ga0268266_10133794 3300028379 Bacteria 2219
396 Ga0268265_10255001 3300028380 Bacteria 1556
397 Ga0268264_10196845 3300028381 Bacteria 1841
398 Ga0268264_10203348 3300028381 Bacteria 1813
399 Ga0268264_10495865 3300028381 Bacteria 1190
400 Ga0268264_11647739 3300028381 Bacteria 652
401 Ga0265338_10190015 3300028800 Bacteria 1558
402 Ga0265340_10025552 3300031247 Unclassified 2990
403 Ga0265331_10366049 3300031250 Unclassified 646
404 Ga0307408_101402860 3300031548 Bacteria 658
405 Ga0265313_10002192 3300031595 Bacteria 17287
406 Ga0265314_10000658 3300031711 Bacteria 42283
407 Ga0265314_10059657 3300031711 Unclassified 2609
408 Ga0265342_10214439 3300031712 Bacteria 1040
409 Ga0316578_10077157 3300031728 Bacteria 1978
410 Ga0307516_10042969 3300031730 Bacteria 4481
411 Ga0307412_11786192 3300031911 Bacteria 565
412 Ga0307416_100399637 3300032002 Bacteria 1411
413 Ga0316585_10320058 3300032137 Unclassified 516
414 Ga0373926_0056765 3300035083 Unclassified 1421
415 Ga0373926_0401715 3300035083 Bacteria 541
416 Ga0373934_0005209 3300035086 Bacteria 4810
417 Ga0373934_0045583 3300035086 Bacteria 1734
418 Ga0373923_0015439 3300035111 Bacteria 2884
419 Ga0373945_0238087 3300035116 Bacteria 766
420 Ga0373953_0128839 3300035117 Bacteria 1078
421 Ga0373953_0316874 3300035117 Bacteria 681
422 Ga0373954_0004986 3300035118 Bacteria 5734
423 Ga0373954_0157059 3300035118 Unclassified 1112
424 Ga0373954_0159875 3300035118 Bacteria 1102
425 Ga0373954_0395199 3300035118 Bacteria 684
426 Ga0373943_0295043 3300035170 Bacteria 919
427 Ga0373955_0066065 3300035172 Bacteria 2010
428 Ga0373955_0067384 3300035172 Bacteria 1992
429 Ga0373924_0097603 3300035410 Bacteria 1262
430 Ga0373935_0165045 3300035692 Bacteria 1512
431 Ga0373935_0174200 3300035692 Bacteria 1473
432 Ga0373935_0245962 3300035692 Bacteria 1250
433 Ga0373935_0967502 3300035692 Bacteria 632
434 Ga0373927_0454768 3300035695 Bacteria 846
435 Ga0373927_0960174 3300035695 Unclassified 564
436 Ga0373933_0025265 3300035724 Bacteria 3406
437 Ga0373933_0108448 3300035724 Bacteria 1729
438 Ga0373933_0114689 3300035724 Bacteria 1683
439 Ga0373933_0185501 3300035724 Bacteria 1328
440 Ga0373947_0013741 3300035725 Bacteria 4640
441 Ga0373947_0033707 3300035725 Bacteria 3025
442 Ga0373947_0411851 3300035725 Bacteria 913
443 Ga0373937_0006934 3300036401 Bacteria 9783
444 Ga0373937_0011506 3300036401 Bacteria 7767
445 Ga0373937_0016792 3300036401 Bacteria 6508
446 Ga0373937_0082766 3300036401 Bacteria 2969
447 Ga0373937_0485600 3300036401 Bacteria 1173
448 Ga0373937_0668911 3300036401 Unclassified 984
449 Ga0373937_1687716 3300036401 Bacteria 580
450 Ga0373925_0041379 3300037068 Bacteria 3416
451 Ga0373925_0060968 3300037068 Unclassified 2833
452 Ga0373925_0200410 3300037068 Bacteria 1587
453 Ga0373925_0722460 3300037068 Bacteria 821
454 Ga0373925_1328739 3300037068 Bacteria 590
455 Ga0436364_1007551 3300037853 Bacteria 2098
456 Ga0436360_1247515 3300039438 Bacteria 5120
457 Ga0436363_0058530 3300039450 Unclassified 614
458 Ga0436363_0267808 3300039450 Unclassified 907
459 Ga0436363_1407452 3300039450 Unclassified 1822
460 Ga0451787_581785 3300041441 Bacteria 731
461 Ga0451791_1811122 3300041451 Bacteria 1205
462 Ga0451797_0592358 3300041453 Bacteria 589
463 Ga0451804_0464469 3300041463 Bacteria 842
464 Ga0451807_1765324 3300041486 Bacteria 570
465 Ga0451855_2020836 3300041511 Bacteria 634
466 Ga0439445_0161641 3300042004 Unclassified 654
467 Ga0439448_0115741 3300042005 Unclassified 918
468 Ga0439464_0046863 3300042439 Bacteria 1243
469 Ga0451577_0084142 3300042876 Bacteria 2839
470 Ga0466963_0090796 3300044694 Bacteria 2080
471 Ga0466963_1162699 3300044694 Bacteria 542
472 Ga0451576_0601738 3300045051 Unclassified 1155
473 Ga0451576_2101447 3300045051 Bacteria 581
474 Ga0466967_0513910 3300045976 Bacteria 1176
475 Ga0495592_0070323 3300046454 Bacteria 2550
476 Ga0495651_0075326 3300046462 Bacteria 2559
477 Ga0495651_0145651 3300046462 Bacteria 1713
478 Ga0495653_0597208 3300046463 Bacteria 679
479 Ga0495580_0013742 3300046472 Bacteria 6166
480 Ga0495580_0028592 3300046472 Bacteria 4051
481 Ga0495580_0623536 3300046472 Bacteria 711
482 Ga0495639_0008037 3300046475 Bacteria 4529
483 Ga0495664_0624265 3300046477 Bacteria 640
484 Ga0495594_0168768 3300046499 Bacteria 1245
485 Ga0495594_0188481 3300046499 Bacteria 1175
486 Ga0495608_0646554 3300046511 Bacteria 632
487 Ga0495620_0292437 3300046515 Bacteria 619
488 Ga0495630_0965510 3300046517 Bacteria 648
489 Ga0495652_0178179 3300046529 Bacteria 1634
490 Ga0495665_0129688 3300046531 Bacteria 1320
491 Ga0495665_0640498 3300046531 Bacteria 529
492 Ga0495586_0088205 3300046535 Bacteria 1711
493 Ga0495586_0269937 3300046535 Bacteria 972
494 Ga0495587_0004553 3300046536 Bacteria 9106
495 Ga0495587_0034517 3300046536 Bacteria 3050
496 Ga0495645_0364696 3300046543 Bacteria 928
497 Ga0495667_0022996 3300046559 Bacteria 4200
498 Ga0495634_0010869 3300046642 Bacteria 6650
499 Ga0495635_0582296 3300046663 Bacteria 732
500 Ga0495599_0013011 3300046678 Bacteria 5135
501 Ga0495658_1036791 3300046683 Bacteria 523
502 Ga0495669_0252242 3300046684 Unclassified 847
503 Ga0495581_0396960 3300047315 Bacteria 805
504 Ga0495604_0114335 3300047317 Bacteria 1963
505 Ga0495674_0220929 3300047319 Bacteria 1566
506 Ga0495680_0504496 3300047322 Unclassified 821
507 Ga0495684_0015676 3300047471 Bacteria 5832
508 Ga0495684_0111042 3300047471 Bacteria 2069
509 Ga0495684_0153802 3300047471 Bacteria 1719
510 Ga0495684_0489934 3300047471 Bacteria 847
511 Ga0495684_0547233 3300047471 Unclassified 789
512 Ga0495686_0091597 3300047472 Bacteria 1845
513 Ga0495602_0003418 3300048088 Bacteria 16412
514 Ga0495602_0834659 3300048088 Bacteria 617
515 Ga0496104_0111608 3300048907 Bacteria 2622
516 Ga0496104_0169574 3300048907 Bacteria 2093
517 Ga0496112_0259397 3300048915 Bacteria 1688
518 Ga0496121_0605791 3300048924 Bacteria 675
519 Ga0501041_0544053 3300049577 Bacteria 740
520 Ga0501067_0066783 3300049583 Bacteria 1990
521 Ga0501067_0101569 3300049583 Bacteria 1598
522 Ga0501073_0014419 3300049589 Bacteria 5743
523 Ga0501075_0003165 3300049591 Bacteria 11020
524 Ga0501077_0001180 3300049593 Bacteria 15792
525 Ga0501077_0515797 3300049593 Bacteria 767
526 Ga0501080_0003726 3300049742 Bacteria 13450
527 nmdc:mga03683_131444_c1 3300050489 Bacteria 1120
528 nmdc:mga03n38_422349_c1 3300050490 Bacteria 737
529 nmdc:mga00v17_172962_c1 3300050491 Bacteria 1393
530 nmdc:mga0k408_116543_c1 3300050493 Bacteria 1580
531 nmdc:mga0k408_18587_c1 3300050493 Bacteria 3880
532 nmdc:mga0k408_247214_c1 3300050493 Bacteria 1065
533 nmdc:mga0k408_302579_c1 3300050493 Unclassified 954
534 nmdc:mga06z11_187868_c1 3300050494 Bacteria 1195
535 nmdc:mga06z11_46107_c1 3300050494 Bacteria 2207
536 nmdc:mga04h51_19236_c1 3300050495 Bacteria 2022
537 nmdc:mga04h51_98476_c1 3300050495 Bacteria 1063
538 nmdc:mga07m45_8580_c1 3300050496 Bacteria 5261
539 nmdc:mga05p37_354637_c1 3300050507 Unclassified 1726
540 nmdc:mga08y16_905423_c1 3300050511 Bacteria 868
541 nmdc:mga0sz30_240864_c1 3300050516 Bacteria 805
542 Ga0495612_0056350 3300053078 Bacteria 1622
543 Ga0495595_0517912 3300053084 Unclassified 608
544 Ga0495619_0112348 3300053085 Bacteria 1863
545 Ga0500566_0022242 3300053094 Bacteria 3725
546 Ga0500595_001865 3300053119 Bacteria 10888
547 Ga0500652_000017 3300053131 Bacteria 121760
548 Ga0501084_1380119 3300054114 Bacteria 590
549 Ga0590071_193275 3300059421 Bacteria 535
550 Ga0501082_0000627 3300060353 Bacteria 31120
551 2821450162 2821443989 Bacteria 7658172
552 Ga0070697_100824709
553 Ga0070658_10143834
554 Ga0070683_100001260
555 Ga0070683_100025252
556 Ga0070683_100025268
557 Ga0070683_100094744
558 Ga0070683_100152052
559 Ga0070683_100227601
560 Ga0070683_101161289
561 Ga0068869_100299012
562 Ga0070666_10248538
563 Ga0070680_100004314
564 Ga0070680_100245254
565 Ga0070682_101207922
566 Ga0068868_100072340
567 Ga0068868_101946779
568 Ga0070660_100010614
569 Ga0070660_100014607
570 Ga0070689_100298669
571 Ga0070689_100540277
572 Ga0070689_100598877
573 Ga0070691_10000025
574 Ga0070691_10556646
575 Ga0070687_100202848
576 Ga0070661_100030539
577 Ga0070661_100318012
578 Ga0070668_101058626
579 Ga0070671_100376077
580 Ga0070674_101399108
581 Ga0070673_100151860
582 Ga0070673_100485070
583 Ga0070688_100160701
584 Ga0070709_11208761
585 Ga0070714_100158771
586 Ga0070714_100803468
587 Ga0070713_100248222
588 Ga0070713_100296908
589 Ga0070713_101026057
590 Ga0070710_10195969
591 Ga0070711_100190930
592 Ga0070711_100951870
593 Ga0070708_101586616
594 Ga0070678_100090231
595 Ga0070681_10003240
596 Ga0070681_10118597
597 Ga0070681_10237942
598 Ga0070681_10242554
599 Ga0068867_100060797
600 Ga0068867_100851232
601 Ga0068867_101328309
602 Ga0068867_101516818
603 Ga0070698_100337259
604 Ga0070679_100010938
605 Ga0070684_100000569
606 Ga0070684_100015714
607 Ga0070684_100087251
608 Ga0070684_100328313
609 Ga0068853_100026329
610 Ga0068853_100075304
611 Ga0068853_100099435
612 Ga0068853_100109652
613 Ga0068853_100249119
614 Ga0068853_100530971
615 Ga0070672_100230389
616 Ga0070686_100252877
617 Ga0070695_100385090
618 Ga0070693_100540071
619 Ga0070693_100706236
620 Ga0070693_100780088
621 Ga0070693_100971786
622 Ga0070665_100048671
623 Ga0070665_100063674
624 Ga0070704_100807548
625 Ga0068855_100005936
626 Ga0068855_100006084
627 Ga0068855_100011824
628 Ga0068855_100063333
629 Ga0068855_100144611
630 Ga0068855_100276187
631 Ga0068855_100581942
632 Ga0068857_100000789
633 Ga0068857_100007458
634 Ga0068857_101201712
635 Ga0068856_100003209
636 Ga0068856_100008072
637 Ga0068856_100110352
638 Ga0068856_100110762
639 Ga0068856_100207887
640 Ga0068856_100296163
641 Ga0068856_100318290
642 Ga0068856_100888262
643 Ga0070702_100354169
644 Ga0068852_100016724
645 Ga0068852_100112590
646 Ga0068859_100026683
647 Ga0068859_100048138
648 Ga0068859_101235239
649 Ga0068864_100032952
650 Ga0068864_100928959
651 Ga0068864_101330918
652 Ga0068866_10383025
653 Ga0068866_10698786
654 Ga0068866_10717818
655 Ga0068866_11350851
656 Ga0068861_100497720
657 Ga0068851_10238732
658 Ga0068863_100131081
659 Ga0068863_100168745
660 Ga0068858_100295697
661 Ga0068858_100399866
662 Ga0068860_100389126
663 Ga0068860_100567590
664 Ga0068862_100217604
665 Ga0068862_100849680
666 Ga0081540_1043873
667 Ga0081539_10000588
668 Ga0070717_10027107
669 Ga0075365_10093707
670 Ga0075365_10411881
671 Ga0075368_10007404
672 Ga0075368_10056388
673 Ga0075363_100129185
674 Ga0075363_100502851
675 Ga0075364_10083466
676 Ga0075362_10100349
677 Ga0075362_10326374
678 Ga0075362_10488029
679 Ga0075367_10001118
680 Ga0075367_10060864
681 Ga0075369_10200571
682 Ga0075366_10022361
683 Ga0075366_10147160
684 Ga0097621_100009037
685 Ga0097621_100011693
686 Ga0097621_100125704
687 Ga0097621_100327987
688 Ga0097621_102267810
689 Ga0075370_10126664
690 Ga0068871_100129817
691 Ga0068871_100142464
692 Ga0068871_101088047
693 Ga0075428_100188265
694 Ga0075431_100683045
695 Ga0075431_100942969
696 Ga0075433_10858154
697 Ga0075434_100959837
698 Ga0068865_100440274
699 Ga0068865_100587418
700 Ga0068865_100913222
701 Ga0068865_101158803
702 Ga0097620_100026683
703 Ga0097620_100048136
704 Ga0097620_101234914
705 Ga0097620_102455653
706 Ga0105240_10009670
707 Ga0105240_10015036
708 Ga0105240_10040771
709 Ga0105240_10300129
710 Ga0105240_10332035
711 Ga0105240_10590210
712 Ga0105240_10935260
713 Ga0111539_10041519
714 Ga0105245_10002996
715 Ga0105245_10018833
716 Ga0105245_10071967
717 Ga0105245_10296333
718 Ga0105245_10319613
719 Ga0105245_10475102
720 Ga0105245_11698690
721 Ga0105247_10178873
722 Ga0105247_10209962
723 Ga0114129_10049946
724 Ga0114129_10170765
725 Ga0114129_10667081
726 Ga0105243_10028524
727 Ga0105241_10007982
728 Ga0105241_10073886
729 Ga0105241_10948058
730 Ga0105241_11365502
731 Ga0105241_12329666
732 Ga0105242_10026951
733 Ga0105242_10105282
734 Ga0105242_10131770
735 Ga0105242_10149016
736 Ga0105242_10619476
737 Ga0105242_10655205
738 Ga0105242_11154379
739 Ga0105248_10002915
740 Ga0105248_10351396
741 Ga0105248_10892891
742 Ga0105248_11116374
743 Ga0105237_10001547
744 Ga0105237_10004813
745 Ga0105237_10128310
746 Ga0105237_10132040
747 Ga0105237_10394057
748 Ga0105237_10460085
749 Ga0105237_11045507
750 Ga0105237_12664379
751 Ga0105238_10005456
752 Ga0105238_10007325
753 Ga0105238_10020539
754 Ga0105238_10027893
755 Ga0105238_10070598
756 Ga0105238_10108329
757 Ga0105238_10338304
758 Ga0105238_10622520
759 Ga0105238_11270111
760 Ga0105249_10010247
761 Ga0105249_10238691
762 Ga0105249_10400300
763 Ga0105249_10609050
764 Ga0105249_10969607
765 Ga0105239_10000502
766 Ga0105239_10006356
767 Ga0105239_10059219
768 Ga0105239_10083721
769 Ga0105239_10087236
770 Ga0105239_10760309
771 Ga0105239_11311940
772 Ga0105246_10028383
773 Ga0105246_10041023
774 Ga0105246_10173718
775 Ga0105246_10528839
776 Ga0105246_11334196
777 Ga0157373_10547210
778 Ga0157371_10037744
779 Ga0157370_10002436
780 Ga0157370_10011795
781 Ga0157370_10019394
782 Ga0157370_11939885
783 Ga0157369_10004384
784 Ga0157369_10006115
785 Ga0157369_10029909
786 Ga0157369_10115265
787 Ga0157369_11348270
788 Ga0157374_10039786
789 Ga0157374_10112219
790 Ga0157374_10365524
791 Ga0157374_10400363
792 Ga0157374_11800888
793 Ga0157378_10007616
794 Ga0157378_10129396
795 Ga0157378_10807713
796 Ga0163162_10006158
797 Ga0163162_10378440
798 Ga0163162_10787991
799 Ga0163162_10820296
800 Ga0163162_12134690
801 Ga0157372_10003874
802 Ga0157372_10020404
803 Ga0157372_10045771
804 Ga0157372_10084606
805 Ga0157372_10135742
806 Ga0157372_10810758
807 Ga0157375_10004952
808 Ga0157375_10203566
809 Ga0157375_11391849
810 Ga0157375_11494080
811 Ga0163163_10020543
812 Ga0163163_10027352
813 Ga0163163_10032293
814 Ga0163163_10084987
815 Ga0163163_10261084
816 Ga0163163_10392653
817 Ga0163163_10901998
818 Ga0163163_12817913
819 Ga0157380_10376764
820 Ga0157380_10859836
821 Ga0157379_10068236
822 Ga0157379_10970607
823 Ga0157376_10227010
824 Ga0157376_12085638
825 Ga0157376_12185901
826 Ga0207682_10101536
827 Ga0207642_10581716
828 Ga0207642_10801383
829 Ga0207642_10983775
830 Ga0207710_10413525
831 Ga0207680_10154708
832 Ga0207680_10306913
833 Ga0207699_10698100
834 Ga0207699_11163105
835 Ga0207705_10917116
836 Ga0207654_10004807
837 Ga0207654_10179026
838 Ga0207654_10182620
839 Ga0207654_10993217
840 Ga0207707_10002582
841 Ga0207707_10120584
842 Ga0207695_10000808
843 Ga0207695_10016168
844 Ga0207695_10031900
845 Ga0207695_10053242
846 Ga0207695_10146909
847 Ga0207695_10246473
848 Ga0207671_10014312
849 Ga0207671_10015464
850 Ga0207671_10490168
851 Ga0207671_10501205
852 Ga0207671_11169165
853 Ga0207671_11356416
854 Ga0207660_10004175
855 Ga0207660_11367228
856 Ga0207657_10000194
857 Ga0207657_10025559
858 Ga0207649_10111720
859 Ga0207652_10015507
860 Ga0207694_10001951
861 Ga0207694_10004319
862 Ga0207694_10045601
863 Ga0207694_10125254
864 Ga0207694_10214357
865 Ga0207687_10005071
866 Ga0207687_10006316
867 Ga0207687_10032457
868 Ga0207687_10088565
869 Ga0207687_10243875
870 Ga0207687_10607459
871 Ga0207687_11462312
872 Ga0207700_10062972
873 Ga0207644_10735967
874 Ga0207644_10899633
875 Ga0207686_10077562
876 Ga0207686_10165863
877 Ga0207686_10444456
878 Ga0207686_10522354
879 Ga0207686_10911304
880 Ga0207709_10061021
881 Ga0207709_10411323
882 Ga0207670_10051094
883 Ga0207670_10914676
884 Ga0207704_10065138
885 Ga0207704_10864617
886 Ga0207704_11177030
887 Ga0207711_10009342
888 Ga0207711_10095732
889 Ga0207711_10897917
890 Ga0207689_10029232
891 Ga0207689_11068654
892 Ga0207661_10001243
893 Ga0207661_10038812
894 Ga0207661_10147069
895 Ga0207661_10152256
896 Ga0207661_10285772
897 Ga0207661_10465583
898 Ga0207661_11618909
899 Ga0207679_10249667
900 Ga0207667_10000673
901 Ga0207667_10058817
902 Ga0207667_10079460
903 Ga0207667_10203204
904 Ga0207667_10463450
905 Ga0207651_10152005
906 Ga0207712_10016691
907 Ga0207712_10044901
908 Ga0207712_10076779
909 Ga0207712_10306871
910 Ga0207712_10727862
911 Ga0207658_10091745
912 Ga0207677_10049591
913 Ga0207677_10529685
914 Ga0207703_10093127
915 Ga0207703_10095180
916 Ga0207703_10164718
917 Ga0207703_10265226
918 Ga0207639_10019509
919 Ga0207639_10070909
920 Ga0207639_10080767
921 Ga0207639_10112306
922 Ga0207639_10244434
923 Ga0207639_10421544
924 Ga0207702_10014215
925 Ga0207702_10182161
926 Ga0207702_10205122
927 Ga0207702_10470090
928 Ga0207702_10821361
929 Ga0207641_10003903
930 Ga0207641_10200316
931 Ga0207648_10075998
932 Ga0207648_10391187
933 Ga0207648_10609372
934 Ga0207648_10791039
935 Ga0207676_10098778
936 Ga0207676_10658883
937 Ga0207676_11403768
938 Ga0207674_10000109
939 Ga0207674_10003144
940 Ga0207675_100541537
941 Ga0207683_10174773
942 Ga0207698_10018022
943 Ga0207698_11436559
944 Ga0209813_10026159
945 Ga0209813_10083244
946 Ga0268266_10133794
947 Ga0268265_10255001
948 Ga0268264_10196845
949 Ga0268264_10203348
950 Ga0268264_10495865
951 Ga0268264_11647739
952 Ga0265338_10190015
953 Ga0265340_10025552
954 Ga0265331_10366049
955 Ga0307408_101402860
956 Ga0265313_10002192
957 Ga0265314_10000658
958 Ga0265314_10059657
959 Ga0265342_10214439
960 Ga0316578_10077157
961 Ga0307516_10042969
962 Ga0307412_11786192
963 Ga0307416_100399637
964 Ga0316585_10320058
965 Ga0373926_0056765
966 Ga0373926_0401715
967 Ga0373934_0005209
968 Ga0373934_0045583
969 Ga0373923_0015439
970 Ga0373945_0238087
971 Ga0373953_0128839
972 Ga0373953_0316874
973 Ga0373954_0004986
974 Ga0373954_0157059
975 Ga0373954_0159875
976 Ga0373954_0395199
977 Ga0373943_0295043
978 Ga0373955_0066065
979 Ga0373955_0067384
980 Ga0373924_0097603
981 Ga0373935_0165045
982 Ga0373935_0174200
983 Ga0373935_0245962
984 Ga0373935_0967502
985 Ga0373927_0454768
986 Ga0373927_0960174
987 Ga0373933_0025265
988 Ga0373933_0108448
989 Ga0373933_0114689
990 Ga0373933_0185501
991 Ga0373947_0013741
992 Ga0373947_0033707
993 Ga0373947_0411851
994 Ga0373937_0006934
995 Ga0373937_0011506
996 Ga0373937_0016792
997 Ga0373937_0082766
998 Ga0373937_0485600
999 Ga0373937_0668911
1000 Ga0373937_1687716
1001 Ga0373925_0041379
1002 Ga0373925_0060968
1003 Ga0373925_0200410
1004 Ga0373925_0722460
1005 Ga0373925_1328739
1006 Ga0436364_1007551
1007 Ga0436360_1247515
1008 Ga0436363_0058530
1009 Ga0436363_0267808
1010 Ga0436363_1407452
1011 Ga0451787_581785
1012 Ga0451791_1811122
1013 Ga0451797_0592358
1014 Ga0451804_0464469
1015 Ga0451807_1765324
1016 Ga0451855_2020836
1017 Ga0439445_0161641
1018 Ga0439448_0115741
1019 Ga0439464_0046863
1020 Ga0451577_0084142
1021 Ga0466963_0090796
1022 Ga0466963_1162699
1023 Ga0451576_0601738
1024 Ga0451576_2101447
1025 Ga0466967_0513910
1026 Ga0495592_0070323
1027 Ga0495651_0075326
1028 Ga0495651_0145651
1029 Ga0495653_0597208
1030 Ga0495580_0013742
1031 Ga0495580_0028592
1032 Ga0495580_0623536
1033 Ga0495639_0008037
1034 Ga0495664_0624265
1035 Ga0495594_0168768
1036 Ga0495594_0188481
1037 Ga0495608_0646554
1038 Ga0495620_0292437
1039 Ga0495630_0965510
1040 Ga0495652_0178179
1041 Ga0495665_0129688
1042 Ga0495665_0640498
1043 Ga0495586_0088205
1044 Ga0495586_0269937
1045 Ga0495587_0004553
1046 Ga0495587_0034517
1047 Ga0495645_0364696
1048 Ga0495667_0022996
1049 Ga0495634_0010869
1050 Ga0495635_0582296
1051 Ga0495599_0013011
1052 Ga0495658_1036791
1053 Ga0495669_0252242
1054 Ga0495581_0396960
1055 Ga0495604_0114335
1056 Ga0495674_0220929
1057 Ga0495680_0504496
1058 Ga0495684_0015676
1059 Ga0495684_0111042
1060 Ga0495684_0153802
1061 Ga0495684_0489934
1062 Ga0495684_0547233
1063 Ga0495686_0091597
1064 Ga0495602_0003418
1065 Ga0495602_0834659
1066 Ga0496104_0111608
1067 Ga0496104_0169574
1068 Ga0496112_0259397
1069 Ga0496121_0605791
1070 Ga0501041_0544053
1071 Ga0501067_0066783
1072 Ga0501067_0101569
1073 Ga0501073_0014419
1074 Ga0501075_0003165
1075 Ga0501077_0001180
1076 Ga0501077_0515797
1077 Ga0501080_0003726
1078 nmdc:mga03683_131444_c1
1079 nmdc:mga03n38_422349_c1
1080 nmdc:mga00v17_172962_c1
1081 nmdc:mga0k408_116543_c1
1082 nmdc:mga0k408_18587_c1
1083 nmdc:mga0k408_247214_c1
1084 nmdc:mga0k408_302579_c1
1085 nmdc:mga06z11_187868_c1
1086 nmdc:mga06z11_46107_c1
1087 nmdc:mga04h51_19236_c1
1088 nmdc:mga04h51_98476_c1
1089 nmdc:mga07m45_8580_c1
1090 nmdc:mga05p37_354637_c1
1091 nmdc:mga08y16_905423_c1
1092 nmdc:mga0sz30_240864_c1
1093 Ga0495612_0056350
1094 Ga0495595_0517912
1095 Ga0495619_0112348
1096 Ga0500566_0022242
1097 Ga0500595_001865
1098 Ga0500652_000017
1099 Ga0501084_1380119
1100 Ga0590071_193275
1101 Ga0501082_0000627
1102 2821450162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04379

DUF525

ApaG domain

40

126

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xq4-assembly1.cif.gz_A crystal structure of the putative apaa protein from bordetella pertussis, northeast structural genomics target ber40 0.9667 19 135
2f1e-assembly1.cif.gz_A solution structure of apag protein 0.9666 19 130
5hdw-assembly1.cif.gz_A apag domain of fbxo3 0.9582 11 134
1xvs-assembly1.cif.gz_B crystal structure of apag protein from vibrio cholerae 0.9578 15 134
6z9c-assembly1.cif.gz_A structure of human poldip2, a multifaceted adaptor protein in metabolism and genome stability 0.934 9 134
ID Description Score Start End Superfamily
af_Q65XS0_164_295_2.60.40.1470 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9909 11 131 2.60.40.1470
1xq4B00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9793 19 132 2.60.40.1470
2f1eA00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9666 19 130 2.60.40.1470
af_F1R287_271_403_2.60.40.1470 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9588 12 132 2.60.40.1470
1xvsB00 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.9406 14 134 2.60.40.1470
ID Description Score Start End GO Terms
AF-A0A0P7Z9S1-F1-model_v4 ApaG domain-containing protein 1.003 13 113
AF-A0A537PZ30-F1-model_v4 Co2+/Mg2+ efflux protein ApaG 0.9996 11 107 GO:0070987
AF-A0A6A6MRS0-F1-model_v4 ApaG domain-containing protein 0.9988 11 116 GO:0016020
AF-A0A382XZ37-F1-model_v4 Protein ApaG 0.9977 11 130 GO:0070987
AF-A0A445G460-F1-model_v4 Protein ApaG isoform C 0.9975 11 107

Map