F462575

General Info

Members Datasets Scaffolds Average Seq Length
551 268 546 427

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10067817|Ga0070709_100678172
Length 465
Sequence MPTDRLSGPGSAITGSGPSHVRWFLIFWLFILSAVAFLDRVNISIAGSSIASEYHLTNVELGWVFSSFLAGYALFQTLGGRLADRFGPRRILAGGAVWWGVFTALTAAIPHGIQGALLLFVSIRFLFGAGEAVIYPASNQFVSRWIPSEERGIANGLIFAGVGAGAGLSPPLITFIMLHYGWRASFWVCALIGFVVGLVWFIGARDTPAEHSLVSPSEMETIRSGLSASVDASKGARAQNLIPWKTVCKSKEVLAVTISYFSFGYVAWIFFSWFYTYLAQVRGLNLKASAFYAMLPFLAMAVCCAVGGMVSDRLTRSHGPRVGRCYLAAIVIALAAVFLVFGAEVHSARLASVVLAGGAGALYLAQSSFWSVTADLAGASSGSVSGFMNMGAQAGGWFTAWLTPLIASHFGWTASFLVAAGLCLMGAAAWLFVDPNRTLEATPAPAGVQMTPSTLISSASVSENY

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
110 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
111 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
112 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
167 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.36
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 5.99
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1349230 2162886012 Bacteria 4404
2 JGI24739J22299_10012831 3300001989 Bacteria 3069
3 JGI24735J21928_10022232 3300002067 Bacteria 1933
4 JGI24751J29686_10002143 3300002459 Bacteria 4005
5 Ga0070676_10000032 3300005328 Bacteria 41977
6 Ga0070676_10007530 3300005328 Bacteria 5847
7 Ga0070683_100052169 3300005329 Bacteria 3788
8 Ga0070690_100011035 3300005330 Bacteria 5276
9 Ga0070670_100024963 3300005331 Bacteria 5142
10 Ga0068869_100006303 3300005334 Bacteria 7511
11 Ga0068869_100033514 3300005334 Bacteria 3626
12 Ga0070666_10046981 3300005335 Bacteria 2897
13 Ga0070666_10082575 3300005335 Bacteria 2197
14 Ga0070666_10088323 3300005335 Bacteria 2127
15 Ga0070680_100054663 3300005336 Bacteria 3261
16 Ga0070682_100009656 3300005337 Bacteria 5461
17 Ga0068868_100003343 3300005338 Bacteria 11162
18 Ga0068868_100006628 3300005338 Bacteria 8212
19 Ga0070660_100002962 3300005339 Bacteria 11680
20 Ga0070660_100167806 3300005339 Bacteria 1771
21 Ga0070689_100018311 3300005340 Bacteria 5157
22 Ga0070661_100005290 3300005344 Bacteria 8893
23 Ga0070661_100010092 3300005344 Bacteria 6558
24 Ga0070661_100037985 3300005344 Bacteria 3504
25 Ga0070661_100045028 3300005344 Bacteria 3225
26 Ga0070668_100024596 3300005347 Bacteria 4563
27 Ga0070675_100009782 3300005354 Bacteria 7469
28 Ga0070671_100011409 3300005355 Bacteria 7145
29 Ga0070671_100037185 3300005355 Bacteria 4037
30 Ga0070674_100040965 3300005356 Bacteria 3136
31 Ga0070673_100034314 3300005364 Bacteria 3838
32 Ga0070673_100179820 3300005364 Unclassified 1810
33 Ga0070688_100001836 3300005365 Bacteria 10667
34 Ga0070688_100171673 3300005365 Bacteria 1497
35 Ga0070659_100011244 3300005366 Bacteria 6612
36 Ga0070659_100043959 3300005366 Unclassified 3495
37 Ga0070667_100010667 3300005367 Bacteria 7590
38 Ga0070709_10000332 3300005434 Bacteria 29688
39 Ga0070709_10025913 3300005434 Bacteria 3469
40 Ga0070709_10028200 3300005434 Bacteria 3347
41 Ga0070709_10067817 3300005434 Bacteria 2292
42 Ga0070709_10123640 3300005434 Unclassified 1758
43 Ga0070714_100000065 3300005435 Bacteria 96459
44 Ga0070714_100141836 3300005435 Bacteria 2158
45 Ga0070713_100000856 3300005436 Bacteria 19501
46 Ga0070713_100000862 3300005436 Bacteria 19416
47 Ga0070711_100000078 3300005439 Bacteria 54188
48 Ga0070711_100000147 3300005439 Bacteria 37937
49 Ga0070711_100000993 3300005439 Bacteria 15033
50 Ga0070711_100003687 3300005439 Bacteria 8968
51 Ga0070711_100025160 3300005439 Unclassified 3891
52 Ga0070711_100040686 3300005439 Unclassified 3136
53 Ga0070708_100002764 3300005445 Bacteria 13627
54 Ga0070708_100007053 3300005445 Bacteria 8966
55 Ga0070708_100015038 3300005445 Bacteria 6383
56 Ga0070708_100018361 3300005445 Bacteria 5854
57 Ga0070708_100040569 3300005445 Bacteria 4077
58 Ga0070708_100084736 3300005445 Bacteria 2875
59 Ga0070663_100020212 3300005455 Bacteria 4405
60 Ga0070678_100118948 3300005456 Bacteria 2080
61 Ga0070662_100010648 3300005457 Bacteria 6047
62 Ga0070662_100021721 3300005457 Bacteria 4386
63 Ga0070662_100029007 3300005457 Bacteria 3858
64 Ga0068867_100006702 3300005459 Bacteria 8142
65 Ga0068867_100014513 3300005459 Bacteria 5584
66 Ga0070685_10001249 3300005466 Bacteria 13488
67 Ga0070706_100003558 3300005467 Bacteria 15324
68 Ga0070707_100012154 3300005468 Bacteria 8037
69 Ga0070698_100002364 3300005471 Bacteria 20808
70 Ga0070699_100052341 3300005518 Unclassified 3534
71 Ga0070684_100001539 3300005535 Bacteria 16657
72 Ga0070684_100065818 3300005535 Bacteria 3182
73 Ga0070684_100080732 3300005535 Bacteria 2877
74 Ga0070684_100207084 3300005535 Bacteria 1787
75 Ga0070697_100000588 3300005536 Bacteria 27480
76 Ga0070697_100002429 3300005536 Bacteria 14331
77 Ga0070697_100076607 3300005536 Bacteria 2750
78 Ga0070697_100216337 3300005536 Bacteria 1632
79 Ga0068853_100007078 3300005539 Bacteria 8972
80 Ga0068853_100007112 3300005539 Bacteria 8956
81 Ga0068853_100097095 3300005539 Bacteria 2600
82 Ga0070672_100020496 3300005543 Bacteria 4823
83 Ga0070686_100005627 3300005544 Bacteria 6943
84 Ga0070686_100079820 3300005544 Bacteria 2164
85 Ga0070695_100015508 3300005545 Bacteria 4602
86 Ga0070696_100018704 3300005546 Bacteria 4686
87 Ga0070693_100079106 3300005547 Bacteria 1955
88 Ga0070665_100079777 3300005548 Bacteria 3279
89 Ga0068855_100026524 3300005563 Bacteria 6931
90 Ga0068855_100194999 3300005563 Bacteria 2282
91 Ga0070664_100028916 3300005564 Bacteria 4616
92 Ga0070664_100029921 3300005564 Unclassified 4540
93 Ga0068857_100000800 3300005577 Bacteria 23516
94 Ga0068857_100069231 3300005577 Bacteria 3142
95 Ga0068857_100069815 3300005577 Bacteria 3129
96 Ga0068857_100106138 3300005577 Bacteria 2522
97 Ga0068854_100003468 3300005578 Bacteria 9845
98 Ga0068856_100051526 3300005614 Bacteria 4058
99 Ga0070702_100020911 3300005615 Bacteria 3436
100 Ga0068852_100069038 3300005616 Bacteria 3096
101 Ga0068859_100018197 3300005617 Bacteria 7062
102 Ga0068859_100026033 3300005617 Bacteria 5869
103 Ga0068859_100028325 3300005617 Bacteria 5615
104 Ga0068859_100063424 3300005617 Bacteria 3726
105 Ga0068864_100062993 3300005618 Bacteria 3214
106 Ga0068864_100137439 3300005618 Bacteria 2202
107 Ga0068866_10008235 3300005718 Bacteria 4385
108 Ga0068866_10056708 3300005718 Unclassified 2015
109 Ga0068861_100103348 3300005719 Bacteria 2270
110 Ga0068861_100235114 3300005719 Bacteria 1556
111 Ga0068851_10003518 3300005834 Bacteria 6967
112 Ga0068851_10037445 3300005834 Unclassified 2432
113 Ga0068870_10001324 3300005840 Bacteria 9966
114 Ga0068863_100021909 3300005841 Bacteria 6097
115 Ga0068863_100091497 3300005841 Bacteria 2885
116 Ga0068863_100254449 3300005841 Unclassified 1697
117 Ga0068858_100003398 3300005842 Bacteria 15829
118 Ga0068858_100010601 3300005842 Bacteria 8724
119 Ga0068860_100089343 3300005843 Bacteria 2933
120 Ga0068860_100100622 3300005843 Bacteria 2758
121 Ga0068860_100159947 3300005843 Bacteria 2171
122 Ga0068860_100317503 3300005843 Bacteria 1529
123 Ga0068862_100006015 3300005844 Bacteria 10108
124 Ga0081540_1051312 3300005983 Unclassified 2041
125 Ga0070717_10001170 3300006028 Bacteria 17721
126 Ga0070717_10005939 3300006028 Bacteria 8940
127 Ga0070717_10011129 3300006028 Bacteria 6818
128 Ga0070717_10024655 3300006028 Bacteria 4779
129 Ga0070717_10035030 3300006028 Bacteria 4061
130 Ga0070715_10001751 3300006163 Bacteria 6457
131 Ga0070715_10014899 3300006163 Bacteria 2890
132 Ga0070716_100000248 3300006173 Bacteria 21595
133 Ga0070716_100003139 3300006173 Bacteria 7725
134 Ga0070716_100010359 3300006173 Bacteria 4671
135 Ga0070716_100029718 3300006173 Bacteria 2957
136 Ga0070716_100118399 3300006173 Unclassified 1654
137 Ga0070716_100137883 3300006173 Unclassified 1551
138 Ga0070712_100000228 3300006175 Bacteria 31570
139 Ga0070712_100004509 3300006175 Bacteria 8598
140 Ga0070712_100010578 3300006175 Bacteria 5825
141 Ga0070712_100013696 3300006175 Bacteria 5188
142 Ga0070712_100029340 3300006175 Bacteria 3686
143 Ga0070712_100035497 3300006175 Bacteria 3384
144 Ga0070712_100194477 3300006175 Unclassified 1589
145 Ga0097621_100007030 3300006237 Bacteria 8016
146 Ga0097621_100037822 3300006237 Bacteria 3870
147 Ga0097621_100125477 3300006237 Bacteria 2180
148 Ga0068871_100011411 3300006358 Bacteria 6516
149 Ga0068871_100056511 3300006358 Bacteria 3190
150 Ga0075434_100017278 3300006871 Bacteria 6948
151 Ga0075434_100114649 3300006871 Bacteria 2708
152 Ga0068865_100004978 3300006881 Bacteria 8033
153 Ga0068865_100026715 3300006881 Bacteria 3807
154 Ga0075436_100000061 3300006914 Bacteria 64633
155 Ga0075436_100005552 3300006914 Bacteria 8668
156 Ga0097620_100018197 3300006931 Bacteria 7062
157 Ga0097620_100026033 3300006931 Bacteria 5869
158 Ga0097620_100028327 3300006931 Bacteria 5615
159 Ga0097620_100063422 3300006931 Bacteria 3726
160 Ga0099794_10001317 3300007265 Bacteria 8632
161 Ga0099794_10003137 3300007265 Bacteria 6260
162 Ga0099794_10016059 3300007265 Unclassified 3314
163 Ga0099794_10043344 3300007265 Unclassified 2147
164 Ga0099794_10045617 3300007265 Bacteria 2098
165 Ga0099794_10072029 3300007265 Bacteria 1694
166 Ga0105250_10028418 3300009092 Bacteria 2252
167 Ga0105240_10030350 3300009093 Bacteria 7026
168 Ga0105240_10053116 3300009093 Bacteria 5089
169 Ga0105240_10063080 3300009093 Unclassified 4611
170 Ga0105240_10093743 3300009093 Bacteria 3664
171 Ga0105240_10126147 3300009093 Unclassified 3075
172 Ga0105245_10025834 3300009098 Bacteria 5165
173 Ga0105245_10079965 3300009098 Bacteria 2986
174 Ga0105245_10209221 3300009098 Bacteria 1877
175 Ga0105247_10011606 3300009101 Bacteria 5307
176 Ga0105247_10015309 3300009101 Unclassified 4596
177 Ga0105247_10026787 3300009101 Bacteria 3484
178 Ga0105243_10057351 3300009148 Bacteria 3100
179 Ga0105241_10003060 3300009174 Bacteria 12472
180 Ga0105241_10020237 3300009174 Bacteria 4915
181 Ga0105241_10203189 3300009174 Bacteria 1656
182 Ga0105242_10040558 3300009176 Bacteria 3752
183 Ga0105242_10243731 3300009176 Bacteria 1617
184 Ga0105248_10006022 3300009177 Bacteria 13314
185 Ga0105248_10094313 3300009177 Bacteria 3370
186 Ga0105237_10007636 3300009545 Bacteria 11816
187 Ga0105237_10043608 3300009545 Bacteria 4518
188 Ga0105237_10071837 3300009545 Unclassified 3454
189 Ga0105237_10114967 3300009545 Bacteria 2684
190 Ga0105237_10180357 3300009545 Unclassified 2112
191 Ga0105238_10190357 3300009551 Bacteria 2028
192 Ga0105249_10051734 3300009553 Bacteria 3748
193 Ga0099796_10001434 3300010159 Plasmid 4795
194 Ga0105239_10027187 3300010375 Bacteria 6298
195 Ga0105246_10000585 3300011119 Bacteria 20210
196 Ga0157373_10019722 3300013100 Bacteria 4905
197 Ga0157373_10020397 3300013100 Bacteria 4818
198 Ga0157371_10013614 3300013102 Bacteria 6173
199 Ga0157369_10045453 3300013105 Unclassified 4776
200 Ga0157369_10060300 3300013105 Bacteria 4091
201 Ga0157369_10063571 3300013105 Bacteria 3976
202 Ga0157369_10110106 3300013105 Bacteria 2928
203 Ga0157374_10000328 3300013296 Bacteria 43754
204 Ga0157374_10005486 3300013296 Bacteria 10651
205 Ga0157374_10024009 3300013296 Bacteria 5460
206 Ga0157374_10131936 3300013296 Bacteria 2418
207 Ga0157378_10088940 3300013297 Bacteria 2804
208 Ga0157378_10137602 3300013297 Bacteria 2265
209 Ga0163162_10001977 3300013306 Bacteria 19243
210 Ga0163162_10018926 3300013306 Bacteria 6752
211 Ga0163162_10047749 3300013306 Bacteria 4289
212 Ga0157372_10008184 3300013307 Bacteria 11115
213 Ga0157372_10011320 3300013307 Bacteria 9486
214 Ga0157372_10012075 3300013307 Bacteria 9200
215 Ga0157372_10039068 3300013307 Bacteria 5238
216 Ga0157372_10045279 3300013307 Bacteria 4880
217 Ga0157372_10048077 3300013307 Bacteria 4742
218 Ga0157372_10068248 3300013307 Unclassified 3997
219 Ga0157372_10279378 3300013307 Bacteria 1941
220 Ga0157372_10378576 3300013307 Bacteria 1649
221 Ga0157375_10000473 3300013308 Bacteria 36686
222 Ga0157375_10049829 3300013308 Bacteria 4105
223 Ga0157375_10077221 3300013308 Bacteria 3359
224 Ga0157375_10156123 3300013308 Bacteria 2421
225 Ga0157375_10241801 3300013308 Bacteria 1965
226 Ga0157375_10247691 3300013308 Bacteria 1942
227 Ga0163163_10006586 3300014325 Bacteria 10172
228 Ga0163163_10008924 3300014325 Bacteria 8930
229 Ga0163163_10027381 3300014325 Bacteria 5460
230 Ga0163163_10028547 3300014325 Bacteria 5360
231 Ga0163163_10036805 3300014325 Bacteria 4756
232 Ga0163163_10074330 3300014325 Bacteria 3390
233 Ga0163163_10181911 3300014325 Bacteria 2149
234 Ga0157380_10049777 3300014326 Bacteria 3306
235 Ga0157377_10001704 3300014745 Bacteria 9592
236 Ga0157379_10001487 3300014968 Bacteria 19295
237 Ga0157379_10007611 3300014968 Bacteria 9378
238 Ga0157379_10015521 3300014968 Bacteria 6684
239 Ga0157379_10017280 3300014968 Bacteria 6355
240 Ga0157379_10155892 3300014968 Unclassified 2060
241 Ga0157379_10198328 3300014968 Bacteria 1815
242 Ga0157376_10000030 3300014969 Bacteria 181885
243 Ga0157376_10005457 3300014969 Bacteria 8888
244 Ga0157376_10008453 3300014969 Bacteria 7431
245 Ga0157376_10017240 3300014969 Bacteria 5502
246 Ga0157376_10041904 3300014969 Bacteria 3751
247 Ga0157376_10121490 3300014969 Unclassified 2316
248 Ga0157376_10147964 3300014969 Unclassified 2115
249 Ga0157376_10209363 3300014969 Bacteria 1799
250 Ga0182007_10017570 3300015262 Bacteria 2609
251 Ga0182005_1009312 3300015265 Bacteria 2860
252 Ga0163161_10007365 3300017792 Bacteria 7597
253 Ga0213872_10000987 3300021361 Bacteria 19905
254 Ga0224570_100502 3300022730 Unclassified 3077
255 Ga0224569_100686 3300022732 Bacteria 2881
256 Ga0224572_1015504 3300024225 Unclassified 1460
257 Ga0228598_1000569 3300024227 Bacteria 7729
258 Ga0228598_1004969 3300024227 Bacteria 2797
259 Ga0207697_10025715 3300025315 Bacteria 2406
260 Ga0207656_10004521 3300025321 Bacteria 4865
261 Ga0207656_10014357 3300025321 Bacteria 3049
262 Ga0207710_10001989 3300025900 Bacteria 9751
263 Ga0207688_10014005 3300025901 Bacteria 4361
264 Ga0207680_10022506 3300025903 Bacteria 3429
265 Ga0207647_10000730 3300025904 Bacteria 25805
266 Ga0207647_10002001 3300025904 Bacteria 15592
267 Ga0207647_10002386 3300025904 Bacteria 14259
268 Ga0207685_10008794 3300025905 Unclassified 2898
269 Ga0207699_10001156 3300025906 Bacteria 12472
270 Ga0207699_10017626 3300025906 Bacteria 3765
271 Ga0207699_10053975 3300025906 Unclassified 2385
272 Ga0207699_10064331 3300025906 Bacteria 2219
273 Ga0207645_10001142 3300025907 Bacteria 21910
274 Ga0207645_10015856 3300025907 Bacteria 4993
275 Ga0207643_10000478 3300025908 Bacteria 25853
276 Ga0207705_10077343 3300025909 Bacteria 2420
277 Ga0207684_10029317 3300025910 Unclassified 4688
278 Ga0207654_10040824 3300025911 Unclassified 2617
279 Ga0207695_10004159 3300025913 Bacteria 19871
280 Ga0207695_10009276 3300025913 Bacteria 12187
281 Ga0207695_10080379 3300025913 Unclassified 3301
282 Ga0207671_10014577 3300025914 Bacteria 6201
283 Ga0207671_10062329 3300025914 Bacteria 2769
284 Ga0207671_10095971 3300025914 Unclassified 2240
285 Ga0207693_10000012 3300025915 Bacteria 154708
286 Ga0207693_10000108 3300025915 Bacteria 75296
287 Ga0207693_10000622 3300025915 Bacteria 31701
288 Ga0207693_10000808 3300025915 Bacteria 28014
289 Ga0207693_10002543 3300025915 Bacteria 15859
290 Ga0207693_10008067 3300025915 Bacteria 8634
291 Ga0207693_10036261 3300025915 Bacteria 3887
292 Ga0207663_10000658 3300025916 Bacteria 15321
293 Ga0207663_10005366 3300025916 Bacteria 6447
294 Ga0207663_10018252 3300025916 Bacteria 3928
295 Ga0207663_10056805 3300025916 Unclassified 2464
296 Ga0207663_10100612 3300025916 Bacteria 1940
297 Ga0207657_10000099 3300025919 Bacteria 83148
298 Ga0207657_10000898 3300025919 Bacteria 31448
299 Ga0207657_10001200 3300025919 Bacteria 27561
300 Ga0207657_10036957 3300025919 Bacteria 4367
301 Ga0207649_10007529 3300025920 Bacteria 5919
302 Ga0207649_10026267 3300025920 Bacteria 3405
303 Ga0207652_10045116 3300025921 Bacteria 3757
304 Ga0207646_10006398 3300025922 Bacteria 12180
305 Ga0207646_10024132 3300025922 Bacteria 5574
306 Ga0207646_10140975 3300025922 Bacteria 2171
307 Ga0207694_10071741 3300025924 Bacteria 2706
308 Ga0207650_10000053 3300025925 Bacteria 164599
309 Ga0207687_10005999 3300025927 Bacteria 8041
310 Ga0207700_10000557 3300025928 Bacteria 21915
311 Ga0207700_10003390 3300025928 Bacteria 9254
312 Ga0207700_10074551 3300025928 Bacteria 2625
313 Ga0207664_10002011 3300025929 Bacteria 13396
314 Ga0207664_10016198 3300025929 Bacteria 5431
315 Ga0207664_10045900 3300025929 Unclassified 3428
316 Ga0207664_10100611 3300025929 Bacteria 2387
317 Ga0207644_10004065 3300025931 Bacteria 9486
318 Ga0207690_10076253 3300025932 Bacteria 2327
319 Ga0207706_10000973 3300025933 Bacteria 29233
320 Ga0207706_10019059 3300025933 Bacteria 6172
321 Ga0207686_10044630 3300025934 Unclassified 2723
322 Ga0207709_10030734 3300025935 Bacteria 3127
323 Ga0207665_10001867 3300025939 Bacteria 14204
324 Ga0207665_10004299 3300025939 Bacteria 9463
325 Ga0207665_10009817 3300025939 Bacteria 6285
326 Ga0207665_10013845 3300025939 Bacteria 5305
327 Ga0207665_10024560 3300025939 Unclassified 3974
328 Ga0207665_10038127 3300025939 Bacteria 3199
329 Ga0207665_10047290 3300025939 Bacteria 2884
330 Ga0207691_10003378 3300025940 Bacteria 15536
331 Ga0207711_10007157 3300025941 Bacteria 9351
332 Ga0207711_10037692 3300025941 Bacteria 4108
333 Ga0207711_10084114 3300025941 Bacteria 2785
334 Ga0207689_10007355 3300025942 Bacteria 9657
335 Ga0207661_10000435 3300025944 Bacteria 26948
336 Ga0207661_10004917 3300025944 Bacteria 9368
337 Ga0207661_10025580 3300025944 Bacteria 4489
338 Ga0207679_10000140 3300025945 Bacteria 59718
339 Ga0207667_10007140 3300025949 Bacteria 13484
340 Ga0207651_10171031 3300025960 Bacteria 1714
341 Ga0207712_10028640 3300025961 Bacteria 3728
342 Ga0207668_10039904 3300025972 Unclassified 3164
343 Ga0207640_10075066 3300025981 Bacteria 2290
344 Ga0207658_10008131 3300025986 Bacteria 7144
345 Ga0207658_10188035 3300025986 Bacteria 1714
346 Ga0207703_10001419 3300026035 Bacteria 21845
347 Ga0207703_10015339 3300026035 Bacteria 5976
348 Ga0207639_10033851 3300026041 Bacteria 3773
349 Ga0207639_10068417 3300026041 Bacteria 2767
350 Ga0207678_10006566 3300026067 Bacteria 10312
351 Ga0207678_10078351 3300026067 Unclassified 2830
352 Ga0207641_10000321 3300026088 Bacteria 58896
353 Ga0207641_10005807 3300026088 Bacteria 10472
354 Ga0207648_10000314 3300026089 Bacteria 53108
355 Ga0207648_10005869 3300026089 Bacteria 12283
356 Ga0207648_10010314 3300026089 Bacteria 8868
357 Ga0207648_10094646 3300026089 Unclassified 2612
358 Ga0207676_10004705 3300026095 Bacteria 9667
359 Ga0207676_10055926 3300026095 Bacteria 3100
360 Ga0207674_10000092 3300026116 Bacteria 99761
361 Ga0207674_10001720 3300026116 Bacteria 27998
362 Ga0207674_10161746 3300026116 Bacteria 2193
363 Ga0207675_100005271 3300026118 Bacteria 12438
364 Ga0207675_100017704 3300026118 Bacteria 6647
365 Ga0207675_100235427 3300026118 Bacteria 1768
366 Ga0207683_10007677 3300026121 Bacteria 9234
367 Ga0207683_10025739 3300026121 Bacteria 5075
368 Ga0209588_1031740 3300027671 Unclassified 1691
369 Ga0265354_1000006 3300028016 Bacteria 32449
370 Ga0265356_1000090 3300028017 Bacteria 15313
371 Ga0268265_10002752 3300028380 Bacteria 12981
372 Ga0268265_10191590 3300028380 Bacteria 1766
373 Ga0268264_10011297 3300028381 Bacteria 7376
374 Ga0268264_10035224 3300028381 Bacteria 4120
375 Ga0268264_10038199 3300028381 Bacteria 3961
376 Ga0268264_10116198 3300028381 Bacteria 2351
377 Ga0265338_10002594 3300028800 Bacteria 26721
378 Ga0265762_1001979 3300030760 Bacteria 3723
379 Ga0265760_10012146 3300031090 Bacteria 2460
380 Ga0265316_10006270 3300031344 Bacteria 11399
381 Ga0307408_100022318 3300031548 Unclassified 4299
382 Ga0265314_10001967 3300031711 Bacteria 21850
383 Ga0307406_10002607 3300031901 Bacteria 9829
384 Ga0316212_1003812 3300033547 Unclassified 2187
385 Ga0373926_0013128 3300035083 Unclassified 2806
386 Ga0373934_0004876 3300035086 Unclassified 4964
387 Ga0373944_0034418 3300035089 Unclassified 1540
388 Ga0373923_0038857 3300035111 Bacteria 1952
389 Ga0373945_0017731 3300035116 Unclassified 2414
390 Ga0373953_0003990 3300035117 Unclassified 4657
391 Ga0373954_0004799 3300035118 Bacteria 5830
392 Ga0373954_0017165 3300035118 Bacteria 3246
393 Ga0373956_0003824 3300035119 Bacteria 6056
394 Ga0373956_0052590 3300035119 Bacteria 1832
395 Ga0373943_0006600 3300035170 Bacteria 5202
396 Ga0373955_0002557 3300035172 Bacteria 7957
397 Ga0373955_0047227 3300035172 Bacteria 2330
398 Ga0373955_0084500 3300035172 Unclassified 1800
399 Ga0373962_0031054 3300035242 Bacteria 1464
400 Ga0373931_0037872 3300035691 Bacteria 2520
401 Ga0373935_0001385 3300035692 Bacteria 13401
402 Ga0373935_0029615 3300035692 Bacteria 3389
403 Ga0373927_0000454 3300035695 Bacteria 31317
404 Ga0373927_0046938 3300035695 Bacteria 2794
405 Ga0373927_0101268 3300035695 Bacteria 1874
406 Ga0373933_0005505 3300035724 Bacteria 6897
407 Ga0373933_0033811 3300035724 Bacteria 2976
408 Ga0373947_0009236 3300035725 Bacteria 5667
409 Ga0373947_0019011 3300035725 Bacteria 3958
410 Ga0373947_0059422 3300035725 Bacteria 2318
411 Ga0373937_0001572 3300036401 Bacteria 19175
412 Ga0373937_0036195 3300036401 Bacteria 4497
413 Ga0373937_0077007 3300036401 Bacteria 3081
414 Ga0373925_0000782 3300037068 Bacteria 29294
415 Ga0373925_0031280 3300037068 Bacteria 3910
416 Ga0373925_0166934 3300037068 Bacteria 1736
417 Ga0373925_0183932 3300037068 Bacteria 1656
418 Ga0395905_0071834 3300037471 Bacteria 3245
419 Ga0436362_0802604 3300039453 Bacteria 3908
420 Ga0436362_1166207 3300039453 Bacteria 2088
421 Ga0439458_0001728 3300042157 Bacteria 5463
422 Ga0466966_0095398 3300044684 Bacteria 1843
423 Ga0466967_0170461 3300045976 Unclassified 2047
424 Ga0466967_0366053 3300045976 Bacteria 1398
425 Ga0495580_0000977 3300046472 Bacteria 25057
426 Ga0495580_0001272 3300046472 Bacteria 22231
427 Ga0495580_0001342 3300046472 Bacteria 21668
428 Ga0495580_0002203 3300046472 Bacteria 17047
429 Ga0495580_0058756 3300046472 Unclassified 2704
430 Ga0495582_0000037 3300046473 Bacteria 70566
431 Ga0495639_0006196 3300046475 Bacteria 5136
432 Ga0495594_0013707 3300046499 Unclassified 4237
433 Ga0495594_0072481 3300046499 Bacteria 1916
434 Ga0495628_0080946 3300046516 Unclassified 2523
435 Ga0495630_0099051 3300046517 Unclassified 2205
436 Ga0495648_0075339 3300046524 Unclassified 1941
437 Ga0495666_0085278 3300046526 Bacteria 1492
438 Ga0495586_0063057 3300046535 Unclassified 2018
439 Ga0495587_0003145 3300046536 Bacteria 11029
440 Ga0495645_0017672 3300046543 Bacteria 5112
441 Ga0495667_0049162 3300046559 Unclassified 2784
442 Ga0495625_0133539 3300046660 Bacteria 1680
443 Ga0495599_0120230 3300046678 Unclassified 1633
444 Ga0495623_0014435 3300046679 Bacteria 5113
445 Ga0495658_0017562 3300046683 Bacteria 3699
446 Ga0495658_0045540 3300046683 Bacteria 2462
447 Ga0495658_0052068 3300046683 Unclassified 2320
448 Ga0495669_0077845 3300046684 Bacteria 1519
449 Ga0495604_0009835 3300047317 Bacteria 7566
450 Ga0495674_0018016 3300047319 Bacteria 6573
451 Ga0495674_0059967 3300047319 Unclassified 3322
452 Ga0495674_0122012 3300047319 Bacteria 2201
453 Ga0495672_0006641 3300047320 Bacteria 8888
454 Ga0495672_0006880 3300047320 Bacteria 8676
455 Ga0495684_0017031 3300047471 Bacteria 5598
456 Ga0495686_0001979 3300047472 Bacteria 20321
457 Ga0495686_0014262 3300047472 Bacteria 5475
458 Ga0495686_0014283 3300047472 Bacteria 5471
459 Ga0495686_0121990 3300047472 Bacteria 1552
460 Ga0495602_0008779 3300048088 Bacteria 10548
461 Ga0495602_0009777 3300048088 Bacteria 9961
462 Ga0495602_0181943 3300048088 Unclassified 1620
463 Ga0496100_0100597 3300048903 Bacteria 1992
464 Ga0496100_0130548 3300048903 Bacteria 1769
465 Ga0496102_0005199 3300048905 Bacteria 11049
466 Ga0496102_0037108 3300048905 Bacteria 4395
467 Ga0496102_0045087 3300048905 Bacteria 4002
468 Ga0496102_0266058 3300048905 Bacteria 1616
469 Ga0496103_0026996 3300048906 Bacteria 3477
470 Ga0496103_0049590 3300048906 Bacteria 2596
471 Ga0496103_0063476 3300048906 Bacteria 2301
472 Ga0496104_0061189 3300048907 Bacteria 3569
473 Ga0496104_0175754 3300048907 Bacteria 2052
474 Ga0496106_0018696 3300048909 Bacteria 5131
475 Ga0496106_0046511 3300048909 Bacteria 3263
476 Ga0496106_0148752 3300048909 Unclassified 1846
477 Ga0496107_0027564 3300048910 Bacteria 4034
478 Ga0496107_0145937 3300048910 Bacteria 1749
479 Ga0496108_0007454 3300048911 Bacteria 8868
480 Ga0496108_0151033 3300048911 Bacteria 2004
481 Ga0496108_0165952 3300048911 Bacteria 1909
482 Ga0496109_0015768 3300048912 Bacteria 6596
483 Ga0496109_0148107 3300048912 Unclassified 2197
484 Ga0496110_0006872 3300048913 Bacteria 9045
485 Ga0496112_0000146 3300048915 Bacteria 44267
486 Ga0496112_0002955 3300048915 Bacteria 13862
487 Ga0496112_0019330 3300048915 Bacteria 6428
488 Ga0496112_0024307 3300048915 Bacteria 5800
489 Ga0496112_0024519 3300048915 Bacteria 5777
490 Ga0496112_0027529 3300048915 Bacteria 5481
491 Ga0496112_0165504 3300048915 Unclassified 2177
492 Ga0496113_0049688 3300048916 Bacteria 3124
493 Ga0496115_0019838 3300048918 Bacteria 5180
494 Ga0496115_0028763 3300048918 Bacteria 4359
495 Ga0496115_0057398 3300048918 Bacteria 3131
496 Ga0496116_0012258 3300048919 Bacteria 7012
497 Ga0496117_0000035 3300048920 Bacteria 326449
498 Ga0496118_0000054 3300048921 Bacteria 233617
499 Ga0496119_0004560 3300048922 Bacteria 13709
500 Ga0496120_0029038 3300048923 Unclassified 3381
501 Ga0496121_0002192 3300048924 Bacteria 30563
502 Ga0496122_0004629 3300048925 Bacteria 16923
503 Ga0496123_0002862 3300048926 Bacteria 20314
504 Ga0496124_0004189 3300048927 Bacteria 16988
505 Ga0496124_0068475 3300048927 Bacteria 2949
506 Ga0496125_0003275 3300048928 Bacteria 19914
507 Ga0496125_0007617 3300048928 Bacteria 11491
508 Ga0496126_0002190 3300048929 Bacteria 27165
509 Ga0496126_0003894 3300048929 Bacteria 18354
510 Ga0496126_0142967 3300048929 Bacteria 2057
511 Ga0501031_0032167 3300049568 Bacteria 3421
512 Ga0501031_0080548 3300049568 Bacteria 2122
513 Ga0501032_0003816 3300049569 Bacteria 11441
514 Ga0501032_0012457 3300049569 Bacteria 6076
515 Ga0501033_0000675 3300049570 Bacteria 31467
516 Ga0501033_0023462 3300049570 Bacteria 4652
517 Ga0501036_0002489 3300049572 Bacteria 14444
518 Ga0501037_0001892 3300049573 Bacteria 15220
519 Ga0501037_0019663 3300049573 Bacteria 4983
520 Ga0501037_0138852 3300049573 Bacteria 1740
521 Ga0501038_0005942 3300049574 Bacteria 11289
522 Ga0501039_0135014 3300049575 Bacteria 1937
523 Ga0501043_0001924 3300049579 Bacteria 17773
524 Ga0501043_0008177 3300049579 Bacteria 8252
525 Ga0501046_0000389 3300049580 Bacteria 44043
526 Ga0501046_0116100 3300049580 Bacteria 2041
527 Ga0501047_0005145 3300049581 Bacteria 12274
528 Ga0501047_0008295 3300049581 Bacteria 9805
529 Ga0501047_0010899 3300049581 Bacteria 8597
530 Ga0501047_0022562 3300049581 Bacteria 6044
531 Ga0501048_0167497 3300049582 Bacteria 1556
532 Ga0501070_0064572 3300049586 Bacteria 3031
533 Ga0501073_0001170 3300049589 Bacteria 19167
534 Ga0501080_0011888 3300049742 Bacteria 7976
535 Ga0501080_0018597 3300049742 Bacteria 6431
536 Ga0501083_0088236 3300049744 Bacteria 2051
537 Ga0501035_0000357 3300049822 Bacteria 52667
538 Ga0501035_0278729 3300049822 Bacteria 1414
539 Ga0501044_0001820 3300049823 Bacteria 24832
540 Ga0501044_0074996 3300049823 Bacteria 3435
541 nmdc:mga0n895_94768_c1 3300050512 Bacteria 2989
542 nmdc:mga08x19_1500_c1 3300050514 Bacteria 14454
543 nmdc:mga08x19_3625_c1 3300050514 Bacteria 9192
544 Ga0495601_0040880 3300053077 Bacteria 2905
545 Ga0495619_0051410 3300053085 Unclassified 2723
546 Ga0500651_0000002 3300053093 Bacteria 476609

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0165504 Ga0496112_0165504_985_2103 324
2 3300035117 Ga0373953_0003990 Ga0373953_0003990_394_1545 331
3 3300048906 Ga0496103_0063476 Ga0496103_0063476_1023_2165 345
4 3300048088 Ga0495602_0181943 Ga0495602_0181943_401_1609 350
5 3300049822 Ga0501035_0278729 Ga0501035_0278729_92_1396 358
6 3300047472 Ga0495686_0014283 Ga0495686_0014283_577_1788 360
7 3300048925 Ga0496122_0004629 Ga0496122_0004629_15178_16431 362
8 3300048926 Ga0496123_0002862 Ga0496123_0002862_17031_18284 362
9 3300048927 Ga0496124_0004189 Ga0496124_0004189_14640_15893 362
10 3300005435 Ga0070714_100141836 Ga0070714_1001418362 363
11 3300025929 Ga0207664_10045900 Ga0207664_100459003 363
12 3300048929 Ga0496126_0002190 Ga0496126_0002190_1461_2762 364
13 3300049581 Ga0501047_0022562 Ga0501047_0022562_4411_5715 366
14 3300005336 Ga0070680_100054663 Ga0070680_1000546633 367
15 3300005535 Ga0070684_100207084 Ga0070684_1002070841 367
16 3300005539 Ga0068853_100007112 Ga0068853_1000071125 367
17 3300005577 Ga0068857_100069231 Ga0068857_1000692312 367
18 3300009545 Ga0105237_10007636 Ga0105237_100076366 367
19 3300009551 Ga0105238_10190357 Ga0105238_101903572 367
20 3300025919 Ga0207657_10036957 Ga0207657_100369573 367
21 3300025921 Ga0207652_10045116 Ga0207652_100451162 367
22 3300025944 Ga0207661_10004917 Ga0207661_100049175 367
23 3300026116 Ga0207674_10001720 Ga0207674_1000172011 367
24 3300048913 Ga0496110_0006872 Ga0496110_0006872_7764_9023 367
25 3300002067 JGI24735J21928_10022232 JGI24735J21928_100222321 370
26 3300025905 Ga0207685_10008794 Ga0207685_100087943 370
27 3300035172 Ga0373955_0084500 Ga0373955_0084500_244_1548 371
28 3300046683 Ga0495658_0052068 Ga0495658_0052068_329_1564 371
29 3300010159 Ga0099796_10001434 Ga0099796_100014345 373
30 3300048905 Ga0496102_0037108 Ga0496102_0037108_2447_3718 373
31 3300048906 Ga0496103_0026996 Ga0496103_0026996_351_1622 373
32 3300048919 Ga0496116_0012258 Ga0496116_0012258_2473_3744 373
33 3300048920 Ga0496117_0000035 Ga0496117_0000035_174169_175440 373
34 3300048921 Ga0496118_0000054 Ga0496118_0000054_47621_48892 373
35 3300048927 Ga0496124_0068475 Ga0496124_0068475_414_1685 373
36 3300048929 Ga0496126_0142967 Ga0496126_0142967_372_1643 373
37 3300005719 Ga0068861_100235114 Ga0068861_1002351142 374
38 3300013306 Ga0163162_10047749 Ga0163162_100477493 374
39 3300047320 Ga0495672_0006880 Ga0495672_0006880_3090_4337 374
40 3300048922 Ga0496119_0004560 Ga0496119_0004560_10653_11924 374
41 3300048923 Ga0496120_0029038 Ga0496120_0029038_1818_3089 374
42 3300048928 Ga0496125_0003275 Ga0496125_0003275_7201_8472 374
43 3300005335 Ga0070666_10088323 Ga0070666_100883231 375
44 3300005367 Ga0070667_100010667 Ga0070667_1000106674 375
45 3300005617 Ga0068859_100028325 Ga0068859_1000283255 375
46 3300005841 Ga0068863_100091497 Ga0068863_1000914973 375
47 3300005842 Ga0068858_100010601 Ga0068858_1000106015 375
48 3300005843 Ga0068860_100159947 Ga0068860_1001599472 375
49 3300006931 Ga0097620_100028327 Ga0097620_1000283275 375
50 3300009101 Ga0105247_10011606 Ga0105247_100116063 375
51 3300014968 Ga0157379_10015521 Ga0157379_100155214 375
52 3300025900 Ga0207710_10001989 Ga0207710_100019894 375
53 3300025941 Ga0207711_10084114 Ga0207711_100841142 375
54 3300025986 Ga0207658_10008131 Ga0207658_100081316 375
55 3300026035 Ga0207703_10001419 Ga0207703_100014193 375
56 3300026118 Ga0207675_100235427 Ga0207675_1002354272 375
57 3300028381 Ga0268264_10038199 Ga0268264_100381993 375
58 3300048915 Ga0496112_0027529 Ga0496112_0027529_2011_3381 375
59 3300048924 Ga0496121_0002192 Ga0496121_0002192_18414_19769 375
60 3300048928 Ga0496125_0007617 Ga0496125_0007617_3413_4783 375
61 3300009093 Ga0105240_10126147 Ga0105240_101261472 378
62 3300013297 Ga0157378_10137602 Ga0157378_101376022 378
63 3300028380 Ga0268265_10191590 Ga0268265_101915901 378
64 3300014969 Ga0157376_10041904 Ga0157376_100419042 379
65 3300006028 Ga0070717_10011129 Ga0070717_100111294 380
66 3300009098 Ga0105245_10025834 Ga0105245_100258342 380
67 3300013296 Ga0157374_10000328 Ga0157374_100003286 380
68 3300013296 Ga0157374_10024009 Ga0157374_100240092 380
69 3300013306 Ga0163162_10018926 Ga0163162_100189262 380
70 3300013308 Ga0157375_10000473 Ga0157375_100004735 380
71 3300014325 Ga0163163_10036805 Ga0163163_100368055 380
72 3300014968 Ga0157379_10155892 Ga0157379_101558922 380
73 3300048915 Ga0496112_0002955 Ga0496112_0002955_11814_13070 380
74 3300048906 Ga0496103_0049590 Ga0496103_0049590_1237_2538 381
75 3300049568 Ga0501031_0080548 Ga0501031_0080548_627_1913 381
76 3300049569 Ga0501032_0012457 Ga0501032_0012457_3204_4490 381
77 3300049570 Ga0501033_0023462 Ga0501033_0023462_935_2221 381
78 3300049572 Ga0501036_0002489 Ga0501036_0002489_613_1899 381
79 3300049579 Ga0501043_0008177 Ga0501043_0008177_3014_4300 381
80 3300049580 Ga0501046_0000389 Ga0501046_0000389_10583_11869 381
81 3300049581 Ga0501047_0010899 Ga0501047_0010899_4314_5600 381
82 3300049582 Ga0501048_0167497 Ga0501048_0167497_180_1466 381
83 3300049589 Ga0501073_0001170 Ga0501073_0001170_11483_12769 381
84 3300049742 Ga0501080_0018597 Ga0501080_0018597_1149_2435 381
85 3300049822 Ga0501035_0000357 Ga0501035_0000357_49324_50610 381
86 iso_pu_bacteria 2884215851 2884216513 381
87 3300005328 Ga0070676_10000032 Ga0070676_1000003215 382
88 3300035086 Ga0373934_0004876 Ga0373934_0004876_332_1639 382
89 3300035118 Ga0373954_0004799 Ga0373954_0004799_3748_5055 382
90 3300035119 Ga0373956_0003824 Ga0373956_0003824_1111_2418 382
91 3300035172 Ga0373955_0002557 Ga0373955_0002557_4137_5444 382
92 3300035724 Ga0373933_0005505 Ga0373933_0005505_4229_5536 382
93 3300036401 Ga0373937_0001572 Ga0373937_0001572_4892_6199 382
94 3300046536 Ga0495587_0003145 Ga0495587_0003145_8275_9582 382
95 3300046559 Ga0495667_0049162 Ga0495667_0049162_1369_2676 382
96 3300047317 Ga0495604_0009835 Ga0495604_0009835_4077_5384 382
97 3300047471 Ga0495684_0017031 Ga0495684_0017031_2106_3413 382
98 3300047472 Ga0495686_0121990 Ga0495686_0121990_93_1364 382
99 3300048088 Ga0495602_0009777 Ga0495602_0009777_2159_3466 382
100 3300005365 Ga0070688_100171673 Ga0070688_1001716731 383
101 3300013307 Ga0157372_10045279 Ga0157372_100452793 383
102 3300025915 Ga0207693_10036261 Ga0207693_100362612 383
103 3300025916 Ga0207663_10056805 Ga0207663_100568052 383
104 3300026089 Ga0207648_10010314 Ga0207648_100103142 383
105 3300035725 Ga0373947_0059422 Ga0373947_0059422_777_2039 383
106 3300037471 Ga0395905_0071834 Ga0395905_0071834_61_1353 383
107 3300006175 Ga0070712_100194477 Ga0070712_1001944772 384
108 3300001989 JGI24739J22299_10012831 JGI24739J22299_100128313 385
109 3300005434 Ga0070709_10000332 Ga0070709_1000033214 385
110 3300005436 Ga0070713_100000862 Ga0070713_1000008624 385
111 3300006163 Ga0070715_10001751 Ga0070715_100017514 385
112 3300006173 Ga0070716_100003139 Ga0070716_1000031398 385
113 3300006175 Ga0070712_100000228 Ga0070712_10000022814 385
114 3300006237 Ga0097621_100125477 Ga0097621_1001254771 385
115 3300014969 Ga0157376_10005457 Ga0157376_100054574 385
116 3300025906 Ga0207699_10001156 Ga0207699_1000115611 385
117 3300025915 Ga0207693_10000108 Ga0207693_1000010812 385
118 3300025928 Ga0207700_10000557 Ga0207700_1000055717 385
119 3300025939 Ga0207665_10013845 Ga0207665_100138453 385
120 3300031548 Ga0307408_100022318 Ga0307408_1000223182 385
121 3300031901 Ga0307406_10002607 Ga0307406_100026075 385
122 3300005535 Ga0070684_100065818 Ga0070684_1000658183 386
123 3300006163 Ga0070715_10014899 Ga0070715_100148992 386
124 3300006175 Ga0070712_100013696 Ga0070712_1000136961 386
125 3300014325 Ga0163163_10028547 Ga0163163_100285474 386
126 3300028017 Ga0265356_1000090 Ga0265356_10000904 386
127 3300005445 Ga0070708_100018361 Ga0070708_1000183615 387
128 3300046660 Ga0495625_0133539 Ga0495625_0133539_16_1320 387
129 3300005334 Ga0068869_100006303 Ga0068869_1000063032 388
130 3300005364 Ga0070673_100179820 Ga0070673_1001798202 388
131 3300005617 Ga0068859_100026033 Ga0068859_1000260334 388
132 3300005842 Ga0068858_100003398 Ga0068858_10000339812 388
133 3300005983 Ga0081540_1051312 Ga0081540_10513121 388
134 3300006931 Ga0097620_100026033 Ga0097620_1000260334 388
135 3300009093 Ga0105240_10030350 Ga0105240_100303504 388
136 3300009093 Ga0105240_10053116 Ga0105240_100531163 388
137 3300013307 Ga0157372_10008184 Ga0157372_100081846 388
138 3300013307 Ga0157372_10012075 Ga0157372_100120752 388
139 3300013307 Ga0157372_10279378 Ga0157372_102793782 388
140 3300013308 Ga0157375_10241801 Ga0157375_102418011 388
141 3300013308 Ga0157375_10247691 Ga0157375_102476912 388
142 3300014969 Ga0157376_10017240 Ga0157376_100172403 388
143 3300025904 Ga0207647_10002386 Ga0207647_100023867 388
144 3300025913 Ga0207695_10004159 Ga0207695_1000415911 388
145 3300025913 Ga0207695_10080379 Ga0207695_100803792 388
146 3300025929 Ga0207664_10100611 Ga0207664_101006112 388
147 3300025960 Ga0207651_10171031 Ga0207651_101710312 388
148 3300026035 Ga0207703_10015339 Ga0207703_100153394 388
149 3300026089 Ga0207648_10094646 Ga0207648_100946462 388
150 3300028381 Ga0268264_10011297 Ga0268264_100112975 388
151 3300047472 Ga0495686_0001979 Ga0495686_0001979_10468_11865 388
152 3300050512 nmdc:mga0n895_94768_c1 nmdc:mga0n895_94768_c1_1434_2735 388
153 3300005548 Ga0070665_100079777 Ga0070665_1000797773 389
154 3300006028 Ga0070717_10024655 Ga0070717_100246552 389
155 3300007265 Ga0099794_10045617 Ga0099794_100456172 389
156 3300009177 Ga0105248_10006022 Ga0105248_1000602210 389
157 3300014969 Ga0157376_10121490 Ga0157376_101214902 389
158 3300025941 Ga0207711_10007157 Ga0207711_100071577 389
159 3300035695 Ga0373927_0046938 Ga0373927_0046938_659_1987 389
160 3300035725 Ga0373947_0009236 Ga0373947_0009236_2644_3972 389
161 3300037068 Ga0373925_0031280 Ga0373925_0031280_2436_3764 389
162 3300045976 Ga0466967_0366053 Ga0466967_0366053_57_1370 389
163 3300046472 Ga0495580_0000977 Ga0495580_0000977_12466_13794 389
164 3300046524 Ga0495648_0075339 Ga0495648_0075339_564_1859 389
165 3300046683 Ga0495658_0017562 Ga0495658_0017562_1473_2801 389
166 3300047472 Ga0495686_0014262 Ga0495686_0014262_1411_2727 389
167 3300048929 Ga0496126_0003894 Ga0496126_0003894_12824_14101 389
168 3300053093 Ga0500651_0000002 Ga0500651_0000002_90451_91746 389
169 3300005344 Ga0070661_100045028 Ga0070661_1000450282 390
170 3300005434 Ga0070709_10025913 Ga0070709_100259132 390
171 3300005434 Ga0070709_10123640 Ga0070709_101236402 390
172 3300005439 Ga0070711_100040686 Ga0070711_1000406862 390
173 3300005545 Ga0070695_100015508 Ga0070695_1000155082 390
174 3300006173 Ga0070716_100000248 Ga0070716_10000024811 390
175 3300006173 Ga0070716_100118399 Ga0070716_1001183992 390
176 3300006175 Ga0070712_100004509 Ga0070712_1000045096 390
177 3300006237 Ga0097621_100037822 Ga0097621_1000378221 390
178 3300006914 Ga0075436_100005552 Ga0075436_1000055522 390
179 3300007265 Ga0099794_10016059 Ga0099794_100160593 390
180 3300007265 Ga0099794_10072029 Ga0099794_100720291 390
181 3300009174 Ga0105241_10020237 Ga0105241_100202374 390
182 3300014968 Ga0157379_10001487 Ga0157379_100014874 390
183 3300014969 Ga0157376_10000030 Ga0157376_1000003057 390
184 3300014969 Ga0157376_10209363 Ga0157376_102093632 390
185 3300025906 Ga0207699_10017626 Ga0207699_100176263 390
186 3300025906 Ga0207699_10053975 Ga0207699_100539752 390
187 3300025915 Ga0207693_10008067 Ga0207693_100080677 390
188 3300025920 Ga0207649_10026267 Ga0207649_100262672 390
189 3300025939 Ga0207665_10001867 Ga0207665_100018673 390
190 3300025939 Ga0207665_10024560 Ga0207665_100245602 390
191 3300028800 Ga0265338_10002594 Ga0265338_100025946 390
192 3300035695 Ga0373927_0101268 Ga0373927_0101268_203_1501 390
193 3300046472 Ga0495580_0001342 Ga0495580_0001342_16322_17620 390
194 3300046526 Ga0495666_0085278 Ga0495666_0085278_180_1478 390
195 3300048903 Ga0496100_0130548 Ga0496100_0130548_411_1736 390
196 3300048905 Ga0496102_0005199 Ga0496102_0005199_7714_9039 390
197 3300048909 Ga0496106_0018696 Ga0496106_0018696_1412_2737 390
198 3300048910 Ga0496107_0145937 Ga0496107_0145937_367_1692 390
199 3300048918 Ga0496115_0019838 Ga0496115_0019838_132_1445 390
200 3300049568 Ga0501031_0032167 Ga0501031_0032167_300_1595 390
201 3300049569 Ga0501032_0003816 Ga0501032_0003816_7357_8652 390
202 3300049570 Ga0501033_0000675 Ga0501033_0000675_20338_21633 390
203 3300049572 Ga0501036_0002489 Ga0501036_0002489_12541_13836 390
204 3300049573 Ga0501037_0001892 Ga0501037_0001892_8865_10160 390
205 3300049574 Ga0501038_0005942 Ga0501038_0005942_503_1798 390
206 3300049575 Ga0501039_0135014 Ga0501039_0135014_264_1559 390
207 3300049579 Ga0501043_0001924 Ga0501043_0001924_6580_7875 390
208 3300049580 Ga0501046_0000389 Ga0501046_0000389_22511_23806 390
209 3300049581 Ga0501047_0005145 Ga0501047_0005145_6485_7780 390
210 3300049742 Ga0501080_0011888 Ga0501080_0011888_4424_5719 390
211 3300049822 Ga0501035_0000357 Ga0501035_0000357_37387_38682 390
212 3300049823 Ga0501044_0001820 Ga0501044_0001820_12144_13439 390
213 3300050514 nmdc:mga08x19_3625_c1 nmdc:mga08x19_3625_c1_4674_5960 390
214 3300005436 Ga0070713_100000856 Ga0070713_10000085616 391
215 3300005439 Ga0070711_100000078 Ga0070711_10000007812 391
216 3300005439 Ga0070711_100003687 Ga0070711_1000036872 391
217 3300005445 Ga0070708_100040569 Ga0070708_1000405693 391
218 3300005445 Ga0070708_100084736 Ga0070708_1000847362 391
219 3300006028 Ga0070717_10005939 Ga0070717_100059392 391
220 3300006173 Ga0070716_100010359 Ga0070716_1000103594 391
221 3300006175 Ga0070712_100029340 Ga0070712_1000293403 391
222 3300007265 Ga0099794_10001317 Ga0099794_100013173 391
223 3300007265 Ga0099794_10003137 Ga0099794_100031375 391
224 3300007265 Ga0099794_10043344 Ga0099794_100433442 391
225 3300013307 Ga0157372_10378576 Ga0157372_103785761 391
226 3300025915 Ga0207693_10000012 Ga0207693_1000001286 391
227 3300025915 Ga0207693_10000808 Ga0207693_1000080813 391
228 3300025916 Ga0207663_10000658 Ga0207663_100006586 391
229 3300025916 Ga0207663_10100612 Ga0207663_101006122 391
230 3300025922 Ga0207646_10140975 Ga0207646_101409752 391
231 3300025928 Ga0207700_10003390 Ga0207700_100033908 391
232 3300025939 Ga0207665_10009817 Ga0207665_100098173 391
233 3300027671 Ga0209588_1031740 Ga0209588_10317401 391
234 3300031090 Ga0265760_10012146 Ga0265760_100121462 391
235 3300042157 Ga0439458_0001728 Ga0439458_0001728_3884_5200 391
236 3300044684 Ga0466966_0095398 Ga0466966_0095398_51_1361 391
237 3300046543 Ga0495645_0017672 Ga0495645_0017672_1171_2463 391
238 3300046678 Ga0495599_0120230 Ga0495599_0120230_129_1421 391
239 3300047319 Ga0495674_0122012 Ga0495674_0122012_136_1428 391
240 3300048907 Ga0496104_0061189 Ga0496104_0061189_298_1626 391
241 3300048918 Ga0496115_0057398 Ga0496115_0057398_227_1555 391
242 3300053077 Ga0495601_0040880 Ga0495601_0040880_181_1473 391
243 3300005439 Ga0070711_100025160 Ga0070711_1000251602 392
244 3300005546 Ga0070696_100018704 Ga0070696_1000187042 392
245 3300005618 Ga0068864_100137439 Ga0068864_1001374392 392
246 3300009148 Ga0105243_10057351 Ga0105243_100573511 392
247 3300014968 Ga0157379_10198328 Ga0157379_101983281 392
248 3300025911 Ga0207654_10040824 Ga0207654_100408241 392
249 3300025935 Ga0207709_10030734 Ga0207709_100307341 392
250 3300048909 Ga0496106_0148752 Ga0496106_0148752_427_1749 392
251 3300013307 Ga0157372_10048077 Ga0157372_100480776 393
252 3300025928 Ga0207700_10074551 Ga0207700_100745512 393
253 3300046472 Ga0495580_0058756 Ga0495580_0058756_1000_2301 393
254 3300046475 Ga0495639_0006196 Ga0495639_0006196_2116_3417 393
255 3300046499 Ga0495594_0013707 Ga0495594_0013707_1181_2482 393
256 3300046517 Ga0495630_0099051 Ga0495630_0099051_118_1419 393
257 3300046535 Ga0495586_0063057 Ga0495586_0063057_358_1659 393
258 3300047319 Ga0495674_0059967 Ga0495674_0059967_13_1383 393
259 3300005335 Ga0070666_10082575 Ga0070666_100825752 394
260 3300005338 Ga0068868_100006628 Ga0068868_1000066288 394
261 3300005339 Ga0070660_100167806 Ga0070660_1001678062 394
262 3300005344 Ga0070661_100037985 Ga0070661_1000379852 394
263 3300005366 Ga0070659_100043959 Ga0070659_1000439592 394
264 3300005445 Ga0070708_100002764 Ga0070708_1000027643 394
265 3300005457 Ga0070662_100010648 Ga0070662_1000106485 394
266 3300005459 Ga0068867_100014513 Ga0068867_1000145132 394
267 3300005535 Ga0070684_100080732 Ga0070684_1000807322 394
268 3300005539 Ga0068853_100097095 Ga0068853_1000970952 394
269 3300005544 Ga0070686_100079820 Ga0070686_1000798202 394
270 3300005547 Ga0070693_100079106 Ga0070693_1000791061 394
271 3300005564 Ga0070664_100029921 Ga0070664_1000299213 394
272 3300005577 Ga0068857_100106138 Ga0068857_1001061382 394
273 3300005617 Ga0068859_100018197 Ga0068859_1000181971 394
274 3300005718 Ga0068866_10056708 Ga0068866_100567082 394
275 3300005719 Ga0068861_100103348 Ga0068861_1001033482 394
276 3300005834 Ga0068851_10037445 Ga0068851_100374451 394
277 3300005841 Ga0068863_100254449 Ga0068863_1002544491 394
278 3300005843 Ga0068860_100317503 Ga0068860_1003175031 394
279 3300005844 Ga0068862_100006015 Ga0068862_1000060158 394
280 3300006358 Ga0068871_100011411 Ga0068871_1000114111 394
281 3300006881 Ga0068865_100026715 Ga0068865_1000267153 394
282 3300006914 Ga0075436_100000061 Ga0075436_10000006128 394
283 3300006931 Ga0097620_100018197 Ga0097620_1000181976 394
284 3300009093 Ga0105240_10063080 Ga0105240_100630802 394
285 3300009098 Ga0105245_10209221 Ga0105245_102092212 394
286 3300009101 Ga0105247_10015309 Ga0105247_100153093 394
287 3300009176 Ga0105242_10243731 Ga0105242_102437311 394
288 3300009545 Ga0105237_10180357 Ga0105237_101803572 394
289 3300013105 Ga0157369_10110106 Ga0157369_101101062 394
290 3300013308 Ga0157375_10156123 Ga0157375_101561232 394
291 3300014325 Ga0163163_10006586 Ga0163163_100065866 394
292 3300014969 Ga0157376_10147964 Ga0157376_101479642 394
293 3300021361 Ga0213872_10000987 Ga0213872_100009879 394
294 3300022730 Ga0224570_100502 Ga0224570_1005022 394
295 3300024227 Ga0228598_1000569 Ga0228598_10005694 394
296 3300025321 Ga0207656_10004521 Ga0207656_100045213 394
297 3300025907 Ga0207645_10015856 Ga0207645_100158565 394
298 3300025913 Ga0207695_10009276 Ga0207695_1000927610 394
299 3300025914 Ga0207671_10014577 Ga0207671_100145775 394
300 3300025915 Ga0207693_10002543 Ga0207693_100025439 394
301 3300025919 Ga0207657_10001200 Ga0207657_100012009 394
302 3300025924 Ga0207694_10071741 Ga0207694_100717412 394
303 3300025927 Ga0207687_10005999 Ga0207687_100059995 394
304 3300025933 Ga0207706_10000973 Ga0207706_1000097323 394
305 3300025934 Ga0207686_10044630 Ga0207686_100446301 394
306 3300025941 Ga0207711_10037692 Ga0207711_100376923 394
307 3300025944 Ga0207661_10025580 Ga0207661_100255803 394
308 3300025949 Ga0207667_10007140 Ga0207667_100071405 394
309 3300025972 Ga0207668_10039904 Ga0207668_100399042 394
310 3300025986 Ga0207658_10188035 Ga0207658_101880351 394
311 3300026067 Ga0207678_10006566 Ga0207678_1000656610 394
312 3300026089 Ga0207648_10005869 Ga0207648_100058695 394
313 3300026095 Ga0207676_10055926 Ga0207676_100559262 394
314 3300026116 Ga0207674_10161746 Ga0207674_101617462 394
315 3300026118 Ga0207675_100005271 Ga0207675_10000527110 394
316 3300026121 Ga0207683_10025739 Ga0207683_100257392 394
317 3300030760 Ga0265762_1001979 Ga0265762_10019791 394
318 3300035242 Ga0373962_0031054 Ga0373962_0031054_25_1344 394
319 3300035692 Ga0373935_0029615 Ga0373935_0029615_334_1692 394
320 3300036401 Ga0373937_0036195 Ga0373937_0036195_2873_4231 394
321 3300037068 Ga0373925_0183932 Ga0373925_0183932_44_1402 394
322 3300039453 Ga0436362_1166207 Ga0436362_1166207_552_1862 394
323 3300045976 Ga0466967_0170461 Ga0466967_0170461_580_1890 394
324 3300046679 Ga0495623_0014435 Ga0495623_0014435_2605_3924 394
325 3300048088 Ga0495602_0008779 Ga0495602_0008779_7328_8647 394
326 3300048905 Ga0496102_0266058 Ga0496102_0266058_55_1374 394
327 3300048911 Ga0496108_0165952 Ga0496108_0165952_24_1361 394
328 3300048912 Ga0496109_0148107 Ga0496109_0148107_749_2068 394
329 3300048915 Ga0496112_0019330 Ga0496112_0019330_101_1420 394
330 3300050514 nmdc:mga08x19_1500_c1 nmdc:mga08x19_1500_c1_10016_11347 394
331 iso_pu_bacteria 2884215851 2884216522 394
332 3300005434 Ga0070709_10028200 Ga0070709_100282004 395
333 3300006028 Ga0070717_10001170 Ga0070717_100011703 395
334 3300006175 Ga0070712_100035497 Ga0070712_1000354972 395
335 3300013105 Ga0157369_10045453 Ga0157369_100454532 395
336 3300014325 Ga0163163_10027381 Ga0163163_100273813 395
337 3300025904 Ga0207647_10002001 Ga0207647_100020017 395
338 3300025929 Ga0207664_10016198 Ga0207664_100161982 395
339 3300026067 Ga0207678_10078351 Ga0207678_100783512 395
340 3300046684 Ga0495669_0077845 Ga0495669_0077845_105_1487 395
341 3300049573 Ga0501037_0019663 Ga0501037_0019663_639_1955 395
342 3300049580 Ga0501046_0116100 Ga0501046_0116100_681_1997 395
343 3300049581 Ga0501047_0008295 Ga0501047_0008295_1437_2753 395
344 3300049586 Ga0501070_0064572 Ga0501070_0064572_417_1733 395
345 3300049823 Ga0501044_0074996 Ga0501044_0074996_989_2305 395
346 3300035119 Ga0373956_0052590 Ga0373956_0052590_421_1794 396
347 3300049573 Ga0501037_0138852 Ga0501037_0138852_151_1530 396
348 3300049744 Ga0501083_0088236 Ga0501083_0088236_276_1610 396
349 3300009545 Ga0105237_10071837 Ga0105237_100718372 397
350 3300013105 Ga0157369_10063571 Ga0157369_100635712 397
351 3300013307 Ga0157372_10068248 Ga0157372_100682482 397
352 3300022732 Ga0224569_100686 Ga0224569_1006862 397
353 3300024225 Ga0224572_1015504 Ga0224572_10155042 397
354 3300024227 Ga0228598_1004969 Ga0228598_10049692 397
355 3300025914 Ga0207671_10095971 Ga0207671_100959712 397
356 3300046472 Ga0495580_0002203 Ga0495580_0002203_13647_14972 397
357 3300046473 Ga0495582_0000037 Ga0495582_0000037_27340_28665 397
358 3300046683 Ga0495658_0045540 Ga0495658_0045540_153_1478 397
359 3300047320 Ga0495672_0006641 Ga0495672_0006641_7409_8740 397
360 3300005344 Ga0070661_100005290 Ga0070661_1000052907 398
361 3300005445 Ga0070708_100007053 Ga0070708_1000070536 398
362 3300005457 Ga0070662_100029007 Ga0070662_1000290073 398
363 3300005536 Ga0070697_100002429 Ga0070697_10000242910 398
364 3300005578 Ga0068854_100003468 Ga0068854_1000034685 398
365 3300009174 Ga0105241_10203189 Ga0105241_102031892 398
366 3300009545 Ga0105237_10043608 Ga0105237_100436082 398
367 3300013100 Ga0157373_10019722 Ga0157373_100197223 398
368 3300014968 Ga0157379_10017280 Ga0157379_100172801 398
369 3300015262 Ga0182007_10017570 Ga0182007_100175701 398
370 3300015265 Ga0182005_1009312 Ga0182005_10093122 398
371 3300025914 Ga0207671_10062329 Ga0207671_100623292 398
372 3300025933 Ga0207706_10019059 Ga0207706_100190595 398
373 3300039453 Ga0436362_0802604 Ga0436362_0802604_1937_3259 398
374 3300005518 Ga0070699_100052341 Ga0070699_1000523412 399
375 3300006871 Ga0075434_100114649 Ga0075434_1001146491 399
376 3300031344 Ga0265316_10006270 Ga0265316_100062706 399
377 3300031711 Ga0265314_10001967 Ga0265314_1000196716 399
378 3300005468 Ga0070707_100012154 Ga0070707_1000121543 400
379 3300005471 Ga0070698_100002364 Ga0070698_10000236410 400
380 3300006173 Ga0070716_100137883 Ga0070716_1001378831 400
381 3300025922 Ga0207646_10006398 Ga0207646_100063985 400
382 3300025922 Ga0207646_10024132 Ga0207646_100241325 400
383 3300025939 Ga0207665_10038127 Ga0207665_100381272 400
384 3300046516 Ga0495628_0080946 Ga0495628_0080946_708_2024 400
385 3300053085 Ga0495619_0051410 Ga0495619_0051410_744_2060 400
386 3300014325 Ga0163163_10181911 Ga0163163_101819112 401
387 3300005841 Ga0068863_100021909 Ga0068863_1000219092 402
388 3300005843 Ga0068860_100100622 Ga0068860_1001006222 402
389 3300006028 Ga0070717_10035030 Ga0070717_100350302 402
390 3300006237 Ga0097621_100007030 Ga0097621_1000070302 402
391 3300006358 Ga0068871_100056511 Ga0068871_1000565113 402
392 3300006871 Ga0075434_100017278 Ga0075434_1000172785 402
393 3300009177 Ga0105248_10094313 Ga0105248_100943132 402
394 3300013297 Ga0157378_10088940 Ga0157378_100889402 402
395 3300013308 Ga0157375_10077221 Ga0157375_100772212 402
396 3300026088 Ga0207641_10005807 Ga0207641_100058075 402
397 3300028381 Ga0268264_10116198 Ga0268264_101161982 402
398 3300035691 Ga0373931_0037872 Ga0373931_0037872_146_1513 402
399 3300037068 Ga0373925_0166934 Ga0373925_0166934_113_1450 402
400 3300048907 Ga0496104_0175754 Ga0496104_0175754_376_1713 402
401 3300048910 Ga0496107_0027564 Ga0496107_0027564_1076_2413 402
402 3300048915 Ga0496112_0024307 Ga0496112_0024307_254_1591 402
403 3300005335 Ga0070666_10046981 Ga0070666_100469812 403
404 3300005355 Ga0070671_100011409 Ga0070671_1000114095 403
405 3300005435 Ga0070714_100000065 Ga0070714_10000006543 403
406 3300005439 Ga0070711_100000993 Ga0070711_1000009936 403
407 3300005563 Ga0068855_100194999 Ga0068855_1001949992 403
408 3300005577 Ga0068857_100069815 Ga0068857_1000698152 403
409 3300005614 Ga0068856_100051526 Ga0068856_1000515263 403
410 3300005618 Ga0068864_100062993 Ga0068864_1000629933 403
411 3300009093 Ga0105240_10093743 Ga0105240_100937432 403
412 3300010375 Ga0105239_10027187 Ga0105239_100271875 403
413 3300013296 Ga0157374_10005486 Ga0157374_100054868 403
414 3300013296 Ga0157374_10131936 Ga0157374_101319362 403
415 3300013306 Ga0163162_10001977 Ga0163162_1000197712 403
416 3300013307 Ga0157372_10011320 Ga0157372_100113207 403
417 3300014325 Ga0163163_10074330 Ga0163163_100743304 403
418 3300025909 Ga0207705_10077343 Ga0207705_100773432 403
419 3300025916 Ga0207663_10005366 Ga0207663_100053664 403
420 3300025919 Ga0207657_10000099 Ga0207657_1000009917 403
421 3300025929 Ga0207664_10002011 Ga0207664_100020116 403
422 3300026041 Ga0207639_10068417 Ga0207639_100684173 403
423 3300028016 Ga0265354_1000006 Ga0265354_100000615 403
424 3300033547 Ga0316212_1003812 Ga0316212_10038122 403
425 3300035111 Ga0373923_0038857 Ga0373923_0038857_177_1577 403
426 3300035118 Ga0373954_0017165 Ga0373954_0017165_1803_3203 403
427 3300035172 Ga0373955_0047227 Ga0373955_0047227_556_1956 403
428 3300035724 Ga0373933_0033811 Ga0373933_0033811_1094_2494 403
429 3300036401 Ga0373937_0077007 Ga0373937_0077007_1474_2874 403
430 3300048905 Ga0496102_0045087 Ga0496102_0045087_1529_2902 403
431 3300048911 Ga0496108_0151033 Ga0496108_0151033_468_1841 403
432 3300048912 Ga0496109_0015768 Ga0496109_0015768_4705_6078 403
433 3300048915 Ga0496112_0024519 Ga0496112_0024519_628_2001 403
434 3300005536 Ga0070697_100076607 Ga0070697_1000766073 404
435 3300005616 Ga0068852_100069038 Ga0068852_1000690382 404
436 3300035083 Ga0373926_0013128 Ga0373926_0013128_240_1634 405
437 3300035089 Ga0373944_0034418 Ga0373944_0034418_19_1413 405
438 3300035116 Ga0373945_0017731 Ga0373945_0017731_545_1939 405
439 3300035170 Ga0373943_0006600 Ga0373943_0006600_3143_4537 405
440 3300035692 Ga0373935_0001385 Ga0373935_0001385_8148_9542 405
441 3300035695 Ga0373927_0000454 Ga0373927_0000454_21214_22608 405
442 3300035725 Ga0373947_0019011 Ga0373947_0019011_1396_2790 405
443 3300037068 Ga0373925_0000782 Ga0373925_0000782_5254_6648 405
444 3300047319 Ga0495674_0018016 Ga0495674_0018016_4786_6180 405
445 3300005467 Ga0070706_100003558 Ga0070706_1000035582 407
446 3300005536 Ga0070697_100000588 Ga0070697_1000005884 407
447 3300025910 Ga0207684_10029317 Ga0207684_100293172 407
448 3300046472 Ga0495580_0001272 Ga0495580_0001272_263_1624 407
449 3300046499 Ga0495594_0072481 Ga0495594_0072481_510_1871 407
450 3300005445 Ga0070708_100015038 Ga0070708_1000150381 408
451 3300005536 Ga0070697_100216337 Ga0070697_1002163371 408
452 3300009545 Ga0105237_10114967 Ga0105237_101149671 408
453 3300005434 Ga0070709_10067817 Ga0070709_100678172 410
454 3300005439 Ga0070711_100000147 Ga0070711_10000014724 410
455 3300006173 Ga0070716_100029718 Ga0070716_1000297181 410
456 3300006175 Ga0070712_100010578 Ga0070712_1000105784 410
457 3300025906 Ga0207699_10064331 Ga0207699_100643312 410
458 3300025915 Ga0207693_10000622 Ga0207693_1000062224 410
459 3300025916 Ga0207663_10018252 Ga0207663_100182522 410
460 3300025939 Ga0207665_10004299 Ga0207665_100042992 410
461 3300025939 Ga0207665_10047290 Ga0207665_100472903 410
462 2162886012 MBSR1b_contig_1349230 MBSR1b_0905.00004200 424
463 3300002459 JGI24751J29686_10002143 JGI24751J29686_100021432 424
464 3300005328 Ga0070676_10007530 Ga0070676_100075304 424
465 3300005329 Ga0070683_100052169 Ga0070683_1000521692 424
466 3300005330 Ga0070690_100011035 Ga0070690_1000110354 424
467 3300005331 Ga0070670_100024963 Ga0070670_1000249632 424
468 3300005334 Ga0068869_100033514 Ga0068869_1000335143 424
469 3300005337 Ga0070682_100009656 Ga0070682_1000096564 424
470 3300005338 Ga0068868_100003343 Ga0068868_1000033432 424
471 3300005339 Ga0070660_100002962 Ga0070660_10000296211 424
472 3300005340 Ga0070689_100018311 Ga0070689_1000183114 424
473 3300005344 Ga0070661_100010092 Ga0070661_1000100922 424
474 3300005347 Ga0070668_100024596 Ga0070668_1000245962 424
475 3300005354 Ga0070675_100009782 Ga0070675_1000097822 424
476 3300005355 Ga0070671_100037185 Ga0070671_1000371852 424
477 3300005356 Ga0070674_100040965 Ga0070674_1000409653 424
478 3300005364 Ga0070673_100034314 Ga0070673_1000343142 424
479 3300005365 Ga0070688_100001836 Ga0070688_1000018367 424
480 3300005366 Ga0070659_100011244 Ga0070659_1000112444 424
481 3300005455 Ga0070663_100020212 Ga0070663_1000202123 424
482 3300005456 Ga0070678_100118948 Ga0070678_1001189482 424
483 3300005457 Ga0070662_100021721 Ga0070662_1000217213 424
484 3300005459 Ga0068867_100006702 Ga0068867_1000067027 424
485 3300005466 Ga0070685_10001249 Ga0070685_100012493 424
486 3300005535 Ga0070684_100001539 Ga0070684_10000153914 424
487 3300005539 Ga0068853_100007078 Ga0068853_1000070783 424
488 3300005543 Ga0070672_100020496 Ga0070672_1000204962 424
489 3300005544 Ga0070686_100005627 Ga0070686_1000056276 424
490 3300005563 Ga0068855_100026524 Ga0068855_1000265244 424
491 3300005564 Ga0070664_100028916 Ga0070664_1000289164 424
492 3300005577 Ga0068857_100000800 Ga0068857_10000080012 424
493 3300005615 Ga0070702_100020911 Ga0070702_1000209113 424
494 3300005617 Ga0068859_100063424 Ga0068859_1000634243 424
495 3300005718 Ga0068866_10008235 Ga0068866_100082353 424
496 3300005834 Ga0068851_10003518 Ga0068851_100035182 424
497 3300005840 Ga0068870_10001324 Ga0068870_100013247 424
498 3300005843 Ga0068860_100089343 Ga0068860_1000893431 424
499 3300006881 Ga0068865_100004978 Ga0068865_1000049786 424
500 3300006931 Ga0097620_100063422 Ga0097620_1000634223 424
501 3300009092 Ga0105250_10028418 Ga0105250_100284182 424
502 3300009098 Ga0105245_10079965 Ga0105245_100799652 424
503 3300009101 Ga0105247_10026787 Ga0105247_100267873 424
504 3300009174 Ga0105241_10003060 Ga0105241_1000306010 424
505 3300009176 Ga0105242_10040558 Ga0105242_100405583 424
506 3300009553 Ga0105249_10051734 Ga0105249_100517343 424
507 3300011119 Ga0105246_10000585 Ga0105246_100005854 424
508 3300013100 Ga0157373_10020397 Ga0157373_100203972 424
509 3300013102 Ga0157371_10013614 Ga0157371_100136142 424
510 3300013105 Ga0157369_10060300 Ga0157369_100603002 424
511 3300013307 Ga0157372_10039068 Ga0157372_100390683 424
512 3300013308 Ga0157375_10049829 Ga0157375_100498293 424
513 3300014325 Ga0163163_10008924 Ga0163163_100089242 424
514 3300014326 Ga0157380_10049777 Ga0157380_100497772 424
515 3300014745 Ga0157377_10001704 Ga0157377_100017044 424
516 3300014968 Ga0157379_10007611 Ga0157379_100076113 424
517 3300014969 Ga0157376_10008453 Ga0157376_100084532 424
518 3300017792 Ga0163161_10007365 Ga0163161_100073653 424
519 3300025315 Ga0207697_10025715 Ga0207697_100257152 424
520 3300025321 Ga0207656_10014357 Ga0207656_100143572 424
521 3300025901 Ga0207688_10014005 Ga0207688_100140053 424
522 3300025903 Ga0207680_10022506 Ga0207680_100225063 424
523 3300025904 Ga0207647_10000730 Ga0207647_1000073017 424
524 3300025907 Ga0207645_10001142 Ga0207645_1000114211 424
525 3300025908 Ga0207643_10000478 Ga0207643_1000047810 424
526 3300025919 Ga0207657_10000898 Ga0207657_1000089821 424
527 3300025920 Ga0207649_10007529 Ga0207649_100075294 424
528 3300025925 Ga0207650_10000053 Ga0207650_10000053123 424
529 3300025931 Ga0207644_10004065 Ga0207644_100040653 424
530 3300025932 Ga0207690_10076253 Ga0207690_100762532 424
531 3300025940 Ga0207691_10003378 Ga0207691_100033788 424
532 3300025942 Ga0207689_10007355 Ga0207689_100073553 424
533 3300025944 Ga0207661_10000435 Ga0207661_1000043512 424
534 3300025945 Ga0207679_10000140 Ga0207679_100001409 424
535 3300025961 Ga0207712_10028640 Ga0207712_100286402 424
536 3300025981 Ga0207640_10075066 Ga0207640_100750661 424
537 3300026041 Ga0207639_10033851 Ga0207639_100338512 424
538 3300026088 Ga0207641_10000321 Ga0207641_1000032122 424
539 3300026089 Ga0207648_10000314 Ga0207648_1000031415 424
540 3300026095 Ga0207676_10004705 Ga0207676_100047054 424
541 3300026116 Ga0207674_10000092 Ga0207674_1000009217 424
542 3300026118 Ga0207675_100017704 Ga0207675_1000177042 424
543 3300026121 Ga0207683_10007677 Ga0207683_100076778 424
544 3300028380 Ga0268265_10002752 Ga0268265_1000275212 424
545 3300028381 Ga0268264_10035224 Ga0268264_100352242 424
546 3300048903 Ga0496100_0100597 Ga0496100_0100597_521_1900 424
547 3300048909 Ga0496106_0046511 Ga0496106_0046511_522_1901 424
548 3300048911 Ga0496108_0007454 Ga0496108_0007454_6083_7462 424
549 3300048915 Ga0496112_0000146 Ga0496112_0000146_15203_16582 424
550 3300048916 Ga0496113_0049688 Ga0496113_0049688_1390_2769 424
551 3300048918 Ga0496115_0028763 Ga0496115_0028763_93_1472 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

29

400

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t3n-assembly1.cif.gz_A r184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2) 0.8467 7 398
6e9o-assembly1.cif.gz_B e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.8299 5 384
6e9o-assembly2.cif.gz_A e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.8207 5 384
6e9o-assembly2.cif.gz_A e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.7933 5 384
7t3n-assembly1.cif.gz_A r184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2) 0.7856 7 398
ID Description Score Start End Superfamily
af_Q2FVB9_1_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9719 1 204 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9665 5 205 1.20.1250.20
af_P0AA78_1_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9632 7 206 1.20.1250.20
af_Q2FVB9_1_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9576 1 204 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9569 5 205 1.20.1250.20
ID Description Score Start End GO Terms
AF-F5S8P2-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9063 6 192 GO:0005886
GO:0046943
AF-A0A662YSL9-F1-model_v4 Synaptic vesicular amine transporter 0.9059 46 185 GO:0005335
GO:0015842
GO:0030672
GO:0042910
GO:0043195
AF-H1UZ85-F1-model_v4 MFS transporter 0.9003 13 225 GO:0016020
GO:0022857
AF-A0A6B2LKJ1-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8978 25 196 GO:0005886
GO:0022857
AF-A0A842YDF2-F1-model_v4 MFS transporter 0.8781 9 193 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
71.33 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map