F462575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 551 | 268 | 546 | 427 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10067817|Ga0070709_100678172 |
| Length | 465 |
| Sequence | MPTDRLSGPGSAITGSGPSHVRWFLIFWLFILSAVAFLDRVNISIAGSSIASEYHLTNVELGWVFSSFLAGYALFQTLGGRLADRFGPRRILAGGAVWWGVFTALTAAIPHGIQGALLLFVSIRFLFGAGEAVIYPASNQFVSRWIPSEERGIANGLIFAGVGAGAGLSPPLITFIMLHYGWRASFWVCALIGFVVGLVWFIGARDTPAEHSLVSPSEMETIRSGLSASVDASKGARAQNLIPWKTVCKSKEVLAVTISYFSFGYVAWIFFSWFYTYLAQVRGLNLKASAFYAMLPFLAMAVCCAVGGMVSDRLTRSHGPRVGRCYLAAIVIALAAVFLVFGAEVHSARLASVVLAGGAGALYLAQSSFWSVTADLAGASSGSVSGFMNMGAQAGGWFTAWLTPLIASHFGWTASFLVAAGLCLMGAAAWLFVDPNRTLEATPAPAGVQMTPSTLISSASVSENY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 110 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 111 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 112 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 167 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 178 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 179 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 198 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 237 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 238 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 239 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 240 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 241 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 242 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 243 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 244 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 245 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 246 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 247 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.27 |
| Metatranscriptomes | 0.36 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.18 |
| Nodule | 0 |
| Rhizoplane | 5.99 |
| Rhizosphere | 90.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_1349230 | 2162886012 | Bacteria | 4404 |
| 2 | JGI24739J22299_10012831 | 3300001989 | Bacteria | 3069 |
| 3 | JGI24735J21928_10022232 | 3300002067 | Bacteria | 1933 |
| 4 | JGI24751J29686_10002143 | 3300002459 | Bacteria | 4005 |
| 5 | Ga0070676_10000032 | 3300005328 | Bacteria | 41977 |
| 6 | Ga0070676_10007530 | 3300005328 | Bacteria | 5847 |
| 7 | Ga0070683_100052169 | 3300005329 | Bacteria | 3788 |
| 8 | Ga0070690_100011035 | 3300005330 | Bacteria | 5276 |
| 9 | Ga0070670_100024963 | 3300005331 | Bacteria | 5142 |
| 10 | Ga0068869_100006303 | 3300005334 | Bacteria | 7511 |
| 11 | Ga0068869_100033514 | 3300005334 | Bacteria | 3626 |
| 12 | Ga0070666_10046981 | 3300005335 | Bacteria | 2897 |
| 13 | Ga0070666_10082575 | 3300005335 | Bacteria | 2197 |
| 14 | Ga0070666_10088323 | 3300005335 | Bacteria | 2127 |
| 15 | Ga0070680_100054663 | 3300005336 | Bacteria | 3261 |
| 16 | Ga0070682_100009656 | 3300005337 | Bacteria | 5461 |
| 17 | Ga0068868_100003343 | 3300005338 | Bacteria | 11162 |
| 18 | Ga0068868_100006628 | 3300005338 | Bacteria | 8212 |
| 19 | Ga0070660_100002962 | 3300005339 | Bacteria | 11680 |
| 20 | Ga0070660_100167806 | 3300005339 | Bacteria | 1771 |
| 21 | Ga0070689_100018311 | 3300005340 | Bacteria | 5157 |
| 22 | Ga0070661_100005290 | 3300005344 | Bacteria | 8893 |
| 23 | Ga0070661_100010092 | 3300005344 | Bacteria | 6558 |
| 24 | Ga0070661_100037985 | 3300005344 | Bacteria | 3504 |
| 25 | Ga0070661_100045028 | 3300005344 | Bacteria | 3225 |
| 26 | Ga0070668_100024596 | 3300005347 | Bacteria | 4563 |
| 27 | Ga0070675_100009782 | 3300005354 | Bacteria | 7469 |
| 28 | Ga0070671_100011409 | 3300005355 | Bacteria | 7145 |
| 29 | Ga0070671_100037185 | 3300005355 | Bacteria | 4037 |
| 30 | Ga0070674_100040965 | 3300005356 | Bacteria | 3136 |
| 31 | Ga0070673_100034314 | 3300005364 | Bacteria | 3838 |
| 32 | Ga0070673_100179820 | 3300005364 | Unclassified | 1810 |
| 33 | Ga0070688_100001836 | 3300005365 | Bacteria | 10667 |
| 34 | Ga0070688_100171673 | 3300005365 | Bacteria | 1497 |
| 35 | Ga0070659_100011244 | 3300005366 | Bacteria | 6612 |
| 36 | Ga0070659_100043959 | 3300005366 | Unclassified | 3495 |
| 37 | Ga0070667_100010667 | 3300005367 | Bacteria | 7590 |
| 38 | Ga0070709_10000332 | 3300005434 | Bacteria | 29688 |
| 39 | Ga0070709_10025913 | 3300005434 | Bacteria | 3469 |
| 40 | Ga0070709_10028200 | 3300005434 | Bacteria | 3347 |
| 41 | Ga0070709_10067817 | 3300005434 | Bacteria | 2292 |
| 42 | Ga0070709_10123640 | 3300005434 | Unclassified | 1758 |
| 43 | Ga0070714_100000065 | 3300005435 | Bacteria | 96459 |
| 44 | Ga0070714_100141836 | 3300005435 | Bacteria | 2158 |
| 45 | Ga0070713_100000856 | 3300005436 | Bacteria | 19501 |
| 46 | Ga0070713_100000862 | 3300005436 | Bacteria | 19416 |
| 47 | Ga0070711_100000078 | 3300005439 | Bacteria | 54188 |
| 48 | Ga0070711_100000147 | 3300005439 | Bacteria | 37937 |
| 49 | Ga0070711_100000993 | 3300005439 | Bacteria | 15033 |
| 50 | Ga0070711_100003687 | 3300005439 | Bacteria | 8968 |
| 51 | Ga0070711_100025160 | 3300005439 | Unclassified | 3891 |
| 52 | Ga0070711_100040686 | 3300005439 | Unclassified | 3136 |
| 53 | Ga0070708_100002764 | 3300005445 | Bacteria | 13627 |
| 54 | Ga0070708_100007053 | 3300005445 | Bacteria | 8966 |
| 55 | Ga0070708_100015038 | 3300005445 | Bacteria | 6383 |
| 56 | Ga0070708_100018361 | 3300005445 | Bacteria | 5854 |
| 57 | Ga0070708_100040569 | 3300005445 | Bacteria | 4077 |
| 58 | Ga0070708_100084736 | 3300005445 | Bacteria | 2875 |
| 59 | Ga0070663_100020212 | 3300005455 | Bacteria | 4405 |
| 60 | Ga0070678_100118948 | 3300005456 | Bacteria | 2080 |
| 61 | Ga0070662_100010648 | 3300005457 | Bacteria | 6047 |
| 62 | Ga0070662_100021721 | 3300005457 | Bacteria | 4386 |
| 63 | Ga0070662_100029007 | 3300005457 | Bacteria | 3858 |
| 64 | Ga0068867_100006702 | 3300005459 | Bacteria | 8142 |
| 65 | Ga0068867_100014513 | 3300005459 | Bacteria | 5584 |
| 66 | Ga0070685_10001249 | 3300005466 | Bacteria | 13488 |
| 67 | Ga0070706_100003558 | 3300005467 | Bacteria | 15324 |
| 68 | Ga0070707_100012154 | 3300005468 | Bacteria | 8037 |
| 69 | Ga0070698_100002364 | 3300005471 | Bacteria | 20808 |
| 70 | Ga0070699_100052341 | 3300005518 | Unclassified | 3534 |
| 71 | Ga0070684_100001539 | 3300005535 | Bacteria | 16657 |
| 72 | Ga0070684_100065818 | 3300005535 | Bacteria | 3182 |
| 73 | Ga0070684_100080732 | 3300005535 | Bacteria | 2877 |
| 74 | Ga0070684_100207084 | 3300005535 | Bacteria | 1787 |
| 75 | Ga0070697_100000588 | 3300005536 | Bacteria | 27480 |
| 76 | Ga0070697_100002429 | 3300005536 | Bacteria | 14331 |
| 77 | Ga0070697_100076607 | 3300005536 | Bacteria | 2750 |
| 78 | Ga0070697_100216337 | 3300005536 | Bacteria | 1632 |
| 79 | Ga0068853_100007078 | 3300005539 | Bacteria | 8972 |
| 80 | Ga0068853_100007112 | 3300005539 | Bacteria | 8956 |
| 81 | Ga0068853_100097095 | 3300005539 | Bacteria | 2600 |
| 82 | Ga0070672_100020496 | 3300005543 | Bacteria | 4823 |
| 83 | Ga0070686_100005627 | 3300005544 | Bacteria | 6943 |
| 84 | Ga0070686_100079820 | 3300005544 | Bacteria | 2164 |
| 85 | Ga0070695_100015508 | 3300005545 | Bacteria | 4602 |
| 86 | Ga0070696_100018704 | 3300005546 | Bacteria | 4686 |
| 87 | Ga0070693_100079106 | 3300005547 | Bacteria | 1955 |
| 88 | Ga0070665_100079777 | 3300005548 | Bacteria | 3279 |
| 89 | Ga0068855_100026524 | 3300005563 | Bacteria | 6931 |
| 90 | Ga0068855_100194999 | 3300005563 | Bacteria | 2282 |
| 91 | Ga0070664_100028916 | 3300005564 | Bacteria | 4616 |
| 92 | Ga0070664_100029921 | 3300005564 | Unclassified | 4540 |
| 93 | Ga0068857_100000800 | 3300005577 | Bacteria | 23516 |
| 94 | Ga0068857_100069231 | 3300005577 | Bacteria | 3142 |
| 95 | Ga0068857_100069815 | 3300005577 | Bacteria | 3129 |
| 96 | Ga0068857_100106138 | 3300005577 | Bacteria | 2522 |
| 97 | Ga0068854_100003468 | 3300005578 | Bacteria | 9845 |
| 98 | Ga0068856_100051526 | 3300005614 | Bacteria | 4058 |
| 99 | Ga0070702_100020911 | 3300005615 | Bacteria | 3436 |
| 100 | Ga0068852_100069038 | 3300005616 | Bacteria | 3096 |
| 101 | Ga0068859_100018197 | 3300005617 | Bacteria | 7062 |
| 102 | Ga0068859_100026033 | 3300005617 | Bacteria | 5869 |
| 103 | Ga0068859_100028325 | 3300005617 | Bacteria | 5615 |
| 104 | Ga0068859_100063424 | 3300005617 | Bacteria | 3726 |
| 105 | Ga0068864_100062993 | 3300005618 | Bacteria | 3214 |
| 106 | Ga0068864_100137439 | 3300005618 | Bacteria | 2202 |
| 107 | Ga0068866_10008235 | 3300005718 | Bacteria | 4385 |
| 108 | Ga0068866_10056708 | 3300005718 | Unclassified | 2015 |
| 109 | Ga0068861_100103348 | 3300005719 | Bacteria | 2270 |
| 110 | Ga0068861_100235114 | 3300005719 | Bacteria | 1556 |
| 111 | Ga0068851_10003518 | 3300005834 | Bacteria | 6967 |
| 112 | Ga0068851_10037445 | 3300005834 | Unclassified | 2432 |
| 113 | Ga0068870_10001324 | 3300005840 | Bacteria | 9966 |
| 114 | Ga0068863_100021909 | 3300005841 | Bacteria | 6097 |
| 115 | Ga0068863_100091497 | 3300005841 | Bacteria | 2885 |
| 116 | Ga0068863_100254449 | 3300005841 | Unclassified | 1697 |
| 117 | Ga0068858_100003398 | 3300005842 | Bacteria | 15829 |
| 118 | Ga0068858_100010601 | 3300005842 | Bacteria | 8724 |
| 119 | Ga0068860_100089343 | 3300005843 | Bacteria | 2933 |
| 120 | Ga0068860_100100622 | 3300005843 | Bacteria | 2758 |
| 121 | Ga0068860_100159947 | 3300005843 | Bacteria | 2171 |
| 122 | Ga0068860_100317503 | 3300005843 | Bacteria | 1529 |
| 123 | Ga0068862_100006015 | 3300005844 | Bacteria | 10108 |
| 124 | Ga0081540_1051312 | 3300005983 | Unclassified | 2041 |
| 125 | Ga0070717_10001170 | 3300006028 | Bacteria | 17721 |
| 126 | Ga0070717_10005939 | 3300006028 | Bacteria | 8940 |
| 127 | Ga0070717_10011129 | 3300006028 | Bacteria | 6818 |
| 128 | Ga0070717_10024655 | 3300006028 | Bacteria | 4779 |
| 129 | Ga0070717_10035030 | 3300006028 | Bacteria | 4061 |
| 130 | Ga0070715_10001751 | 3300006163 | Bacteria | 6457 |
| 131 | Ga0070715_10014899 | 3300006163 | Bacteria | 2890 |
| 132 | Ga0070716_100000248 | 3300006173 | Bacteria | 21595 |
| 133 | Ga0070716_100003139 | 3300006173 | Bacteria | 7725 |
| 134 | Ga0070716_100010359 | 3300006173 | Bacteria | 4671 |
| 135 | Ga0070716_100029718 | 3300006173 | Bacteria | 2957 |
| 136 | Ga0070716_100118399 | 3300006173 | Unclassified | 1654 |
| 137 | Ga0070716_100137883 | 3300006173 | Unclassified | 1551 |
| 138 | Ga0070712_100000228 | 3300006175 | Bacteria | 31570 |
| 139 | Ga0070712_100004509 | 3300006175 | Bacteria | 8598 |
| 140 | Ga0070712_100010578 | 3300006175 | Bacteria | 5825 |
| 141 | Ga0070712_100013696 | 3300006175 | Bacteria | 5188 |
| 142 | Ga0070712_100029340 | 3300006175 | Bacteria | 3686 |
| 143 | Ga0070712_100035497 | 3300006175 | Bacteria | 3384 |
| 144 | Ga0070712_100194477 | 3300006175 | Unclassified | 1589 |
| 145 | Ga0097621_100007030 | 3300006237 | Bacteria | 8016 |
| 146 | Ga0097621_100037822 | 3300006237 | Bacteria | 3870 |
| 147 | Ga0097621_100125477 | 3300006237 | Bacteria | 2180 |
| 148 | Ga0068871_100011411 | 3300006358 | Bacteria | 6516 |
| 149 | Ga0068871_100056511 | 3300006358 | Bacteria | 3190 |
| 150 | Ga0075434_100017278 | 3300006871 | Bacteria | 6948 |
| 151 | Ga0075434_100114649 | 3300006871 | Bacteria | 2708 |
| 152 | Ga0068865_100004978 | 3300006881 | Bacteria | 8033 |
| 153 | Ga0068865_100026715 | 3300006881 | Bacteria | 3807 |
| 154 | Ga0075436_100000061 | 3300006914 | Bacteria | 64633 |
| 155 | Ga0075436_100005552 | 3300006914 | Bacteria | 8668 |
| 156 | Ga0097620_100018197 | 3300006931 | Bacteria | 7062 |
| 157 | Ga0097620_100026033 | 3300006931 | Bacteria | 5869 |
| 158 | Ga0097620_100028327 | 3300006931 | Bacteria | 5615 |
| 159 | Ga0097620_100063422 | 3300006931 | Bacteria | 3726 |
| 160 | Ga0099794_10001317 | 3300007265 | Bacteria | 8632 |
| 161 | Ga0099794_10003137 | 3300007265 | Bacteria | 6260 |
| 162 | Ga0099794_10016059 | 3300007265 | Unclassified | 3314 |
| 163 | Ga0099794_10043344 | 3300007265 | Unclassified | 2147 |
| 164 | Ga0099794_10045617 | 3300007265 | Bacteria | 2098 |
| 165 | Ga0099794_10072029 | 3300007265 | Bacteria | 1694 |
| 166 | Ga0105250_10028418 | 3300009092 | Bacteria | 2252 |
| 167 | Ga0105240_10030350 | 3300009093 | Bacteria | 7026 |
| 168 | Ga0105240_10053116 | 3300009093 | Bacteria | 5089 |
| 169 | Ga0105240_10063080 | 3300009093 | Unclassified | 4611 |
| 170 | Ga0105240_10093743 | 3300009093 | Bacteria | 3664 |
| 171 | Ga0105240_10126147 | 3300009093 | Unclassified | 3075 |
| 172 | Ga0105245_10025834 | 3300009098 | Bacteria | 5165 |
| 173 | Ga0105245_10079965 | 3300009098 | Bacteria | 2986 |
| 174 | Ga0105245_10209221 | 3300009098 | Bacteria | 1877 |
| 175 | Ga0105247_10011606 | 3300009101 | Bacteria | 5307 |
| 176 | Ga0105247_10015309 | 3300009101 | Unclassified | 4596 |
| 177 | Ga0105247_10026787 | 3300009101 | Bacteria | 3484 |
| 178 | Ga0105243_10057351 | 3300009148 | Bacteria | 3100 |
| 179 | Ga0105241_10003060 | 3300009174 | Bacteria | 12472 |
| 180 | Ga0105241_10020237 | 3300009174 | Bacteria | 4915 |
| 181 | Ga0105241_10203189 | 3300009174 | Bacteria | 1656 |
| 182 | Ga0105242_10040558 | 3300009176 | Bacteria | 3752 |
| 183 | Ga0105242_10243731 | 3300009176 | Bacteria | 1617 |
| 184 | Ga0105248_10006022 | 3300009177 | Bacteria | 13314 |
| 185 | Ga0105248_10094313 | 3300009177 | Bacteria | 3370 |
| 186 | Ga0105237_10007636 | 3300009545 | Bacteria | 11816 |
| 187 | Ga0105237_10043608 | 3300009545 | Bacteria | 4518 |
| 188 | Ga0105237_10071837 | 3300009545 | Unclassified | 3454 |
| 189 | Ga0105237_10114967 | 3300009545 | Bacteria | 2684 |
| 190 | Ga0105237_10180357 | 3300009545 | Unclassified | 2112 |
| 191 | Ga0105238_10190357 | 3300009551 | Bacteria | 2028 |
| 192 | Ga0105249_10051734 | 3300009553 | Bacteria | 3748 |
| 193 | Ga0099796_10001434 | 3300010159 | Plasmid | 4795 |
| 194 | Ga0105239_10027187 | 3300010375 | Bacteria | 6298 |
| 195 | Ga0105246_10000585 | 3300011119 | Bacteria | 20210 |
| 196 | Ga0157373_10019722 | 3300013100 | Bacteria | 4905 |
| 197 | Ga0157373_10020397 | 3300013100 | Bacteria | 4818 |
| 198 | Ga0157371_10013614 | 3300013102 | Bacteria | 6173 |
| 199 | Ga0157369_10045453 | 3300013105 | Unclassified | 4776 |
| 200 | Ga0157369_10060300 | 3300013105 | Bacteria | 4091 |
| 201 | Ga0157369_10063571 | 3300013105 | Bacteria | 3976 |
| 202 | Ga0157369_10110106 | 3300013105 | Bacteria | 2928 |
| 203 | Ga0157374_10000328 | 3300013296 | Bacteria | 43754 |
| 204 | Ga0157374_10005486 | 3300013296 | Bacteria | 10651 |
| 205 | Ga0157374_10024009 | 3300013296 | Bacteria | 5460 |
| 206 | Ga0157374_10131936 | 3300013296 | Bacteria | 2418 |
| 207 | Ga0157378_10088940 | 3300013297 | Bacteria | 2804 |
| 208 | Ga0157378_10137602 | 3300013297 | Bacteria | 2265 |
| 209 | Ga0163162_10001977 | 3300013306 | Bacteria | 19243 |
| 210 | Ga0163162_10018926 | 3300013306 | Bacteria | 6752 |
| 211 | Ga0163162_10047749 | 3300013306 | Bacteria | 4289 |
| 212 | Ga0157372_10008184 | 3300013307 | Bacteria | 11115 |
| 213 | Ga0157372_10011320 | 3300013307 | Bacteria | 9486 |
| 214 | Ga0157372_10012075 | 3300013307 | Bacteria | 9200 |
| 215 | Ga0157372_10039068 | 3300013307 | Bacteria | 5238 |
| 216 | Ga0157372_10045279 | 3300013307 | Bacteria | 4880 |
| 217 | Ga0157372_10048077 | 3300013307 | Bacteria | 4742 |
| 218 | Ga0157372_10068248 | 3300013307 | Unclassified | 3997 |
| 219 | Ga0157372_10279378 | 3300013307 | Bacteria | 1941 |
| 220 | Ga0157372_10378576 | 3300013307 | Bacteria | 1649 |
| 221 | Ga0157375_10000473 | 3300013308 | Bacteria | 36686 |
| 222 | Ga0157375_10049829 | 3300013308 | Bacteria | 4105 |
| 223 | Ga0157375_10077221 | 3300013308 | Bacteria | 3359 |
| 224 | Ga0157375_10156123 | 3300013308 | Bacteria | 2421 |
| 225 | Ga0157375_10241801 | 3300013308 | Bacteria | 1965 |
| 226 | Ga0157375_10247691 | 3300013308 | Bacteria | 1942 |
| 227 | Ga0163163_10006586 | 3300014325 | Bacteria | 10172 |
| 228 | Ga0163163_10008924 | 3300014325 | Bacteria | 8930 |
| 229 | Ga0163163_10027381 | 3300014325 | Bacteria | 5460 |
| 230 | Ga0163163_10028547 | 3300014325 | Bacteria | 5360 |
| 231 | Ga0163163_10036805 | 3300014325 | Bacteria | 4756 |
| 232 | Ga0163163_10074330 | 3300014325 | Bacteria | 3390 |
| 233 | Ga0163163_10181911 | 3300014325 | Bacteria | 2149 |
| 234 | Ga0157380_10049777 | 3300014326 | Bacteria | 3306 |
| 235 | Ga0157377_10001704 | 3300014745 | Bacteria | 9592 |
| 236 | Ga0157379_10001487 | 3300014968 | Bacteria | 19295 |
| 237 | Ga0157379_10007611 | 3300014968 | Bacteria | 9378 |
| 238 | Ga0157379_10015521 | 3300014968 | Bacteria | 6684 |
| 239 | Ga0157379_10017280 | 3300014968 | Bacteria | 6355 |
| 240 | Ga0157379_10155892 | 3300014968 | Unclassified | 2060 |
| 241 | Ga0157379_10198328 | 3300014968 | Bacteria | 1815 |
| 242 | Ga0157376_10000030 | 3300014969 | Bacteria | 181885 |
| 243 | Ga0157376_10005457 | 3300014969 | Bacteria | 8888 |
| 244 | Ga0157376_10008453 | 3300014969 | Bacteria | 7431 |
| 245 | Ga0157376_10017240 | 3300014969 | Bacteria | 5502 |
| 246 | Ga0157376_10041904 | 3300014969 | Bacteria | 3751 |
| 247 | Ga0157376_10121490 | 3300014969 | Unclassified | 2316 |
| 248 | Ga0157376_10147964 | 3300014969 | Unclassified | 2115 |
| 249 | Ga0157376_10209363 | 3300014969 | Bacteria | 1799 |
| 250 | Ga0182007_10017570 | 3300015262 | Bacteria | 2609 |
| 251 | Ga0182005_1009312 | 3300015265 | Bacteria | 2860 |
| 252 | Ga0163161_10007365 | 3300017792 | Bacteria | 7597 |
| 253 | Ga0213872_10000987 | 3300021361 | Bacteria | 19905 |
| 254 | Ga0224570_100502 | 3300022730 | Unclassified | 3077 |
| 255 | Ga0224569_100686 | 3300022732 | Bacteria | 2881 |
| 256 | Ga0224572_1015504 | 3300024225 | Unclassified | 1460 |
| 257 | Ga0228598_1000569 | 3300024227 | Bacteria | 7729 |
| 258 | Ga0228598_1004969 | 3300024227 | Bacteria | 2797 |
| 259 | Ga0207697_10025715 | 3300025315 | Bacteria | 2406 |
| 260 | Ga0207656_10004521 | 3300025321 | Bacteria | 4865 |
| 261 | Ga0207656_10014357 | 3300025321 | Bacteria | 3049 |
| 262 | Ga0207710_10001989 | 3300025900 | Bacteria | 9751 |
| 263 | Ga0207688_10014005 | 3300025901 | Bacteria | 4361 |
| 264 | Ga0207680_10022506 | 3300025903 | Bacteria | 3429 |
| 265 | Ga0207647_10000730 | 3300025904 | Bacteria | 25805 |
| 266 | Ga0207647_10002001 | 3300025904 | Bacteria | 15592 |
| 267 | Ga0207647_10002386 | 3300025904 | Bacteria | 14259 |
| 268 | Ga0207685_10008794 | 3300025905 | Unclassified | 2898 |
| 269 | Ga0207699_10001156 | 3300025906 | Bacteria | 12472 |
| 270 | Ga0207699_10017626 | 3300025906 | Bacteria | 3765 |
| 271 | Ga0207699_10053975 | 3300025906 | Unclassified | 2385 |
| 272 | Ga0207699_10064331 | 3300025906 | Bacteria | 2219 |
| 273 | Ga0207645_10001142 | 3300025907 | Bacteria | 21910 |
| 274 | Ga0207645_10015856 | 3300025907 | Bacteria | 4993 |
| 275 | Ga0207643_10000478 | 3300025908 | Bacteria | 25853 |
| 276 | Ga0207705_10077343 | 3300025909 | Bacteria | 2420 |
| 277 | Ga0207684_10029317 | 3300025910 | Unclassified | 4688 |
| 278 | Ga0207654_10040824 | 3300025911 | Unclassified | 2617 |
| 279 | Ga0207695_10004159 | 3300025913 | Bacteria | 19871 |
| 280 | Ga0207695_10009276 | 3300025913 | Bacteria | 12187 |
| 281 | Ga0207695_10080379 | 3300025913 | Unclassified | 3301 |
| 282 | Ga0207671_10014577 | 3300025914 | Bacteria | 6201 |
| 283 | Ga0207671_10062329 | 3300025914 | Bacteria | 2769 |
| 284 | Ga0207671_10095971 | 3300025914 | Unclassified | 2240 |
| 285 | Ga0207693_10000012 | 3300025915 | Bacteria | 154708 |
| 286 | Ga0207693_10000108 | 3300025915 | Bacteria | 75296 |
| 287 | Ga0207693_10000622 | 3300025915 | Bacteria | 31701 |
| 288 | Ga0207693_10000808 | 3300025915 | Bacteria | 28014 |
| 289 | Ga0207693_10002543 | 3300025915 | Bacteria | 15859 |
| 290 | Ga0207693_10008067 | 3300025915 | Bacteria | 8634 |
| 291 | Ga0207693_10036261 | 3300025915 | Bacteria | 3887 |
| 292 | Ga0207663_10000658 | 3300025916 | Bacteria | 15321 |
| 293 | Ga0207663_10005366 | 3300025916 | Bacteria | 6447 |
| 294 | Ga0207663_10018252 | 3300025916 | Bacteria | 3928 |
| 295 | Ga0207663_10056805 | 3300025916 | Unclassified | 2464 |
| 296 | Ga0207663_10100612 | 3300025916 | Bacteria | 1940 |
| 297 | Ga0207657_10000099 | 3300025919 | Bacteria | 83148 |
| 298 | Ga0207657_10000898 | 3300025919 | Bacteria | 31448 |
| 299 | Ga0207657_10001200 | 3300025919 | Bacteria | 27561 |
| 300 | Ga0207657_10036957 | 3300025919 | Bacteria | 4367 |
| 301 | Ga0207649_10007529 | 3300025920 | Bacteria | 5919 |
| 302 | Ga0207649_10026267 | 3300025920 | Bacteria | 3405 |
| 303 | Ga0207652_10045116 | 3300025921 | Bacteria | 3757 |
| 304 | Ga0207646_10006398 | 3300025922 | Bacteria | 12180 |
| 305 | Ga0207646_10024132 | 3300025922 | Bacteria | 5574 |
| 306 | Ga0207646_10140975 | 3300025922 | Bacteria | 2171 |
| 307 | Ga0207694_10071741 | 3300025924 | Bacteria | 2706 |
| 308 | Ga0207650_10000053 | 3300025925 | Bacteria | 164599 |
| 309 | Ga0207687_10005999 | 3300025927 | Bacteria | 8041 |
| 310 | Ga0207700_10000557 | 3300025928 | Bacteria | 21915 |
| 311 | Ga0207700_10003390 | 3300025928 | Bacteria | 9254 |
| 312 | Ga0207700_10074551 | 3300025928 | Bacteria | 2625 |
| 313 | Ga0207664_10002011 | 3300025929 | Bacteria | 13396 |
| 314 | Ga0207664_10016198 | 3300025929 | Bacteria | 5431 |
| 315 | Ga0207664_10045900 | 3300025929 | Unclassified | 3428 |
| 316 | Ga0207664_10100611 | 3300025929 | Bacteria | 2387 |
| 317 | Ga0207644_10004065 | 3300025931 | Bacteria | 9486 |
| 318 | Ga0207690_10076253 | 3300025932 | Bacteria | 2327 |
| 319 | Ga0207706_10000973 | 3300025933 | Bacteria | 29233 |
| 320 | Ga0207706_10019059 | 3300025933 | Bacteria | 6172 |
| 321 | Ga0207686_10044630 | 3300025934 | Unclassified | 2723 |
| 322 | Ga0207709_10030734 | 3300025935 | Bacteria | 3127 |
| 323 | Ga0207665_10001867 | 3300025939 | Bacteria | 14204 |
| 324 | Ga0207665_10004299 | 3300025939 | Bacteria | 9463 |
| 325 | Ga0207665_10009817 | 3300025939 | Bacteria | 6285 |
| 326 | Ga0207665_10013845 | 3300025939 | Bacteria | 5305 |
| 327 | Ga0207665_10024560 | 3300025939 | Unclassified | 3974 |
| 328 | Ga0207665_10038127 | 3300025939 | Bacteria | 3199 |
| 329 | Ga0207665_10047290 | 3300025939 | Bacteria | 2884 |
| 330 | Ga0207691_10003378 | 3300025940 | Bacteria | 15536 |
| 331 | Ga0207711_10007157 | 3300025941 | Bacteria | 9351 |
| 332 | Ga0207711_10037692 | 3300025941 | Bacteria | 4108 |
| 333 | Ga0207711_10084114 | 3300025941 | Bacteria | 2785 |
| 334 | Ga0207689_10007355 | 3300025942 | Bacteria | 9657 |
| 335 | Ga0207661_10000435 | 3300025944 | Bacteria | 26948 |
| 336 | Ga0207661_10004917 | 3300025944 | Bacteria | 9368 |
| 337 | Ga0207661_10025580 | 3300025944 | Bacteria | 4489 |
| 338 | Ga0207679_10000140 | 3300025945 | Bacteria | 59718 |
| 339 | Ga0207667_10007140 | 3300025949 | Bacteria | 13484 |
| 340 | Ga0207651_10171031 | 3300025960 | Bacteria | 1714 |
| 341 | Ga0207712_10028640 | 3300025961 | Bacteria | 3728 |
| 342 | Ga0207668_10039904 | 3300025972 | Unclassified | 3164 |
| 343 | Ga0207640_10075066 | 3300025981 | Bacteria | 2290 |
| 344 | Ga0207658_10008131 | 3300025986 | Bacteria | 7144 |
| 345 | Ga0207658_10188035 | 3300025986 | Bacteria | 1714 |
| 346 | Ga0207703_10001419 | 3300026035 | Bacteria | 21845 |
| 347 | Ga0207703_10015339 | 3300026035 | Bacteria | 5976 |
| 348 | Ga0207639_10033851 | 3300026041 | Bacteria | 3773 |
| 349 | Ga0207639_10068417 | 3300026041 | Bacteria | 2767 |
| 350 | Ga0207678_10006566 | 3300026067 | Bacteria | 10312 |
| 351 | Ga0207678_10078351 | 3300026067 | Unclassified | 2830 |
| 352 | Ga0207641_10000321 | 3300026088 | Bacteria | 58896 |
| 353 | Ga0207641_10005807 | 3300026088 | Bacteria | 10472 |
| 354 | Ga0207648_10000314 | 3300026089 | Bacteria | 53108 |
| 355 | Ga0207648_10005869 | 3300026089 | Bacteria | 12283 |
| 356 | Ga0207648_10010314 | 3300026089 | Bacteria | 8868 |
| 357 | Ga0207648_10094646 | 3300026089 | Unclassified | 2612 |
| 358 | Ga0207676_10004705 | 3300026095 | Bacteria | 9667 |
| 359 | Ga0207676_10055926 | 3300026095 | Bacteria | 3100 |
| 360 | Ga0207674_10000092 | 3300026116 | Bacteria | 99761 |
| 361 | Ga0207674_10001720 | 3300026116 | Bacteria | 27998 |
| 362 | Ga0207674_10161746 | 3300026116 | Bacteria | 2193 |
| 363 | Ga0207675_100005271 | 3300026118 | Bacteria | 12438 |
| 364 | Ga0207675_100017704 | 3300026118 | Bacteria | 6647 |
| 365 | Ga0207675_100235427 | 3300026118 | Bacteria | 1768 |
| 366 | Ga0207683_10007677 | 3300026121 | Bacteria | 9234 |
| 367 | Ga0207683_10025739 | 3300026121 | Bacteria | 5075 |
| 368 | Ga0209588_1031740 | 3300027671 | Unclassified | 1691 |
| 369 | Ga0265354_1000006 | 3300028016 | Bacteria | 32449 |
| 370 | Ga0265356_1000090 | 3300028017 | Bacteria | 15313 |
| 371 | Ga0268265_10002752 | 3300028380 | Bacteria | 12981 |
| 372 | Ga0268265_10191590 | 3300028380 | Bacteria | 1766 |
| 373 | Ga0268264_10011297 | 3300028381 | Bacteria | 7376 |
| 374 | Ga0268264_10035224 | 3300028381 | Bacteria | 4120 |
| 375 | Ga0268264_10038199 | 3300028381 | Bacteria | 3961 |
| 376 | Ga0268264_10116198 | 3300028381 | Bacteria | 2351 |
| 377 | Ga0265338_10002594 | 3300028800 | Bacteria | 26721 |
| 378 | Ga0265762_1001979 | 3300030760 | Bacteria | 3723 |
| 379 | Ga0265760_10012146 | 3300031090 | Bacteria | 2460 |
| 380 | Ga0265316_10006270 | 3300031344 | Bacteria | 11399 |
| 381 | Ga0307408_100022318 | 3300031548 | Unclassified | 4299 |
| 382 | Ga0265314_10001967 | 3300031711 | Bacteria | 21850 |
| 383 | Ga0307406_10002607 | 3300031901 | Bacteria | 9829 |
| 384 | Ga0316212_1003812 | 3300033547 | Unclassified | 2187 |
| 385 | Ga0373926_0013128 | 3300035083 | Unclassified | 2806 |
| 386 | Ga0373934_0004876 | 3300035086 | Unclassified | 4964 |
| 387 | Ga0373944_0034418 | 3300035089 | Unclassified | 1540 |
| 388 | Ga0373923_0038857 | 3300035111 | Bacteria | 1952 |
| 389 | Ga0373945_0017731 | 3300035116 | Unclassified | 2414 |
| 390 | Ga0373953_0003990 | 3300035117 | Unclassified | 4657 |
| 391 | Ga0373954_0004799 | 3300035118 | Bacteria | 5830 |
| 392 | Ga0373954_0017165 | 3300035118 | Bacteria | 3246 |
| 393 | Ga0373956_0003824 | 3300035119 | Bacteria | 6056 |
| 394 | Ga0373956_0052590 | 3300035119 | Bacteria | 1832 |
| 395 | Ga0373943_0006600 | 3300035170 | Bacteria | 5202 |
| 396 | Ga0373955_0002557 | 3300035172 | Bacteria | 7957 |
| 397 | Ga0373955_0047227 | 3300035172 | Bacteria | 2330 |
| 398 | Ga0373955_0084500 | 3300035172 | Unclassified | 1800 |
| 399 | Ga0373962_0031054 | 3300035242 | Bacteria | 1464 |
| 400 | Ga0373931_0037872 | 3300035691 | Bacteria | 2520 |
| 401 | Ga0373935_0001385 | 3300035692 | Bacteria | 13401 |
| 402 | Ga0373935_0029615 | 3300035692 | Bacteria | 3389 |
| 403 | Ga0373927_0000454 | 3300035695 | Bacteria | 31317 |
| 404 | Ga0373927_0046938 | 3300035695 | Bacteria | 2794 |
| 405 | Ga0373927_0101268 | 3300035695 | Bacteria | 1874 |
| 406 | Ga0373933_0005505 | 3300035724 | Bacteria | 6897 |
| 407 | Ga0373933_0033811 | 3300035724 | Bacteria | 2976 |
| 408 | Ga0373947_0009236 | 3300035725 | Bacteria | 5667 |
| 409 | Ga0373947_0019011 | 3300035725 | Bacteria | 3958 |
| 410 | Ga0373947_0059422 | 3300035725 | Bacteria | 2318 |
| 411 | Ga0373937_0001572 | 3300036401 | Bacteria | 19175 |
| 412 | Ga0373937_0036195 | 3300036401 | Bacteria | 4497 |
| 413 | Ga0373937_0077007 | 3300036401 | Bacteria | 3081 |
| 414 | Ga0373925_0000782 | 3300037068 | Bacteria | 29294 |
| 415 | Ga0373925_0031280 | 3300037068 | Bacteria | 3910 |
| 416 | Ga0373925_0166934 | 3300037068 | Bacteria | 1736 |
| 417 | Ga0373925_0183932 | 3300037068 | Bacteria | 1656 |
| 418 | Ga0395905_0071834 | 3300037471 | Bacteria | 3245 |
| 419 | Ga0436362_0802604 | 3300039453 | Bacteria | 3908 |
| 420 | Ga0436362_1166207 | 3300039453 | Bacteria | 2088 |
| 421 | Ga0439458_0001728 | 3300042157 | Bacteria | 5463 |
| 422 | Ga0466966_0095398 | 3300044684 | Bacteria | 1843 |
| 423 | Ga0466967_0170461 | 3300045976 | Unclassified | 2047 |
| 424 | Ga0466967_0366053 | 3300045976 | Bacteria | 1398 |
| 425 | Ga0495580_0000977 | 3300046472 | Bacteria | 25057 |
| 426 | Ga0495580_0001272 | 3300046472 | Bacteria | 22231 |
| 427 | Ga0495580_0001342 | 3300046472 | Bacteria | 21668 |
| 428 | Ga0495580_0002203 | 3300046472 | Bacteria | 17047 |
| 429 | Ga0495580_0058756 | 3300046472 | Unclassified | 2704 |
| 430 | Ga0495582_0000037 | 3300046473 | Bacteria | 70566 |
| 431 | Ga0495639_0006196 | 3300046475 | Bacteria | 5136 |
| 432 | Ga0495594_0013707 | 3300046499 | Unclassified | 4237 |
| 433 | Ga0495594_0072481 | 3300046499 | Bacteria | 1916 |
| 434 | Ga0495628_0080946 | 3300046516 | Unclassified | 2523 |
| 435 | Ga0495630_0099051 | 3300046517 | Unclassified | 2205 |
| 436 | Ga0495648_0075339 | 3300046524 | Unclassified | 1941 |
| 437 | Ga0495666_0085278 | 3300046526 | Bacteria | 1492 |
| 438 | Ga0495586_0063057 | 3300046535 | Unclassified | 2018 |
| 439 | Ga0495587_0003145 | 3300046536 | Bacteria | 11029 |
| 440 | Ga0495645_0017672 | 3300046543 | Bacteria | 5112 |
| 441 | Ga0495667_0049162 | 3300046559 | Unclassified | 2784 |
| 442 | Ga0495625_0133539 | 3300046660 | Bacteria | 1680 |
| 443 | Ga0495599_0120230 | 3300046678 | Unclassified | 1633 |
| 444 | Ga0495623_0014435 | 3300046679 | Bacteria | 5113 |
| 445 | Ga0495658_0017562 | 3300046683 | Bacteria | 3699 |
| 446 | Ga0495658_0045540 | 3300046683 | Bacteria | 2462 |
| 447 | Ga0495658_0052068 | 3300046683 | Unclassified | 2320 |
| 448 | Ga0495669_0077845 | 3300046684 | Bacteria | 1519 |
| 449 | Ga0495604_0009835 | 3300047317 | Bacteria | 7566 |
| 450 | Ga0495674_0018016 | 3300047319 | Bacteria | 6573 |
| 451 | Ga0495674_0059967 | 3300047319 | Unclassified | 3322 |
| 452 | Ga0495674_0122012 | 3300047319 | Bacteria | 2201 |
| 453 | Ga0495672_0006641 | 3300047320 | Bacteria | 8888 |
| 454 | Ga0495672_0006880 | 3300047320 | Bacteria | 8676 |
| 455 | Ga0495684_0017031 | 3300047471 | Bacteria | 5598 |
| 456 | Ga0495686_0001979 | 3300047472 | Bacteria | 20321 |
| 457 | Ga0495686_0014262 | 3300047472 | Bacteria | 5475 |
| 458 | Ga0495686_0014283 | 3300047472 | Bacteria | 5471 |
| 459 | Ga0495686_0121990 | 3300047472 | Bacteria | 1552 |
| 460 | Ga0495602_0008779 | 3300048088 | Bacteria | 10548 |
| 461 | Ga0495602_0009777 | 3300048088 | Bacteria | 9961 |
| 462 | Ga0495602_0181943 | 3300048088 | Unclassified | 1620 |
| 463 | Ga0496100_0100597 | 3300048903 | Bacteria | 1992 |
| 464 | Ga0496100_0130548 | 3300048903 | Bacteria | 1769 |
| 465 | Ga0496102_0005199 | 3300048905 | Bacteria | 11049 |
| 466 | Ga0496102_0037108 | 3300048905 | Bacteria | 4395 |
| 467 | Ga0496102_0045087 | 3300048905 | Bacteria | 4002 |
| 468 | Ga0496102_0266058 | 3300048905 | Bacteria | 1616 |
| 469 | Ga0496103_0026996 | 3300048906 | Bacteria | 3477 |
| 470 | Ga0496103_0049590 | 3300048906 | Bacteria | 2596 |
| 471 | Ga0496103_0063476 | 3300048906 | Bacteria | 2301 |
| 472 | Ga0496104_0061189 | 3300048907 | Bacteria | 3569 |
| 473 | Ga0496104_0175754 | 3300048907 | Bacteria | 2052 |
| 474 | Ga0496106_0018696 | 3300048909 | Bacteria | 5131 |
| 475 | Ga0496106_0046511 | 3300048909 | Bacteria | 3263 |
| 476 | Ga0496106_0148752 | 3300048909 | Unclassified | 1846 |
| 477 | Ga0496107_0027564 | 3300048910 | Bacteria | 4034 |
| 478 | Ga0496107_0145937 | 3300048910 | Bacteria | 1749 |
| 479 | Ga0496108_0007454 | 3300048911 | Bacteria | 8868 |
| 480 | Ga0496108_0151033 | 3300048911 | Bacteria | 2004 |
| 481 | Ga0496108_0165952 | 3300048911 | Bacteria | 1909 |
| 482 | Ga0496109_0015768 | 3300048912 | Bacteria | 6596 |
| 483 | Ga0496109_0148107 | 3300048912 | Unclassified | 2197 |
| 484 | Ga0496110_0006872 | 3300048913 | Bacteria | 9045 |
| 485 | Ga0496112_0000146 | 3300048915 | Bacteria | 44267 |
| 486 | Ga0496112_0002955 | 3300048915 | Bacteria | 13862 |
| 487 | Ga0496112_0019330 | 3300048915 | Bacteria | 6428 |
| 488 | Ga0496112_0024307 | 3300048915 | Bacteria | 5800 |
| 489 | Ga0496112_0024519 | 3300048915 | Bacteria | 5777 |
| 490 | Ga0496112_0027529 | 3300048915 | Bacteria | 5481 |
| 491 | Ga0496112_0165504 | 3300048915 | Unclassified | 2177 |
| 492 | Ga0496113_0049688 | 3300048916 | Bacteria | 3124 |
| 493 | Ga0496115_0019838 | 3300048918 | Bacteria | 5180 |
| 494 | Ga0496115_0028763 | 3300048918 | Bacteria | 4359 |
| 495 | Ga0496115_0057398 | 3300048918 | Bacteria | 3131 |
| 496 | Ga0496116_0012258 | 3300048919 | Bacteria | 7012 |
| 497 | Ga0496117_0000035 | 3300048920 | Bacteria | 326449 |
| 498 | Ga0496118_0000054 | 3300048921 | Bacteria | 233617 |
| 499 | Ga0496119_0004560 | 3300048922 | Bacteria | 13709 |
| 500 | Ga0496120_0029038 | 3300048923 | Unclassified | 3381 |
| 501 | Ga0496121_0002192 | 3300048924 | Bacteria | 30563 |
| 502 | Ga0496122_0004629 | 3300048925 | Bacteria | 16923 |
| 503 | Ga0496123_0002862 | 3300048926 | Bacteria | 20314 |
| 504 | Ga0496124_0004189 | 3300048927 | Bacteria | 16988 |
| 505 | Ga0496124_0068475 | 3300048927 | Bacteria | 2949 |
| 506 | Ga0496125_0003275 | 3300048928 | Bacteria | 19914 |
| 507 | Ga0496125_0007617 | 3300048928 | Bacteria | 11491 |
| 508 | Ga0496126_0002190 | 3300048929 | Bacteria | 27165 |
| 509 | Ga0496126_0003894 | 3300048929 | Bacteria | 18354 |
| 510 | Ga0496126_0142967 | 3300048929 | Bacteria | 2057 |
| 511 | Ga0501031_0032167 | 3300049568 | Bacteria | 3421 |
| 512 | Ga0501031_0080548 | 3300049568 | Bacteria | 2122 |
| 513 | Ga0501032_0003816 | 3300049569 | Bacteria | 11441 |
| 514 | Ga0501032_0012457 | 3300049569 | Bacteria | 6076 |
| 515 | Ga0501033_0000675 | 3300049570 | Bacteria | 31467 |
| 516 | Ga0501033_0023462 | 3300049570 | Bacteria | 4652 |
| 517 | Ga0501036_0002489 | 3300049572 | Bacteria | 14444 |
| 518 | Ga0501037_0001892 | 3300049573 | Bacteria | 15220 |
| 519 | Ga0501037_0019663 | 3300049573 | Bacteria | 4983 |
| 520 | Ga0501037_0138852 | 3300049573 | Bacteria | 1740 |
| 521 | Ga0501038_0005942 | 3300049574 | Bacteria | 11289 |
| 522 | Ga0501039_0135014 | 3300049575 | Bacteria | 1937 |
| 523 | Ga0501043_0001924 | 3300049579 | Bacteria | 17773 |
| 524 | Ga0501043_0008177 | 3300049579 | Bacteria | 8252 |
| 525 | Ga0501046_0000389 | 3300049580 | Bacteria | 44043 |
| 526 | Ga0501046_0116100 | 3300049580 | Bacteria | 2041 |
| 527 | Ga0501047_0005145 | 3300049581 | Bacteria | 12274 |
| 528 | Ga0501047_0008295 | 3300049581 | Bacteria | 9805 |
| 529 | Ga0501047_0010899 | 3300049581 | Bacteria | 8597 |
| 530 | Ga0501047_0022562 | 3300049581 | Bacteria | 6044 |
| 531 | Ga0501048_0167497 | 3300049582 | Bacteria | 1556 |
| 532 | Ga0501070_0064572 | 3300049586 | Bacteria | 3031 |
| 533 | Ga0501073_0001170 | 3300049589 | Bacteria | 19167 |
| 534 | Ga0501080_0011888 | 3300049742 | Bacteria | 7976 |
| 535 | Ga0501080_0018597 | 3300049742 | Bacteria | 6431 |
| 536 | Ga0501083_0088236 | 3300049744 | Bacteria | 2051 |
| 537 | Ga0501035_0000357 | 3300049822 | Bacteria | 52667 |
| 538 | Ga0501035_0278729 | 3300049822 | Bacteria | 1414 |
| 539 | Ga0501044_0001820 | 3300049823 | Bacteria | 24832 |
| 540 | Ga0501044_0074996 | 3300049823 | Bacteria | 3435 |
| 541 | nmdc:mga0n895_94768_c1 | 3300050512 | Bacteria | 2989 |
| 542 | nmdc:mga08x19_1500_c1 | 3300050514 | Bacteria | 14454 |
| 543 | nmdc:mga08x19_3625_c1 | 3300050514 | Bacteria | 9192 |
| 544 | Ga0495601_0040880 | 3300053077 | Bacteria | 2905 |
| 545 | Ga0495619_0051410 | 3300053085 | Unclassified | 2723 |
| 546 | Ga0500651_0000002 | 3300053093 | Bacteria | 476609 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048915 | Ga0496112_0165504 | Ga0496112_0165504_985_2103 | 324 |
| 2 | 3300035117 | Ga0373953_0003990 | Ga0373953_0003990_394_1545 | 331 |
| 3 | 3300048906 | Ga0496103_0063476 | Ga0496103_0063476_1023_2165 | 345 |
| 4 | 3300048088 | Ga0495602_0181943 | Ga0495602_0181943_401_1609 | 350 |
| 5 | 3300049822 | Ga0501035_0278729 | Ga0501035_0278729_92_1396 | 358 |
| 6 | 3300047472 | Ga0495686_0014283 | Ga0495686_0014283_577_1788 | 360 |
| 7 | 3300048925 | Ga0496122_0004629 | Ga0496122_0004629_15178_16431 | 362 |
| 8 | 3300048926 | Ga0496123_0002862 | Ga0496123_0002862_17031_18284 | 362 |
| 9 | 3300048927 | Ga0496124_0004189 | Ga0496124_0004189_14640_15893 | 362 |
| 10 | 3300005435 | Ga0070714_100141836 | Ga0070714_1001418362 | 363 |
| 11 | 3300025929 | Ga0207664_10045900 | Ga0207664_100459003 | 363 |
| 12 | 3300048929 | Ga0496126_0002190 | Ga0496126_0002190_1461_2762 | 364 |
| 13 | 3300049581 | Ga0501047_0022562 | Ga0501047_0022562_4411_5715 | 366 |
| 14 | 3300005336 | Ga0070680_100054663 | Ga0070680_1000546633 | 367 |
| 15 | 3300005535 | Ga0070684_100207084 | Ga0070684_1002070841 | 367 |
| 16 | 3300005539 | Ga0068853_100007112 | Ga0068853_1000071125 | 367 |
| 17 | 3300005577 | Ga0068857_100069231 | Ga0068857_1000692312 | 367 |
| 18 | 3300009545 | Ga0105237_10007636 | Ga0105237_100076366 | 367 |
| 19 | 3300009551 | Ga0105238_10190357 | Ga0105238_101903572 | 367 |
| 20 | 3300025919 | Ga0207657_10036957 | Ga0207657_100369573 | 367 |
| 21 | 3300025921 | Ga0207652_10045116 | Ga0207652_100451162 | 367 |
| 22 | 3300025944 | Ga0207661_10004917 | Ga0207661_100049175 | 367 |
| 23 | 3300026116 | Ga0207674_10001720 | Ga0207674_1000172011 | 367 |
| 24 | 3300048913 | Ga0496110_0006872 | Ga0496110_0006872_7764_9023 | 367 |
| 25 | 3300002067 | JGI24735J21928_10022232 | JGI24735J21928_100222321 | 370 |
| 26 | 3300025905 | Ga0207685_10008794 | Ga0207685_100087943 | 370 |
| 27 | 3300035172 | Ga0373955_0084500 | Ga0373955_0084500_244_1548 | 371 |
| 28 | 3300046683 | Ga0495658_0052068 | Ga0495658_0052068_329_1564 | 371 |
| 29 | 3300010159 | Ga0099796_10001434 | Ga0099796_100014345 | 373 |
| 30 | 3300048905 | Ga0496102_0037108 | Ga0496102_0037108_2447_3718 | 373 |
| 31 | 3300048906 | Ga0496103_0026996 | Ga0496103_0026996_351_1622 | 373 |
| 32 | 3300048919 | Ga0496116_0012258 | Ga0496116_0012258_2473_3744 | 373 |
| 33 | 3300048920 | Ga0496117_0000035 | Ga0496117_0000035_174169_175440 | 373 |
| 34 | 3300048921 | Ga0496118_0000054 | Ga0496118_0000054_47621_48892 | 373 |
| 35 | 3300048927 | Ga0496124_0068475 | Ga0496124_0068475_414_1685 | 373 |
| 36 | 3300048929 | Ga0496126_0142967 | Ga0496126_0142967_372_1643 | 373 |
| 37 | 3300005719 | Ga0068861_100235114 | Ga0068861_1002351142 | 374 |
| 38 | 3300013306 | Ga0163162_10047749 | Ga0163162_100477493 | 374 |
| 39 | 3300047320 | Ga0495672_0006880 | Ga0495672_0006880_3090_4337 | 374 |
| 40 | 3300048922 | Ga0496119_0004560 | Ga0496119_0004560_10653_11924 | 374 |
| 41 | 3300048923 | Ga0496120_0029038 | Ga0496120_0029038_1818_3089 | 374 |
| 42 | 3300048928 | Ga0496125_0003275 | Ga0496125_0003275_7201_8472 | 374 |
| 43 | 3300005335 | Ga0070666_10088323 | Ga0070666_100883231 | 375 |
| 44 | 3300005367 | Ga0070667_100010667 | Ga0070667_1000106674 | 375 |
| 45 | 3300005617 | Ga0068859_100028325 | Ga0068859_1000283255 | 375 |
| 46 | 3300005841 | Ga0068863_100091497 | Ga0068863_1000914973 | 375 |
| 47 | 3300005842 | Ga0068858_100010601 | Ga0068858_1000106015 | 375 |
| 48 | 3300005843 | Ga0068860_100159947 | Ga0068860_1001599472 | 375 |
| 49 | 3300006931 | Ga0097620_100028327 | Ga0097620_1000283275 | 375 |
| 50 | 3300009101 | Ga0105247_10011606 | Ga0105247_100116063 | 375 |
| 51 | 3300014968 | Ga0157379_10015521 | Ga0157379_100155214 | 375 |
| 52 | 3300025900 | Ga0207710_10001989 | Ga0207710_100019894 | 375 |
| 53 | 3300025941 | Ga0207711_10084114 | Ga0207711_100841142 | 375 |
| 54 | 3300025986 | Ga0207658_10008131 | Ga0207658_100081316 | 375 |
| 55 | 3300026035 | Ga0207703_10001419 | Ga0207703_100014193 | 375 |
| 56 | 3300026118 | Ga0207675_100235427 | Ga0207675_1002354272 | 375 |
| 57 | 3300028381 | Ga0268264_10038199 | Ga0268264_100381993 | 375 |
| 58 | 3300048915 | Ga0496112_0027529 | Ga0496112_0027529_2011_3381 | 375 |
| 59 | 3300048924 | Ga0496121_0002192 | Ga0496121_0002192_18414_19769 | 375 |
| 60 | 3300048928 | Ga0496125_0007617 | Ga0496125_0007617_3413_4783 | 375 |
| 61 | 3300009093 | Ga0105240_10126147 | Ga0105240_101261472 | 378 |
| 62 | 3300013297 | Ga0157378_10137602 | Ga0157378_101376022 | 378 |
| 63 | 3300028380 | Ga0268265_10191590 | Ga0268265_101915901 | 378 |
| 64 | 3300014969 | Ga0157376_10041904 | Ga0157376_100419042 | 379 |
| 65 | 3300006028 | Ga0070717_10011129 | Ga0070717_100111294 | 380 |
| 66 | 3300009098 | Ga0105245_10025834 | Ga0105245_100258342 | 380 |
| 67 | 3300013296 | Ga0157374_10000328 | Ga0157374_100003286 | 380 |
| 68 | 3300013296 | Ga0157374_10024009 | Ga0157374_100240092 | 380 |
| 69 | 3300013306 | Ga0163162_10018926 | Ga0163162_100189262 | 380 |
| 70 | 3300013308 | Ga0157375_10000473 | Ga0157375_100004735 | 380 |
| 71 | 3300014325 | Ga0163163_10036805 | Ga0163163_100368055 | 380 |
| 72 | 3300014968 | Ga0157379_10155892 | Ga0157379_101558922 | 380 |
| 73 | 3300048915 | Ga0496112_0002955 | Ga0496112_0002955_11814_13070 | 380 |
| 74 | 3300048906 | Ga0496103_0049590 | Ga0496103_0049590_1237_2538 | 381 |
| 75 | 3300049568 | Ga0501031_0080548 | Ga0501031_0080548_627_1913 | 381 |
| 76 | 3300049569 | Ga0501032_0012457 | Ga0501032_0012457_3204_4490 | 381 |
| 77 | 3300049570 | Ga0501033_0023462 | Ga0501033_0023462_935_2221 | 381 |
| 78 | 3300049572 | Ga0501036_0002489 | Ga0501036_0002489_613_1899 | 381 |
| 79 | 3300049579 | Ga0501043_0008177 | Ga0501043_0008177_3014_4300 | 381 |
| 80 | 3300049580 | Ga0501046_0000389 | Ga0501046_0000389_10583_11869 | 381 |
| 81 | 3300049581 | Ga0501047_0010899 | Ga0501047_0010899_4314_5600 | 381 |
| 82 | 3300049582 | Ga0501048_0167497 | Ga0501048_0167497_180_1466 | 381 |
| 83 | 3300049589 | Ga0501073_0001170 | Ga0501073_0001170_11483_12769 | 381 |
| 84 | 3300049742 | Ga0501080_0018597 | Ga0501080_0018597_1149_2435 | 381 |
| 85 | 3300049822 | Ga0501035_0000357 | Ga0501035_0000357_49324_50610 | 381 |
| 86 | iso_pu_bacteria | 2884215851 | 2884216513 | 381 |
| 87 | 3300005328 | Ga0070676_10000032 | Ga0070676_1000003215 | 382 |
| 88 | 3300035086 | Ga0373934_0004876 | Ga0373934_0004876_332_1639 | 382 |
| 89 | 3300035118 | Ga0373954_0004799 | Ga0373954_0004799_3748_5055 | 382 |
| 90 | 3300035119 | Ga0373956_0003824 | Ga0373956_0003824_1111_2418 | 382 |
| 91 | 3300035172 | Ga0373955_0002557 | Ga0373955_0002557_4137_5444 | 382 |
| 92 | 3300035724 | Ga0373933_0005505 | Ga0373933_0005505_4229_5536 | 382 |
| 93 | 3300036401 | Ga0373937_0001572 | Ga0373937_0001572_4892_6199 | 382 |
| 94 | 3300046536 | Ga0495587_0003145 | Ga0495587_0003145_8275_9582 | 382 |
| 95 | 3300046559 | Ga0495667_0049162 | Ga0495667_0049162_1369_2676 | 382 |
| 96 | 3300047317 | Ga0495604_0009835 | Ga0495604_0009835_4077_5384 | 382 |
| 97 | 3300047471 | Ga0495684_0017031 | Ga0495684_0017031_2106_3413 | 382 |
| 98 | 3300047472 | Ga0495686_0121990 | Ga0495686_0121990_93_1364 | 382 |
| 99 | 3300048088 | Ga0495602_0009777 | Ga0495602_0009777_2159_3466 | 382 |
| 100 | 3300005365 | Ga0070688_100171673 | Ga0070688_1001716731 | 383 |
| 101 | 3300013307 | Ga0157372_10045279 | Ga0157372_100452793 | 383 |
| 102 | 3300025915 | Ga0207693_10036261 | Ga0207693_100362612 | 383 |
| 103 | 3300025916 | Ga0207663_10056805 | Ga0207663_100568052 | 383 |
| 104 | 3300026089 | Ga0207648_10010314 | Ga0207648_100103142 | 383 |
| 105 | 3300035725 | Ga0373947_0059422 | Ga0373947_0059422_777_2039 | 383 |
| 106 | 3300037471 | Ga0395905_0071834 | Ga0395905_0071834_61_1353 | 383 |
| 107 | 3300006175 | Ga0070712_100194477 | Ga0070712_1001944772 | 384 |
| 108 | 3300001989 | JGI24739J22299_10012831 | JGI24739J22299_100128313 | 385 |
| 109 | 3300005434 | Ga0070709_10000332 | Ga0070709_1000033214 | 385 |
| 110 | 3300005436 | Ga0070713_100000862 | Ga0070713_1000008624 | 385 |
| 111 | 3300006163 | Ga0070715_10001751 | Ga0070715_100017514 | 385 |
| 112 | 3300006173 | Ga0070716_100003139 | Ga0070716_1000031398 | 385 |
| 113 | 3300006175 | Ga0070712_100000228 | Ga0070712_10000022814 | 385 |
| 114 | 3300006237 | Ga0097621_100125477 | Ga0097621_1001254771 | 385 |
| 115 | 3300014969 | Ga0157376_10005457 | Ga0157376_100054574 | 385 |
| 116 | 3300025906 | Ga0207699_10001156 | Ga0207699_1000115611 | 385 |
| 117 | 3300025915 | Ga0207693_10000108 | Ga0207693_1000010812 | 385 |
| 118 | 3300025928 | Ga0207700_10000557 | Ga0207700_1000055717 | 385 |
| 119 | 3300025939 | Ga0207665_10013845 | Ga0207665_100138453 | 385 |
| 120 | 3300031548 | Ga0307408_100022318 | Ga0307408_1000223182 | 385 |
| 121 | 3300031901 | Ga0307406_10002607 | Ga0307406_100026075 | 385 |
| 122 | 3300005535 | Ga0070684_100065818 | Ga0070684_1000658183 | 386 |
| 123 | 3300006163 | Ga0070715_10014899 | Ga0070715_100148992 | 386 |
| 124 | 3300006175 | Ga0070712_100013696 | Ga0070712_1000136961 | 386 |
| 125 | 3300014325 | Ga0163163_10028547 | Ga0163163_100285474 | 386 |
| 126 | 3300028017 | Ga0265356_1000090 | Ga0265356_10000904 | 386 |
| 127 | 3300005445 | Ga0070708_100018361 | Ga0070708_1000183615 | 387 |
| 128 | 3300046660 | Ga0495625_0133539 | Ga0495625_0133539_16_1320 | 387 |
| 129 | 3300005334 | Ga0068869_100006303 | Ga0068869_1000063032 | 388 |
| 130 | 3300005364 | Ga0070673_100179820 | Ga0070673_1001798202 | 388 |
| 131 | 3300005617 | Ga0068859_100026033 | Ga0068859_1000260334 | 388 |
| 132 | 3300005842 | Ga0068858_100003398 | Ga0068858_10000339812 | 388 |
| 133 | 3300005983 | Ga0081540_1051312 | Ga0081540_10513121 | 388 |
| 134 | 3300006931 | Ga0097620_100026033 | Ga0097620_1000260334 | 388 |
| 135 | 3300009093 | Ga0105240_10030350 | Ga0105240_100303504 | 388 |
| 136 | 3300009093 | Ga0105240_10053116 | Ga0105240_100531163 | 388 |
| 137 | 3300013307 | Ga0157372_10008184 | Ga0157372_100081846 | 388 |
| 138 | 3300013307 | Ga0157372_10012075 | Ga0157372_100120752 | 388 |
| 139 | 3300013307 | Ga0157372_10279378 | Ga0157372_102793782 | 388 |
| 140 | 3300013308 | Ga0157375_10241801 | Ga0157375_102418011 | 388 |
| 141 | 3300013308 | Ga0157375_10247691 | Ga0157375_102476912 | 388 |
| 142 | 3300014969 | Ga0157376_10017240 | Ga0157376_100172403 | 388 |
| 143 | 3300025904 | Ga0207647_10002386 | Ga0207647_100023867 | 388 |
| 144 | 3300025913 | Ga0207695_10004159 | Ga0207695_1000415911 | 388 |
| 145 | 3300025913 | Ga0207695_10080379 | Ga0207695_100803792 | 388 |
| 146 | 3300025929 | Ga0207664_10100611 | Ga0207664_101006112 | 388 |
| 147 | 3300025960 | Ga0207651_10171031 | Ga0207651_101710312 | 388 |
| 148 | 3300026035 | Ga0207703_10015339 | Ga0207703_100153394 | 388 |
| 149 | 3300026089 | Ga0207648_10094646 | Ga0207648_100946462 | 388 |
| 150 | 3300028381 | Ga0268264_10011297 | Ga0268264_100112975 | 388 |
| 151 | 3300047472 | Ga0495686_0001979 | Ga0495686_0001979_10468_11865 | 388 |
| 152 | 3300050512 | nmdc:mga0n895_94768_c1 | nmdc:mga0n895_94768_c1_1434_2735 | 388 |
| 153 | 3300005548 | Ga0070665_100079777 | Ga0070665_1000797773 | 389 |
| 154 | 3300006028 | Ga0070717_10024655 | Ga0070717_100246552 | 389 |
| 155 | 3300007265 | Ga0099794_10045617 | Ga0099794_100456172 | 389 |
| 156 | 3300009177 | Ga0105248_10006022 | Ga0105248_1000602210 | 389 |
| 157 | 3300014969 | Ga0157376_10121490 | Ga0157376_101214902 | 389 |
| 158 | 3300025941 | Ga0207711_10007157 | Ga0207711_100071577 | 389 |
| 159 | 3300035695 | Ga0373927_0046938 | Ga0373927_0046938_659_1987 | 389 |
| 160 | 3300035725 | Ga0373947_0009236 | Ga0373947_0009236_2644_3972 | 389 |
| 161 | 3300037068 | Ga0373925_0031280 | Ga0373925_0031280_2436_3764 | 389 |
| 162 | 3300045976 | Ga0466967_0366053 | Ga0466967_0366053_57_1370 | 389 |
| 163 | 3300046472 | Ga0495580_0000977 | Ga0495580_0000977_12466_13794 | 389 |
| 164 | 3300046524 | Ga0495648_0075339 | Ga0495648_0075339_564_1859 | 389 |
| 165 | 3300046683 | Ga0495658_0017562 | Ga0495658_0017562_1473_2801 | 389 |
| 166 | 3300047472 | Ga0495686_0014262 | Ga0495686_0014262_1411_2727 | 389 |
| 167 | 3300048929 | Ga0496126_0003894 | Ga0496126_0003894_12824_14101 | 389 |
| 168 | 3300053093 | Ga0500651_0000002 | Ga0500651_0000002_90451_91746 | 389 |
| 169 | 3300005344 | Ga0070661_100045028 | Ga0070661_1000450282 | 390 |
| 170 | 3300005434 | Ga0070709_10025913 | Ga0070709_100259132 | 390 |
| 171 | 3300005434 | Ga0070709_10123640 | Ga0070709_101236402 | 390 |
| 172 | 3300005439 | Ga0070711_100040686 | Ga0070711_1000406862 | 390 |
| 173 | 3300005545 | Ga0070695_100015508 | Ga0070695_1000155082 | 390 |
| 174 | 3300006173 | Ga0070716_100000248 | Ga0070716_10000024811 | 390 |
| 175 | 3300006173 | Ga0070716_100118399 | Ga0070716_1001183992 | 390 |
| 176 | 3300006175 | Ga0070712_100004509 | Ga0070712_1000045096 | 390 |
| 177 | 3300006237 | Ga0097621_100037822 | Ga0097621_1000378221 | 390 |
| 178 | 3300006914 | Ga0075436_100005552 | Ga0075436_1000055522 | 390 |
| 179 | 3300007265 | Ga0099794_10016059 | Ga0099794_100160593 | 390 |
| 180 | 3300007265 | Ga0099794_10072029 | Ga0099794_100720291 | 390 |
| 181 | 3300009174 | Ga0105241_10020237 | Ga0105241_100202374 | 390 |
| 182 | 3300014968 | Ga0157379_10001487 | Ga0157379_100014874 | 390 |
| 183 | 3300014969 | Ga0157376_10000030 | Ga0157376_1000003057 | 390 |
| 184 | 3300014969 | Ga0157376_10209363 | Ga0157376_102093632 | 390 |
| 185 | 3300025906 | Ga0207699_10017626 | Ga0207699_100176263 | 390 |
| 186 | 3300025906 | Ga0207699_10053975 | Ga0207699_100539752 | 390 |
| 187 | 3300025915 | Ga0207693_10008067 | Ga0207693_100080677 | 390 |
| 188 | 3300025920 | Ga0207649_10026267 | Ga0207649_100262672 | 390 |
| 189 | 3300025939 | Ga0207665_10001867 | Ga0207665_100018673 | 390 |
| 190 | 3300025939 | Ga0207665_10024560 | Ga0207665_100245602 | 390 |
| 191 | 3300028800 | Ga0265338_10002594 | Ga0265338_100025946 | 390 |
| 192 | 3300035695 | Ga0373927_0101268 | Ga0373927_0101268_203_1501 | 390 |
| 193 | 3300046472 | Ga0495580_0001342 | Ga0495580_0001342_16322_17620 | 390 |
| 194 | 3300046526 | Ga0495666_0085278 | Ga0495666_0085278_180_1478 | 390 |
| 195 | 3300048903 | Ga0496100_0130548 | Ga0496100_0130548_411_1736 | 390 |
| 196 | 3300048905 | Ga0496102_0005199 | Ga0496102_0005199_7714_9039 | 390 |
| 197 | 3300048909 | Ga0496106_0018696 | Ga0496106_0018696_1412_2737 | 390 |
| 198 | 3300048910 | Ga0496107_0145937 | Ga0496107_0145937_367_1692 | 390 |
| 199 | 3300048918 | Ga0496115_0019838 | Ga0496115_0019838_132_1445 | 390 |
| 200 | 3300049568 | Ga0501031_0032167 | Ga0501031_0032167_300_1595 | 390 |
| 201 | 3300049569 | Ga0501032_0003816 | Ga0501032_0003816_7357_8652 | 390 |
| 202 | 3300049570 | Ga0501033_0000675 | Ga0501033_0000675_20338_21633 | 390 |
| 203 | 3300049572 | Ga0501036_0002489 | Ga0501036_0002489_12541_13836 | 390 |
| 204 | 3300049573 | Ga0501037_0001892 | Ga0501037_0001892_8865_10160 | 390 |
| 205 | 3300049574 | Ga0501038_0005942 | Ga0501038_0005942_503_1798 | 390 |
| 206 | 3300049575 | Ga0501039_0135014 | Ga0501039_0135014_264_1559 | 390 |
| 207 | 3300049579 | Ga0501043_0001924 | Ga0501043_0001924_6580_7875 | 390 |
| 208 | 3300049580 | Ga0501046_0000389 | Ga0501046_0000389_22511_23806 | 390 |
| 209 | 3300049581 | Ga0501047_0005145 | Ga0501047_0005145_6485_7780 | 390 |
| 210 | 3300049742 | Ga0501080_0011888 | Ga0501080_0011888_4424_5719 | 390 |
| 211 | 3300049822 | Ga0501035_0000357 | Ga0501035_0000357_37387_38682 | 390 |
| 212 | 3300049823 | Ga0501044_0001820 | Ga0501044_0001820_12144_13439 | 390 |
| 213 | 3300050514 | nmdc:mga08x19_3625_c1 | nmdc:mga08x19_3625_c1_4674_5960 | 390 |
| 214 | 3300005436 | Ga0070713_100000856 | Ga0070713_10000085616 | 391 |
| 215 | 3300005439 | Ga0070711_100000078 | Ga0070711_10000007812 | 391 |
| 216 | 3300005439 | Ga0070711_100003687 | Ga0070711_1000036872 | 391 |
| 217 | 3300005445 | Ga0070708_100040569 | Ga0070708_1000405693 | 391 |
| 218 | 3300005445 | Ga0070708_100084736 | Ga0070708_1000847362 | 391 |
| 219 | 3300006028 | Ga0070717_10005939 | Ga0070717_100059392 | 391 |
| 220 | 3300006173 | Ga0070716_100010359 | Ga0070716_1000103594 | 391 |
| 221 | 3300006175 | Ga0070712_100029340 | Ga0070712_1000293403 | 391 |
| 222 | 3300007265 | Ga0099794_10001317 | Ga0099794_100013173 | 391 |
| 223 | 3300007265 | Ga0099794_10003137 | Ga0099794_100031375 | 391 |
| 224 | 3300007265 | Ga0099794_10043344 | Ga0099794_100433442 | 391 |
| 225 | 3300013307 | Ga0157372_10378576 | Ga0157372_103785761 | 391 |
| 226 | 3300025915 | Ga0207693_10000012 | Ga0207693_1000001286 | 391 |
| 227 | 3300025915 | Ga0207693_10000808 | Ga0207693_1000080813 | 391 |
| 228 | 3300025916 | Ga0207663_10000658 | Ga0207663_100006586 | 391 |
| 229 | 3300025916 | Ga0207663_10100612 | Ga0207663_101006122 | 391 |
| 230 | 3300025922 | Ga0207646_10140975 | Ga0207646_101409752 | 391 |
| 231 | 3300025928 | Ga0207700_10003390 | Ga0207700_100033908 | 391 |
| 232 | 3300025939 | Ga0207665_10009817 | Ga0207665_100098173 | 391 |
| 233 | 3300027671 | Ga0209588_1031740 | Ga0209588_10317401 | 391 |
| 234 | 3300031090 | Ga0265760_10012146 | Ga0265760_100121462 | 391 |
| 235 | 3300042157 | Ga0439458_0001728 | Ga0439458_0001728_3884_5200 | 391 |
| 236 | 3300044684 | Ga0466966_0095398 | Ga0466966_0095398_51_1361 | 391 |
| 237 | 3300046543 | Ga0495645_0017672 | Ga0495645_0017672_1171_2463 | 391 |
| 238 | 3300046678 | Ga0495599_0120230 | Ga0495599_0120230_129_1421 | 391 |
| 239 | 3300047319 | Ga0495674_0122012 | Ga0495674_0122012_136_1428 | 391 |
| 240 | 3300048907 | Ga0496104_0061189 | Ga0496104_0061189_298_1626 | 391 |
| 241 | 3300048918 | Ga0496115_0057398 | Ga0496115_0057398_227_1555 | 391 |
| 242 | 3300053077 | Ga0495601_0040880 | Ga0495601_0040880_181_1473 | 391 |
| 243 | 3300005439 | Ga0070711_100025160 | Ga0070711_1000251602 | 392 |
| 244 | 3300005546 | Ga0070696_100018704 | Ga0070696_1000187042 | 392 |
| 245 | 3300005618 | Ga0068864_100137439 | Ga0068864_1001374392 | 392 |
| 246 | 3300009148 | Ga0105243_10057351 | Ga0105243_100573511 | 392 |
| 247 | 3300014968 | Ga0157379_10198328 | Ga0157379_101983281 | 392 |
| 248 | 3300025911 | Ga0207654_10040824 | Ga0207654_100408241 | 392 |
| 249 | 3300025935 | Ga0207709_10030734 | Ga0207709_100307341 | 392 |
| 250 | 3300048909 | Ga0496106_0148752 | Ga0496106_0148752_427_1749 | 392 |
| 251 | 3300013307 | Ga0157372_10048077 | Ga0157372_100480776 | 393 |
| 252 | 3300025928 | Ga0207700_10074551 | Ga0207700_100745512 | 393 |
| 253 | 3300046472 | Ga0495580_0058756 | Ga0495580_0058756_1000_2301 | 393 |
| 254 | 3300046475 | Ga0495639_0006196 | Ga0495639_0006196_2116_3417 | 393 |
| 255 | 3300046499 | Ga0495594_0013707 | Ga0495594_0013707_1181_2482 | 393 |
| 256 | 3300046517 | Ga0495630_0099051 | Ga0495630_0099051_118_1419 | 393 |
| 257 | 3300046535 | Ga0495586_0063057 | Ga0495586_0063057_358_1659 | 393 |
| 258 | 3300047319 | Ga0495674_0059967 | Ga0495674_0059967_13_1383 | 393 |
| 259 | 3300005335 | Ga0070666_10082575 | Ga0070666_100825752 | 394 |
| 260 | 3300005338 | Ga0068868_100006628 | Ga0068868_1000066288 | 394 |
| 261 | 3300005339 | Ga0070660_100167806 | Ga0070660_1001678062 | 394 |
| 262 | 3300005344 | Ga0070661_100037985 | Ga0070661_1000379852 | 394 |
| 263 | 3300005366 | Ga0070659_100043959 | Ga0070659_1000439592 | 394 |
| 264 | 3300005445 | Ga0070708_100002764 | Ga0070708_1000027643 | 394 |
| 265 | 3300005457 | Ga0070662_100010648 | Ga0070662_1000106485 | 394 |
| 266 | 3300005459 | Ga0068867_100014513 | Ga0068867_1000145132 | 394 |
| 267 | 3300005535 | Ga0070684_100080732 | Ga0070684_1000807322 | 394 |
| 268 | 3300005539 | Ga0068853_100097095 | Ga0068853_1000970952 | 394 |
| 269 | 3300005544 | Ga0070686_100079820 | Ga0070686_1000798202 | 394 |
| 270 | 3300005547 | Ga0070693_100079106 | Ga0070693_1000791061 | 394 |
| 271 | 3300005564 | Ga0070664_100029921 | Ga0070664_1000299213 | 394 |
| 272 | 3300005577 | Ga0068857_100106138 | Ga0068857_1001061382 | 394 |
| 273 | 3300005617 | Ga0068859_100018197 | Ga0068859_1000181971 | 394 |
| 274 | 3300005718 | Ga0068866_10056708 | Ga0068866_100567082 | 394 |
| 275 | 3300005719 | Ga0068861_100103348 | Ga0068861_1001033482 | 394 |
| 276 | 3300005834 | Ga0068851_10037445 | Ga0068851_100374451 | 394 |
| 277 | 3300005841 | Ga0068863_100254449 | Ga0068863_1002544491 | 394 |
| 278 | 3300005843 | Ga0068860_100317503 | Ga0068860_1003175031 | 394 |
| 279 | 3300005844 | Ga0068862_100006015 | Ga0068862_1000060158 | 394 |
| 280 | 3300006358 | Ga0068871_100011411 | Ga0068871_1000114111 | 394 |
| 281 | 3300006881 | Ga0068865_100026715 | Ga0068865_1000267153 | 394 |
| 282 | 3300006914 | Ga0075436_100000061 | Ga0075436_10000006128 | 394 |
| 283 | 3300006931 | Ga0097620_100018197 | Ga0097620_1000181976 | 394 |
| 284 | 3300009093 | Ga0105240_10063080 | Ga0105240_100630802 | 394 |
| 285 | 3300009098 | Ga0105245_10209221 | Ga0105245_102092212 | 394 |
| 286 | 3300009101 | Ga0105247_10015309 | Ga0105247_100153093 | 394 |
| 287 | 3300009176 | Ga0105242_10243731 | Ga0105242_102437311 | 394 |
| 288 | 3300009545 | Ga0105237_10180357 | Ga0105237_101803572 | 394 |
| 289 | 3300013105 | Ga0157369_10110106 | Ga0157369_101101062 | 394 |
| 290 | 3300013308 | Ga0157375_10156123 | Ga0157375_101561232 | 394 |
| 291 | 3300014325 | Ga0163163_10006586 | Ga0163163_100065866 | 394 |
| 292 | 3300014969 | Ga0157376_10147964 | Ga0157376_101479642 | 394 |
| 293 | 3300021361 | Ga0213872_10000987 | Ga0213872_100009879 | 394 |
| 294 | 3300022730 | Ga0224570_100502 | Ga0224570_1005022 | 394 |
| 295 | 3300024227 | Ga0228598_1000569 | Ga0228598_10005694 | 394 |
| 296 | 3300025321 | Ga0207656_10004521 | Ga0207656_100045213 | 394 |
| 297 | 3300025907 | Ga0207645_10015856 | Ga0207645_100158565 | 394 |
| 298 | 3300025913 | Ga0207695_10009276 | Ga0207695_1000927610 | 394 |
| 299 | 3300025914 | Ga0207671_10014577 | Ga0207671_100145775 | 394 |
| 300 | 3300025915 | Ga0207693_10002543 | Ga0207693_100025439 | 394 |
| 301 | 3300025919 | Ga0207657_10001200 | Ga0207657_100012009 | 394 |
| 302 | 3300025924 | Ga0207694_10071741 | Ga0207694_100717412 | 394 |
| 303 | 3300025927 | Ga0207687_10005999 | Ga0207687_100059995 | 394 |
| 304 | 3300025933 | Ga0207706_10000973 | Ga0207706_1000097323 | 394 |
| 305 | 3300025934 | Ga0207686_10044630 | Ga0207686_100446301 | 394 |
| 306 | 3300025941 | Ga0207711_10037692 | Ga0207711_100376923 | 394 |
| 307 | 3300025944 | Ga0207661_10025580 | Ga0207661_100255803 | 394 |
| 308 | 3300025949 | Ga0207667_10007140 | Ga0207667_100071405 | 394 |
| 309 | 3300025972 | Ga0207668_10039904 | Ga0207668_100399042 | 394 |
| 310 | 3300025986 | Ga0207658_10188035 | Ga0207658_101880351 | 394 |
| 311 | 3300026067 | Ga0207678_10006566 | Ga0207678_1000656610 | 394 |
| 312 | 3300026089 | Ga0207648_10005869 | Ga0207648_100058695 | 394 |
| 313 | 3300026095 | Ga0207676_10055926 | Ga0207676_100559262 | 394 |
| 314 | 3300026116 | Ga0207674_10161746 | Ga0207674_101617462 | 394 |
| 315 | 3300026118 | Ga0207675_100005271 | Ga0207675_10000527110 | 394 |
| 316 | 3300026121 | Ga0207683_10025739 | Ga0207683_100257392 | 394 |
| 317 | 3300030760 | Ga0265762_1001979 | Ga0265762_10019791 | 394 |
| 318 | 3300035242 | Ga0373962_0031054 | Ga0373962_0031054_25_1344 | 394 |
| 319 | 3300035692 | Ga0373935_0029615 | Ga0373935_0029615_334_1692 | 394 |
| 320 | 3300036401 | Ga0373937_0036195 | Ga0373937_0036195_2873_4231 | 394 |
| 321 | 3300037068 | Ga0373925_0183932 | Ga0373925_0183932_44_1402 | 394 |
| 322 | 3300039453 | Ga0436362_1166207 | Ga0436362_1166207_552_1862 | 394 |
| 323 | 3300045976 | Ga0466967_0170461 | Ga0466967_0170461_580_1890 | 394 |
| 324 | 3300046679 | Ga0495623_0014435 | Ga0495623_0014435_2605_3924 | 394 |
| 325 | 3300048088 | Ga0495602_0008779 | Ga0495602_0008779_7328_8647 | 394 |
| 326 | 3300048905 | Ga0496102_0266058 | Ga0496102_0266058_55_1374 | 394 |
| 327 | 3300048911 | Ga0496108_0165952 | Ga0496108_0165952_24_1361 | 394 |
| 328 | 3300048912 | Ga0496109_0148107 | Ga0496109_0148107_749_2068 | 394 |
| 329 | 3300048915 | Ga0496112_0019330 | Ga0496112_0019330_101_1420 | 394 |
| 330 | 3300050514 | nmdc:mga08x19_1500_c1 | nmdc:mga08x19_1500_c1_10016_11347 | 394 |
| 331 | iso_pu_bacteria | 2884215851 | 2884216522 | 394 |
| 332 | 3300005434 | Ga0070709_10028200 | Ga0070709_100282004 | 395 |
| 333 | 3300006028 | Ga0070717_10001170 | Ga0070717_100011703 | 395 |
| 334 | 3300006175 | Ga0070712_100035497 | Ga0070712_1000354972 | 395 |
| 335 | 3300013105 | Ga0157369_10045453 | Ga0157369_100454532 | 395 |
| 336 | 3300014325 | Ga0163163_10027381 | Ga0163163_100273813 | 395 |
| 337 | 3300025904 | Ga0207647_10002001 | Ga0207647_100020017 | 395 |
| 338 | 3300025929 | Ga0207664_10016198 | Ga0207664_100161982 | 395 |
| 339 | 3300026067 | Ga0207678_10078351 | Ga0207678_100783512 | 395 |
| 340 | 3300046684 | Ga0495669_0077845 | Ga0495669_0077845_105_1487 | 395 |
| 341 | 3300049573 | Ga0501037_0019663 | Ga0501037_0019663_639_1955 | 395 |
| 342 | 3300049580 | Ga0501046_0116100 | Ga0501046_0116100_681_1997 | 395 |
| 343 | 3300049581 | Ga0501047_0008295 | Ga0501047_0008295_1437_2753 | 395 |
| 344 | 3300049586 | Ga0501070_0064572 | Ga0501070_0064572_417_1733 | 395 |
| 345 | 3300049823 | Ga0501044_0074996 | Ga0501044_0074996_989_2305 | 395 |
| 346 | 3300035119 | Ga0373956_0052590 | Ga0373956_0052590_421_1794 | 396 |
| 347 | 3300049573 | Ga0501037_0138852 | Ga0501037_0138852_151_1530 | 396 |
| 348 | 3300049744 | Ga0501083_0088236 | Ga0501083_0088236_276_1610 | 396 |
| 349 | 3300009545 | Ga0105237_10071837 | Ga0105237_100718372 | 397 |
| 350 | 3300013105 | Ga0157369_10063571 | Ga0157369_100635712 | 397 |
| 351 | 3300013307 | Ga0157372_10068248 | Ga0157372_100682482 | 397 |
| 352 | 3300022732 | Ga0224569_100686 | Ga0224569_1006862 | 397 |
| 353 | 3300024225 | Ga0224572_1015504 | Ga0224572_10155042 | 397 |
| 354 | 3300024227 | Ga0228598_1004969 | Ga0228598_10049692 | 397 |
| 355 | 3300025914 | Ga0207671_10095971 | Ga0207671_100959712 | 397 |
| 356 | 3300046472 | Ga0495580_0002203 | Ga0495580_0002203_13647_14972 | 397 |
| 357 | 3300046473 | Ga0495582_0000037 | Ga0495582_0000037_27340_28665 | 397 |
| 358 | 3300046683 | Ga0495658_0045540 | Ga0495658_0045540_153_1478 | 397 |
| 359 | 3300047320 | Ga0495672_0006641 | Ga0495672_0006641_7409_8740 | 397 |
| 360 | 3300005344 | Ga0070661_100005290 | Ga0070661_1000052907 | 398 |
| 361 | 3300005445 | Ga0070708_100007053 | Ga0070708_1000070536 | 398 |
| 362 | 3300005457 | Ga0070662_100029007 | Ga0070662_1000290073 | 398 |
| 363 | 3300005536 | Ga0070697_100002429 | Ga0070697_10000242910 | 398 |
| 364 | 3300005578 | Ga0068854_100003468 | Ga0068854_1000034685 | 398 |
| 365 | 3300009174 | Ga0105241_10203189 | Ga0105241_102031892 | 398 |
| 366 | 3300009545 | Ga0105237_10043608 | Ga0105237_100436082 | 398 |
| 367 | 3300013100 | Ga0157373_10019722 | Ga0157373_100197223 | 398 |
| 368 | 3300014968 | Ga0157379_10017280 | Ga0157379_100172801 | 398 |
| 369 | 3300015262 | Ga0182007_10017570 | Ga0182007_100175701 | 398 |
| 370 | 3300015265 | Ga0182005_1009312 | Ga0182005_10093122 | 398 |
| 371 | 3300025914 | Ga0207671_10062329 | Ga0207671_100623292 | 398 |
| 372 | 3300025933 | Ga0207706_10019059 | Ga0207706_100190595 | 398 |
| 373 | 3300039453 | Ga0436362_0802604 | Ga0436362_0802604_1937_3259 | 398 |
| 374 | 3300005518 | Ga0070699_100052341 | Ga0070699_1000523412 | 399 |
| 375 | 3300006871 | Ga0075434_100114649 | Ga0075434_1001146491 | 399 |
| 376 | 3300031344 | Ga0265316_10006270 | Ga0265316_100062706 | 399 |
| 377 | 3300031711 | Ga0265314_10001967 | Ga0265314_1000196716 | 399 |
| 378 | 3300005468 | Ga0070707_100012154 | Ga0070707_1000121543 | 400 |
| 379 | 3300005471 | Ga0070698_100002364 | Ga0070698_10000236410 | 400 |
| 380 | 3300006173 | Ga0070716_100137883 | Ga0070716_1001378831 | 400 |
| 381 | 3300025922 | Ga0207646_10006398 | Ga0207646_100063985 | 400 |
| 382 | 3300025922 | Ga0207646_10024132 | Ga0207646_100241325 | 400 |
| 383 | 3300025939 | Ga0207665_10038127 | Ga0207665_100381272 | 400 |
| 384 | 3300046516 | Ga0495628_0080946 | Ga0495628_0080946_708_2024 | 400 |
| 385 | 3300053085 | Ga0495619_0051410 | Ga0495619_0051410_744_2060 | 400 |
| 386 | 3300014325 | Ga0163163_10181911 | Ga0163163_101819112 | 401 |
| 387 | 3300005841 | Ga0068863_100021909 | Ga0068863_1000219092 | 402 |
| 388 | 3300005843 | Ga0068860_100100622 | Ga0068860_1001006222 | 402 |
| 389 | 3300006028 | Ga0070717_10035030 | Ga0070717_100350302 | 402 |
| 390 | 3300006237 | Ga0097621_100007030 | Ga0097621_1000070302 | 402 |
| 391 | 3300006358 | Ga0068871_100056511 | Ga0068871_1000565113 | 402 |
| 392 | 3300006871 | Ga0075434_100017278 | Ga0075434_1000172785 | 402 |
| 393 | 3300009177 | Ga0105248_10094313 | Ga0105248_100943132 | 402 |
| 394 | 3300013297 | Ga0157378_10088940 | Ga0157378_100889402 | 402 |
| 395 | 3300013308 | Ga0157375_10077221 | Ga0157375_100772212 | 402 |
| 396 | 3300026088 | Ga0207641_10005807 | Ga0207641_100058075 | 402 |
| 397 | 3300028381 | Ga0268264_10116198 | Ga0268264_101161982 | 402 |
| 398 | 3300035691 | Ga0373931_0037872 | Ga0373931_0037872_146_1513 | 402 |
| 399 | 3300037068 | Ga0373925_0166934 | Ga0373925_0166934_113_1450 | 402 |
| 400 | 3300048907 | Ga0496104_0175754 | Ga0496104_0175754_376_1713 | 402 |
| 401 | 3300048910 | Ga0496107_0027564 | Ga0496107_0027564_1076_2413 | 402 |
| 402 | 3300048915 | Ga0496112_0024307 | Ga0496112_0024307_254_1591 | 402 |
| 403 | 3300005335 | Ga0070666_10046981 | Ga0070666_100469812 | 403 |
| 404 | 3300005355 | Ga0070671_100011409 | Ga0070671_1000114095 | 403 |
| 405 | 3300005435 | Ga0070714_100000065 | Ga0070714_10000006543 | 403 |
| 406 | 3300005439 | Ga0070711_100000993 | Ga0070711_1000009936 | 403 |
| 407 | 3300005563 | Ga0068855_100194999 | Ga0068855_1001949992 | 403 |
| 408 | 3300005577 | Ga0068857_100069815 | Ga0068857_1000698152 | 403 |
| 409 | 3300005614 | Ga0068856_100051526 | Ga0068856_1000515263 | 403 |
| 410 | 3300005618 | Ga0068864_100062993 | Ga0068864_1000629933 | 403 |
| 411 | 3300009093 | Ga0105240_10093743 | Ga0105240_100937432 | 403 |
| 412 | 3300010375 | Ga0105239_10027187 | Ga0105239_100271875 | 403 |
| 413 | 3300013296 | Ga0157374_10005486 | Ga0157374_100054868 | 403 |
| 414 | 3300013296 | Ga0157374_10131936 | Ga0157374_101319362 | 403 |
| 415 | 3300013306 | Ga0163162_10001977 | Ga0163162_1000197712 | 403 |
| 416 | 3300013307 | Ga0157372_10011320 | Ga0157372_100113207 | 403 |
| 417 | 3300014325 | Ga0163163_10074330 | Ga0163163_100743304 | 403 |
| 418 | 3300025909 | Ga0207705_10077343 | Ga0207705_100773432 | 403 |
| 419 | 3300025916 | Ga0207663_10005366 | Ga0207663_100053664 | 403 |
| 420 | 3300025919 | Ga0207657_10000099 | Ga0207657_1000009917 | 403 |
| 421 | 3300025929 | Ga0207664_10002011 | Ga0207664_100020116 | 403 |
| 422 | 3300026041 | Ga0207639_10068417 | Ga0207639_100684173 | 403 |
| 423 | 3300028016 | Ga0265354_1000006 | Ga0265354_100000615 | 403 |
| 424 | 3300033547 | Ga0316212_1003812 | Ga0316212_10038122 | 403 |
| 425 | 3300035111 | Ga0373923_0038857 | Ga0373923_0038857_177_1577 | 403 |
| 426 | 3300035118 | Ga0373954_0017165 | Ga0373954_0017165_1803_3203 | 403 |
| 427 | 3300035172 | Ga0373955_0047227 | Ga0373955_0047227_556_1956 | 403 |
| 428 | 3300035724 | Ga0373933_0033811 | Ga0373933_0033811_1094_2494 | 403 |
| 429 | 3300036401 | Ga0373937_0077007 | Ga0373937_0077007_1474_2874 | 403 |
| 430 | 3300048905 | Ga0496102_0045087 | Ga0496102_0045087_1529_2902 | 403 |
| 431 | 3300048911 | Ga0496108_0151033 | Ga0496108_0151033_468_1841 | 403 |
| 432 | 3300048912 | Ga0496109_0015768 | Ga0496109_0015768_4705_6078 | 403 |
| 433 | 3300048915 | Ga0496112_0024519 | Ga0496112_0024519_628_2001 | 403 |
| 434 | 3300005536 | Ga0070697_100076607 | Ga0070697_1000766073 | 404 |
| 435 | 3300005616 | Ga0068852_100069038 | Ga0068852_1000690382 | 404 |
| 436 | 3300035083 | Ga0373926_0013128 | Ga0373926_0013128_240_1634 | 405 |
| 437 | 3300035089 | Ga0373944_0034418 | Ga0373944_0034418_19_1413 | 405 |
| 438 | 3300035116 | Ga0373945_0017731 | Ga0373945_0017731_545_1939 | 405 |
| 439 | 3300035170 | Ga0373943_0006600 | Ga0373943_0006600_3143_4537 | 405 |
| 440 | 3300035692 | Ga0373935_0001385 | Ga0373935_0001385_8148_9542 | 405 |
| 441 | 3300035695 | Ga0373927_0000454 | Ga0373927_0000454_21214_22608 | 405 |
| 442 | 3300035725 | Ga0373947_0019011 | Ga0373947_0019011_1396_2790 | 405 |
| 443 | 3300037068 | Ga0373925_0000782 | Ga0373925_0000782_5254_6648 | 405 |
| 444 | 3300047319 | Ga0495674_0018016 | Ga0495674_0018016_4786_6180 | 405 |
| 445 | 3300005467 | Ga0070706_100003558 | Ga0070706_1000035582 | 407 |
| 446 | 3300005536 | Ga0070697_100000588 | Ga0070697_1000005884 | 407 |
| 447 | 3300025910 | Ga0207684_10029317 | Ga0207684_100293172 | 407 |
| 448 | 3300046472 | Ga0495580_0001272 | Ga0495580_0001272_263_1624 | 407 |
| 449 | 3300046499 | Ga0495594_0072481 | Ga0495594_0072481_510_1871 | 407 |
| 450 | 3300005445 | Ga0070708_100015038 | Ga0070708_1000150381 | 408 |
| 451 | 3300005536 | Ga0070697_100216337 | Ga0070697_1002163371 | 408 |
| 452 | 3300009545 | Ga0105237_10114967 | Ga0105237_101149671 | 408 |
| 453 | 3300005434 | Ga0070709_10067817 | Ga0070709_100678172 | 410 |
| 454 | 3300005439 | Ga0070711_100000147 | Ga0070711_10000014724 | 410 |
| 455 | 3300006173 | Ga0070716_100029718 | Ga0070716_1000297181 | 410 |
| 456 | 3300006175 | Ga0070712_100010578 | Ga0070712_1000105784 | 410 |
| 457 | 3300025906 | Ga0207699_10064331 | Ga0207699_100643312 | 410 |
| 458 | 3300025915 | Ga0207693_10000622 | Ga0207693_1000062224 | 410 |
| 459 | 3300025916 | Ga0207663_10018252 | Ga0207663_100182522 | 410 |
| 460 | 3300025939 | Ga0207665_10004299 | Ga0207665_100042992 | 410 |
| 461 | 3300025939 | Ga0207665_10047290 | Ga0207665_100472903 | 410 |
| 462 | 2162886012 | MBSR1b_contig_1349230 | MBSR1b_0905.00004200 | 424 |
| 463 | 3300002459 | JGI24751J29686_10002143 | JGI24751J29686_100021432 | 424 |
| 464 | 3300005328 | Ga0070676_10007530 | Ga0070676_100075304 | 424 |
| 465 | 3300005329 | Ga0070683_100052169 | Ga0070683_1000521692 | 424 |
| 466 | 3300005330 | Ga0070690_100011035 | Ga0070690_1000110354 | 424 |
| 467 | 3300005331 | Ga0070670_100024963 | Ga0070670_1000249632 | 424 |
| 468 | 3300005334 | Ga0068869_100033514 | Ga0068869_1000335143 | 424 |
| 469 | 3300005337 | Ga0070682_100009656 | Ga0070682_1000096564 | 424 |
| 470 | 3300005338 | Ga0068868_100003343 | Ga0068868_1000033432 | 424 |
| 471 | 3300005339 | Ga0070660_100002962 | Ga0070660_10000296211 | 424 |
| 472 | 3300005340 | Ga0070689_100018311 | Ga0070689_1000183114 | 424 |
| 473 | 3300005344 | Ga0070661_100010092 | Ga0070661_1000100922 | 424 |
| 474 | 3300005347 | Ga0070668_100024596 | Ga0070668_1000245962 | 424 |
| 475 | 3300005354 | Ga0070675_100009782 | Ga0070675_1000097822 | 424 |
| 476 | 3300005355 | Ga0070671_100037185 | Ga0070671_1000371852 | 424 |
| 477 | 3300005356 | Ga0070674_100040965 | Ga0070674_1000409653 | 424 |
| 478 | 3300005364 | Ga0070673_100034314 | Ga0070673_1000343142 | 424 |
| 479 | 3300005365 | Ga0070688_100001836 | Ga0070688_1000018367 | 424 |
| 480 | 3300005366 | Ga0070659_100011244 | Ga0070659_1000112444 | 424 |
| 481 | 3300005455 | Ga0070663_100020212 | Ga0070663_1000202123 | 424 |
| 482 | 3300005456 | Ga0070678_100118948 | Ga0070678_1001189482 | 424 |
| 483 | 3300005457 | Ga0070662_100021721 | Ga0070662_1000217213 | 424 |
| 484 | 3300005459 | Ga0068867_100006702 | Ga0068867_1000067027 | 424 |
| 485 | 3300005466 | Ga0070685_10001249 | Ga0070685_100012493 | 424 |
| 486 | 3300005535 | Ga0070684_100001539 | Ga0070684_10000153914 | 424 |
| 487 | 3300005539 | Ga0068853_100007078 | Ga0068853_1000070783 | 424 |
| 488 | 3300005543 | Ga0070672_100020496 | Ga0070672_1000204962 | 424 |
| 489 | 3300005544 | Ga0070686_100005627 | Ga0070686_1000056276 | 424 |
| 490 | 3300005563 | Ga0068855_100026524 | Ga0068855_1000265244 | 424 |
| 491 | 3300005564 | Ga0070664_100028916 | Ga0070664_1000289164 | 424 |
| 492 | 3300005577 | Ga0068857_100000800 | Ga0068857_10000080012 | 424 |
| 493 | 3300005615 | Ga0070702_100020911 | Ga0070702_1000209113 | 424 |
| 494 | 3300005617 | Ga0068859_100063424 | Ga0068859_1000634243 | 424 |
| 495 | 3300005718 | Ga0068866_10008235 | Ga0068866_100082353 | 424 |
| 496 | 3300005834 | Ga0068851_10003518 | Ga0068851_100035182 | 424 |
| 497 | 3300005840 | Ga0068870_10001324 | Ga0068870_100013247 | 424 |
| 498 | 3300005843 | Ga0068860_100089343 | Ga0068860_1000893431 | 424 |
| 499 | 3300006881 | Ga0068865_100004978 | Ga0068865_1000049786 | 424 |
| 500 | 3300006931 | Ga0097620_100063422 | Ga0097620_1000634223 | 424 |
| 501 | 3300009092 | Ga0105250_10028418 | Ga0105250_100284182 | 424 |
| 502 | 3300009098 | Ga0105245_10079965 | Ga0105245_100799652 | 424 |
| 503 | 3300009101 | Ga0105247_10026787 | Ga0105247_100267873 | 424 |
| 504 | 3300009174 | Ga0105241_10003060 | Ga0105241_1000306010 | 424 |
| 505 | 3300009176 | Ga0105242_10040558 | Ga0105242_100405583 | 424 |
| 506 | 3300009553 | Ga0105249_10051734 | Ga0105249_100517343 | 424 |
| 507 | 3300011119 | Ga0105246_10000585 | Ga0105246_100005854 | 424 |
| 508 | 3300013100 | Ga0157373_10020397 | Ga0157373_100203972 | 424 |
| 509 | 3300013102 | Ga0157371_10013614 | Ga0157371_100136142 | 424 |
| 510 | 3300013105 | Ga0157369_10060300 | Ga0157369_100603002 | 424 |
| 511 | 3300013307 | Ga0157372_10039068 | Ga0157372_100390683 | 424 |
| 512 | 3300013308 | Ga0157375_10049829 | Ga0157375_100498293 | 424 |
| 513 | 3300014325 | Ga0163163_10008924 | Ga0163163_100089242 | 424 |
| 514 | 3300014326 | Ga0157380_10049777 | Ga0157380_100497772 | 424 |
| 515 | 3300014745 | Ga0157377_10001704 | Ga0157377_100017044 | 424 |
| 516 | 3300014968 | Ga0157379_10007611 | Ga0157379_100076113 | 424 |
| 517 | 3300014969 | Ga0157376_10008453 | Ga0157376_100084532 | 424 |
| 518 | 3300017792 | Ga0163161_10007365 | Ga0163161_100073653 | 424 |
| 519 | 3300025315 | Ga0207697_10025715 | Ga0207697_100257152 | 424 |
| 520 | 3300025321 | Ga0207656_10014357 | Ga0207656_100143572 | 424 |
| 521 | 3300025901 | Ga0207688_10014005 | Ga0207688_100140053 | 424 |
| 522 | 3300025903 | Ga0207680_10022506 | Ga0207680_100225063 | 424 |
| 523 | 3300025904 | Ga0207647_10000730 | Ga0207647_1000073017 | 424 |
| 524 | 3300025907 | Ga0207645_10001142 | Ga0207645_1000114211 | 424 |
| 525 | 3300025908 | Ga0207643_10000478 | Ga0207643_1000047810 | 424 |
| 526 | 3300025919 | Ga0207657_10000898 | Ga0207657_1000089821 | 424 |
| 527 | 3300025920 | Ga0207649_10007529 | Ga0207649_100075294 | 424 |
| 528 | 3300025925 | Ga0207650_10000053 | Ga0207650_10000053123 | 424 |
| 529 | 3300025931 | Ga0207644_10004065 | Ga0207644_100040653 | 424 |
| 530 | 3300025932 | Ga0207690_10076253 | Ga0207690_100762532 | 424 |
| 531 | 3300025940 | Ga0207691_10003378 | Ga0207691_100033788 | 424 |
| 532 | 3300025942 | Ga0207689_10007355 | Ga0207689_100073553 | 424 |
| 533 | 3300025944 | Ga0207661_10000435 | Ga0207661_1000043512 | 424 |
| 534 | 3300025945 | Ga0207679_10000140 | Ga0207679_100001409 | 424 |
| 535 | 3300025961 | Ga0207712_10028640 | Ga0207712_100286402 | 424 |
| 536 | 3300025981 | Ga0207640_10075066 | Ga0207640_100750661 | 424 |
| 537 | 3300026041 | Ga0207639_10033851 | Ga0207639_100338512 | 424 |
| 538 | 3300026088 | Ga0207641_10000321 | Ga0207641_1000032122 | 424 |
| 539 | 3300026089 | Ga0207648_10000314 | Ga0207648_1000031415 | 424 |
| 540 | 3300026095 | Ga0207676_10004705 | Ga0207676_100047054 | 424 |
| 541 | 3300026116 | Ga0207674_10000092 | Ga0207674_1000009217 | 424 |
| 542 | 3300026118 | Ga0207675_100017704 | Ga0207675_1000177042 | 424 |
| 543 | 3300026121 | Ga0207683_10007677 | Ga0207683_100076778 | 424 |
| 544 | 3300028380 | Ga0268265_10002752 | Ga0268265_1000275212 | 424 |
| 545 | 3300028381 | Ga0268264_10035224 | Ga0268264_100352242 | 424 |
| 546 | 3300048903 | Ga0496100_0100597 | Ga0496100_0100597_521_1900 | 424 |
| 547 | 3300048909 | Ga0496106_0046511 | Ga0496106_0046511_522_1901 | 424 |
| 548 | 3300048911 | Ga0496108_0007454 | Ga0496108_0007454_6083_7462 | 424 |
| 549 | 3300048915 | Ga0496112_0000146 | Ga0496112_0000146_15203_16582 | 424 |
| 550 | 3300048916 | Ga0496113_0049688 | Ga0496113_0049688_1390_2769 | 424 |
| 551 | 3300048918 | Ga0496115_0028763 | Ga0496115_0028763_93_1472 | 424 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7t3n-assembly1.cif.gz_A | r184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2) | 0.8467 | 7 | 398 |
| 6e9o-assembly1.cif.gz_B | e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form | 0.8299 | 5 | 384 |
| 6e9o-assembly2.cif.gz_A | e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form | 0.8207 | 5 | 384 |
| 6e9o-assembly2.cif.gz_A | e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form | 0.7933 | 5 | 384 |
| 7t3n-assembly1.cif.gz_A | r184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2) | 0.7856 | 7 | 398 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVB9_1_200_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9719 | 1 | 204 | 1.20.1250.20 |
| af_P0AA76_9_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9665 | 5 | 205 | 1.20.1250.20 |
| af_P0AA78_1_199_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9632 | 7 | 206 | 1.20.1250.20 |
| af_Q2FVB9_1_200_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9576 | 1 | 204 | 1.20.1250.20 |
| af_P0AA76_9_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9569 | 5 | 205 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F5S8P2-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9063 | 6 | 192 |
GO:0005886
GO:0046943 |
| AF-A0A662YSL9-F1-model_v4 | Synaptic vesicular amine transporter | 0.9059 | 46 | 185 |
GO:0005335
GO:0015842 GO:0030672 GO:0042910 GO:0043195 |
| AF-H1UZ85-F1-model_v4 | MFS transporter | 0.9003 | 13 | 225 |
GO:0016020
GO:0022857 |
| AF-A0A6B2LKJ1-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.8978 | 25 | 196 |
GO:0005886
GO:0022857 |
| AF-A0A842YDF2-F1-model_v4 | MFS transporter | 0.8781 | 9 | 193 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar