F462523
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 550 | 260 | 1100 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_0706655|Ga0436362_0706655_664_1635 |
| Length | 323 |
| Sequence | MRSQGKLVSSTTLVIAGWLLVASFGAEAPRRKFSLQALNGQFWDLVDRNAELSAVAGGFGFTEGPVWDDGGFLFVSDETLNKIFRVELNGNRQEVISLGDPDGNTYDRRHRLIDCASVLRAIIEVSREGKYKVLADHFQGQRFNSPNDIIVGPDGAFYFTDPTLDLPRGEKQEIAFQGVYRLDASGTVTLLTKDLSQPNGLAFSPDGRRFYVDDSEQRNIRVYDFGDGRLTNSRIFGAEPGGKNEGVPDGMKVDTAGHLFVTGPGGIWVWDSQGHHLGTVVVPEQPANLTWGDKDRGTLYLTATTSVYKLRTRVHGFVPYEAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 113 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 114 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 115 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 116 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 167 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.91 |
| Metatranscriptomes | 1.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.18 |
| Rhizosphere | 95.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436362_0706655 | 3300039453 | Bacteria | 2706 |
| 2 | MBSR1b_contig_198788 | 2162886012 | Unclassified | 2160 |
| 3 | JGI24743J22301_10001705 | 3300001991 | Bacteria | 3134 |
| 4 | JGI24751J29686_10000730 | 3300002459 | Bacteria | 7950 |
| 5 | rootH1_10163171 | 3300003323 | Bacteria | 1293 |
| 6 | Ga0065715_10002528 | 3300005293 | Bacteria | 7499 |
| 7 | Ga0065715_10124125 | 3300005293 | Bacteria | 2148 |
| 8 | Ga0070658_10019460 | 3300005327 | Bacteria | 5436 |
| 9 | Ga0070676_10015547 | 3300005328 | Bacteria | 4199 |
| 10 | Ga0070683_100008552 | 3300005329 | Bacteria | 8699 |
| 11 | Ga0070683_100017349 | 3300005329 | Bacteria | 6364 |
| 12 | Ga0070690_100005294 | 3300005330 | Bacteria | 7235 |
| 13 | Ga0070670_100002259 | 3300005331 | Bacteria | 15845 |
| 14 | Ga0070670_100004434 | 3300005331 | Bacteria | 11760 |
| 15 | Ga0070670_100155317 | 3300005331 | Bacteria | 1981 |
| 16 | Ga0068869_100003323 | 3300005334 | Bacteria | 9824 |
| 17 | Ga0068869_100247125 | 3300005334 | Unclassified | 1424 |
| 18 | Ga0070666_10061569 | 3300005335 | Unclassified | 2541 |
| 19 | Ga0070680_100062652 | 3300005336 | Bacteria | 3046 |
| 20 | Ga0070680_100128328 | 3300005336 | Unclassified | 2120 |
| 21 | Ga0070680_100210445 | 3300005336 | Bacteria | 1640 |
| 22 | Ga0070682_100021547 | 3300005337 | Unclassified | 3805 |
| 23 | Ga0070682_100041559 | 3300005337 | Bacteria | 2835 |
| 24 | Ga0068868_100003343 | 3300005338 | Bacteria | 11162 |
| 25 | Ga0068868_100015773 | 3300005338 | Bacteria | 5596 |
| 26 | Ga0070660_100002962 | 3300005339 | Bacteria | 11680 |
| 27 | Ga0070660_100149176 | 3300005339 | Bacteria | 1879 |
| 28 | Ga0070689_100014194 | 3300005340 | Bacteria | 5781 |
| 29 | Ga0070661_100007288 | 3300005344 | Bacteria | 7628 |
| 30 | Ga0070661_100244208 | 3300005344 | Bacteria | 1383 |
| 31 | Ga0070692_10094475 | 3300005345 | Unclassified | 1630 |
| 32 | Ga0070668_100003732 | 3300005347 | Bacteria | 11232 |
| 33 | Ga0070669_100003465 | 3300005353 | Bacteria | 11378 |
| 34 | Ga0070675_100024970 | 3300005354 | Bacteria | 4790 |
| 35 | Ga0070671_100154446 | 3300005355 | Bacteria | 1939 |
| 36 | Ga0070674_100003703 | 3300005356 | Bacteria | 8613 |
| 37 | Ga0070673_100072904 | 3300005364 | Unclassified | 2763 |
| 38 | Ga0070673_100089922 | 3300005364 | Unclassified | 2507 |
| 39 | Ga0070688_100029640 | 3300005365 | Unclassified | 3278 |
| 40 | Ga0070688_100110907 | 3300005365 | Unclassified | 1824 |
| 41 | Ga0070659_100016495 | 3300005366 | Bacteria | 5546 |
| 42 | Ga0070659_100053587 | 3300005366 | Bacteria | 3175 |
| 43 | Ga0070667_100151808 | 3300005367 | Bacteria | 2035 |
| 44 | Ga0070709_10000332 | 3300005434 | Bacteria | 29688 |
| 45 | Ga0070709_10021144 | 3300005434 | Bacteria | 3787 |
| 46 | Ga0070709_10044441 | 3300005434 | Bacteria | 2751 |
| 47 | Ga0070709_10077259 | 3300005434 | Bacteria | 2164 |
| 48 | Ga0070709_10111169 | 3300005434 | Bacteria | 1842 |
| 49 | Ga0070709_10172840 | 3300005434 | Bacteria | 1511 |
| 50 | Ga0070714_100007629 | 3300005435 | Bacteria | 8423 |
| 51 | Ga0070714_100028497 | 3300005435 | Bacteria | 4634 |
| 52 | Ga0070714_100063507 | 3300005435 | Bacteria | 3176 |
| 53 | Ga0070714_100078772 | 3300005435 | Unclassified | 2864 |
| 54 | Ga0070714_100079321 | 3300005435 | Bacteria | 2854 |
| 55 | Ga0070714_100181331 | 3300005435 | Bacteria | 1916 |
| 56 | Ga0070714_100374922 | 3300005435 | Unclassified | 1340 |
| 57 | Ga0070714_100445340 | 3300005435 | Unclassified | 1230 |
| 58 | Ga0070713_100000413 | 3300005436 | Bacteria | 27428 |
| 59 | Ga0070713_100000856 | 3300005436 | Bacteria | 19501 |
| 60 | Ga0070713_100003904 | 3300005436 | Bacteria | 9888 |
| 61 | Ga0070713_100013225 | 3300005436 | Bacteria | 6084 |
| 62 | Ga0070713_100014487 | 3300005436 | Bacteria | 5859 |
| 63 | Ga0070713_100016807 | 3300005436 | Bacteria | 5510 |
| 64 | Ga0070713_100019696 | 3300005436 | Bacteria | 5159 |
| 65 | Ga0070713_100027631 | 3300005436 | Bacteria | 4468 |
| 66 | Ga0070713_100032299 | 3300005436 | Unclassified | 4179 |
| 67 | Ga0070713_100082071 | 3300005436 | Bacteria | 2752 |
| 68 | Ga0070713_100126386 | 3300005436 | Bacteria | 2250 |
| 69 | Ga0070713_100153681 | 3300005436 | Unclassified | 2049 |
| 70 | Ga0070710_10005162 | 3300005437 | Bacteria | 6182 |
| 71 | Ga0070710_10010243 | 3300005437 | Unclassified | 4602 |
| 72 | Ga0070711_100000078 | 3300005439 | Bacteria | 54188 |
| 73 | Ga0070711_100003687 | 3300005439 | Bacteria | 8968 |
| 74 | Ga0070711_100006008 | 3300005439 | Bacteria | 7289 |
| 75 | Ga0070711_100010342 | 3300005439 | Bacteria | 5774 |
| 76 | Ga0070711_100012647 | 3300005439 | Bacteria | 5279 |
| 77 | Ga0070711_100032316 | 3300005439 | Unclassified | 3479 |
| 78 | Ga0070711_100077508 | 3300005439 | Bacteria | 2359 |
| 79 | Ga0070705_100051494 | 3300005440 | Unclassified | 2401 |
| 80 | Ga0070708_100006920 | 3300005445 | Bacteria | 9048 |
| 81 | Ga0070708_100008359 | 3300005445 | Bacteria | 8313 |
| 82 | Ga0070708_100014583 | 3300005445 | Bacteria | 6474 |
| 83 | Ga0070708_100026239 | 3300005445 | Unclassified | 4986 |
| 84 | Ga0070708_100032717 | 3300005445 | Bacteria | 4513 |
| 85 | Ga0070708_100353887 | 3300005445 | Bacteria | 1384 |
| 86 | Ga0070663_100014501 | 3300005455 | Bacteria | 5061 |
| 87 | Ga0070678_100012773 | 3300005456 | Bacteria | 5237 |
| 88 | Ga0070662_100088230 | 3300005457 | Unclassified | 2324 |
| 89 | Ga0070662_100154185 | 3300005457 | Bacteria | 1791 |
| 90 | Ga0070662_100349614 | 3300005457 | Unclassified | 1211 |
| 91 | Ga0070681_10020134 | 3300005458 | Bacteria | 6687 |
| 92 | Ga0070681_10198003 | 3300005458 | Bacteria | 1927 |
| 93 | Ga0070681_10498435 | 3300005458 | Unclassified | 1131 |
| 94 | Ga0068867_100002029 | 3300005459 | Bacteria | 14153 |
| 95 | Ga0068867_100047569 | 3300005459 | Unclassified | 3153 |
| 96 | Ga0070685_10001249 | 3300005466 | Bacteria | 13488 |
| 97 | Ga0070706_100017391 | 3300005467 | Bacteria | 6635 |
| 98 | Ga0070706_100108220 | 3300005467 | Bacteria | 2586 |
| 99 | Ga0070706_100243463 | 3300005467 | Bacteria | 1679 |
| 100 | Ga0070707_100006178 | 3300005468 | Bacteria | 11156 |
| 101 | Ga0070707_100156439 | 3300005468 | Bacteria | 2220 |
| 102 | Ga0070698_100000393 | 3300005471 | Bacteria | 46076 |
| 103 | Ga0070698_100012185 | 3300005471 | Bacteria | 9109 |
| 104 | Ga0070698_100019408 | 3300005471 | Bacteria | 7138 |
| 105 | Ga0070698_100032677 | 3300005471 | Bacteria | 5389 |
| 106 | Ga0070698_100447084 | 3300005471 | Unclassified | 1228 |
| 107 | Ga0070699_100006077 | 3300005518 | Bacteria | 10561 |
| 108 | Ga0070699_100015770 | 3300005518 | Bacteria | 6487 |
| 109 | Ga0070699_100049624 | 3300005518 | Unclassified | 3633 |
| 110 | Ga0070699_100088575 | 3300005518 | Bacteria | 2703 |
| 111 | Ga0070699_100099883 | 3300005518 | Bacteria | 2543 |
| 112 | Ga0070679_100087909 | 3300005530 | Bacteria | 3095 |
| 113 | Ga0070679_100451906 | 3300005530 | Unclassified | 1229 |
| 114 | Ga0070684_100001539 | 3300005535 | Bacteria | 16657 |
| 115 | Ga0070684_100044884 | 3300005535 | Unclassified | 3825 |
| 116 | Ga0070684_100160541 | 3300005535 | Unclassified | 2039 |
| 117 | Ga0070697_100002338 | 3300005536 | Bacteria | 14586 |
| 118 | Ga0070697_100005485 | 3300005536 | Bacteria | 9779 |
| 119 | Ga0070697_100008836 | 3300005536 | Bacteria | 7861 |
| 120 | Ga0070697_100024201 | 3300005536 | Bacteria | 4834 |
| 121 | Ga0070697_100105456 | 3300005536 | Bacteria | 2345 |
| 122 | Ga0070697_100232539 | 3300005536 | Bacteria | 1572 |
| 123 | Ga0068853_100057133 | 3300005539 | Bacteria | 3366 |
| 124 | Ga0068853_100085605 | 3300005539 | Unclassified | 2763 |
| 125 | Ga0070672_100012577 | 3300005543 | Bacteria | 5950 |
| 126 | Ga0070686_100025538 | 3300005544 | Bacteria | 3556 |
| 127 | Ga0070693_100052351 | 3300005547 | Bacteria | 2340 |
| 128 | Ga0068855_100036494 | 3300005563 | Bacteria | 5850 |
| 129 | Ga0068855_100070153 | 3300005563 | Unclassified | 4078 |
| 130 | Ga0068855_100077852 | 3300005563 | Bacteria | 3848 |
| 131 | Ga0068855_100087633 | 3300005563 | Bacteria | 3597 |
| 132 | Ga0068855_100312788 | 3300005563 | Bacteria | 1737 |
| 133 | Ga0070664_100000218 | 3300005564 | Bacteria | 40952 |
| 134 | Ga0070664_100017087 | 3300005564 | Bacteria | 5954 |
| 135 | Ga0068857_100000431 | 3300005577 | Bacteria | 29696 |
| 136 | Ga0068857_100000800 | 3300005577 | Bacteria | 23516 |
| 137 | Ga0068854_100004840 | 3300005578 | Bacteria | 8495 |
| 138 | Ga0068854_100012470 | 3300005578 | Bacteria | 5568 |
| 139 | Ga0068854_100061175 | 3300005578 | Unclassified | 2726 |
| 140 | Ga0068856_100001284 | 3300005614 | Bacteria | 26414 |
| 141 | Ga0068856_100004471 | 3300005614 | Bacteria | 13911 |
| 142 | Ga0068856_100012139 | 3300005614 | Bacteria | 8343 |
| 143 | Ga0068856_100013830 | 3300005614 | Bacteria | 7802 |
| 144 | Ga0068856_100039129 | 3300005614 | Bacteria | 4656 |
| 145 | Ga0068856_100162921 | 3300005614 | Bacteria | 2241 |
| 146 | Ga0070702_100158605 | 3300005615 | Bacteria | 1460 |
| 147 | Ga0068852_100002212 | 3300005616 | Bacteria | 13348 |
| 148 | Ga0068852_100147358 | 3300005616 | Unclassified | 2185 |
| 149 | Ga0068859_100002285 | 3300005617 | Bacteria | 19458 |
| 150 | Ga0068859_100030222 | 3300005617 | Bacteria | 5436 |
| 151 | Ga0068864_100001216 | 3300005618 | Bacteria | 21390 |
| 152 | Ga0068864_100009864 | 3300005618 | Bacteria | 7876 |
| 153 | Ga0068864_100017546 | 3300005618 | Bacteria | 5968 |
| 154 | Ga0068864_100222805 | 3300005618 | Bacteria | 1741 |
| 155 | Ga0068866_10002220 | 3300005718 | Bacteria | 8060 |
| 156 | Ga0068866_10023516 | 3300005718 | Unclassified | 2868 |
| 157 | Ga0068861_100027330 | 3300005719 | Bacteria | 4154 |
| 158 | Ga0068851_10014432 | 3300005834 | Bacteria | 3750 |
| 159 | Ga0068851_10103691 | 3300005834 | Unclassified | 1511 |
| 160 | Ga0068870_10021423 | 3300005840 | Unclassified | 3161 |
| 161 | Ga0068870_10239734 | 3300005840 | Unclassified | 1119 |
| 162 | Ga0068863_100158377 | 3300005841 | Unclassified | 2168 |
| 163 | Ga0068863_100351901 | 3300005841 | Unclassified | 1435 |
| 164 | Ga0068858_100018863 | 3300005842 | Bacteria | 6455 |
| 165 | Ga0068858_100064451 | 3300005842 | Unclassified | 3391 |
| 166 | Ga0068858_100089197 | 3300005842 | Bacteria | 2869 |
| 167 | Ga0068860_100015643 | 3300005843 | Bacteria | 7408 |
| 168 | Ga0068860_100067531 | 3300005843 | Unclassified | 3397 |
| 169 | Ga0068860_100154992 | 3300005843 | Unclassified | 2207 |
| 170 | Ga0068862_100007335 | 3300005844 | Bacteria | 9158 |
| 171 | Ga0081540_1020926 | 3300005983 | Bacteria | 3916 |
| 172 | Ga0070717_10000556 | 3300006028 | Bacteria | 23693 |
| 173 | Ga0070717_10000812 | 3300006028 | Bacteria | 20547 |
| 174 | Ga0070717_10001835 | 3300006028 | Bacteria | 14838 |
| 175 | Ga0070717_10005111 | 3300006028 | Bacteria | 9569 |
| 176 | Ga0070717_10005939 | 3300006028 | Bacteria | 8940 |
| 177 | Ga0070717_10034645 | 3300006028 | Unclassified | 4083 |
| 178 | Ga0070717_10044430 | 3300006028 | Bacteria | 3627 |
| 179 | Ga0070717_10171064 | 3300006028 | Bacteria | 1890 |
| 180 | Ga0070715_10049675 | 3300006163 | Unclassified | 1798 |
| 181 | Ga0070716_100000248 | 3300006173 | Bacteria | 21595 |
| 182 | Ga0070716_100002380 | 3300006173 | Bacteria | 8663 |
| 183 | Ga0070716_100003139 | 3300006173 | Bacteria | 7725 |
| 184 | Ga0070716_100009693 | 3300006173 | Unclassified | 4807 |
| 185 | Ga0070716_100015760 | 3300006173 | Bacteria | 3889 |
| 186 | Ga0070716_100018643 | 3300006173 | Bacteria | 3618 |
| 187 | Ga0070716_100156967 | 3300006173 | Unclassified | 1470 |
| 188 | Ga0070712_100000228 | 3300006175 | Bacteria | 31570 |
| 189 | Ga0070712_100000445 | 3300006175 | Bacteria | 23661 |
| 190 | Ga0070712_100007130 | 3300006175 | Bacteria | 6973 |
| 191 | Ga0070712_100007823 | 3300006175 | Bacteria | 6693 |
| 192 | Ga0070712_100015386 | 3300006175 | Unclassified | 4926 |
| 193 | Ga0070712_100020180 | 3300006175 | Unclassified | 4358 |
| 194 | Ga0070712_100037368 | 3300006175 | Bacteria | 3310 |
| 195 | Ga0070712_100042320 | 3300006175 | Bacteria | 3132 |
| 196 | Ga0070712_100181154 | 3300006175 | Unclassified | 1642 |
| 197 | Ga0070712_100187728 | 3300006175 | Bacteria | 1615 |
| 198 | Ga0097621_100001711 | 3300006237 | Bacteria | 14997 |
| 199 | Ga0097621_100125457 | 3300006237 | Unclassified | 2180 |
| 200 | Ga0068871_100000439 | 3300006358 | Bacteria | 28672 |
| 201 | Ga0068871_100012445 | 3300006358 | Bacteria | 6273 |
| 202 | Ga0068871_100014011 | 3300006358 | Bacteria | 5966 |
| 203 | Ga0068871_100021872 | 3300006358 | Unclassified | 4923 |
| 204 | Ga0068865_100010160 | 3300006881 | Bacteria | 5851 |
| 205 | Ga0068865_100028681 | 3300006881 | Unclassified | 3686 |
| 206 | Ga0068865_100052026 | 3300006881 | Unclassified | 2837 |
| 207 | Ga0075436_100001541 | 3300006914 | Bacteria | 15748 |
| 208 | Ga0075436_100054406 | 3300006914 | Bacteria | 2763 |
| 209 | Ga0097620_100002285 | 3300006931 | Bacteria | 19458 |
| 210 | Ga0097620_100030219 | 3300006931 | Bacteria | 5436 |
| 211 | Ga0075435_100024148 | 3300007076 | Bacteria | 4713 |
| 212 | Ga0099794_10068555 | 3300007265 | Bacteria | 1734 |
| 213 | Ga0105240_10112609 | 3300009093 | Unclassified | 3289 |
| 214 | Ga0105240_10124491 | 3300009093 | Bacteria | 3100 |
| 215 | Ga0105240_10157491 | 3300009093 | Bacteria | 2700 |
| 216 | Ga0105240_10197981 | 3300009093 | Bacteria | 2357 |
| 217 | Ga0105245_10004868 | 3300009098 | Bacteria | 11824 |
| 218 | Ga0105245_10009843 | 3300009098 | Bacteria | 8328 |
| 219 | Ga0105245_10292300 | 3300009098 | Unclassified | 1596 |
| 220 | Ga0105247_10004580 | 3300009101 | Bacteria | 8809 |
| 221 | Ga0105241_10008981 | 3300009174 | Bacteria | 7350 |
| 222 | Ga0105241_10019246 | 3300009174 | Bacteria | 5034 |
| 223 | Ga0105241_10038309 | 3300009174 | Unclassified | 3613 |
| 224 | Ga0105241_10172421 | 3300009174 | Unclassified | 1788 |
| 225 | Ga0105242_10005129 | 3300009176 | Bacteria | 10100 |
| 226 | Ga0105242_10021399 | 3300009176 | Bacteria | 5078 |
| 227 | Ga0105242_10137023 | 3300009176 | Unclassified | 2120 |
| 228 | Ga0105248_10022863 | 3300009177 | Bacteria | 6942 |
| 229 | Ga0105248_10109158 | 3300009177 | Bacteria | 3119 |
| 230 | Ga0105237_10089345 | 3300009545 | Bacteria | 3071 |
| 231 | Ga0105238_10075170 | 3300009551 | Bacteria | 3370 |
| 232 | Ga0105249_10019153 | 3300009553 | Bacteria | 6103 |
| 233 | Ga0105239_10028640 | 3300010375 | Bacteria | 6124 |
| 234 | Ga0105239_10158488 | 3300010375 | Bacteria | 2528 |
| 235 | Ga0105246_10000585 | 3300011119 | Bacteria | 20210 |
| 236 | Ga0157373_10008159 | 3300013100 | Bacteria | 7785 |
| 237 | Ga0157373_10041842 | 3300013100 | Unclassified | 3277 |
| 238 | Ga0157371_10045196 | 3300013102 | Unclassified | 3135 |
| 239 | Ga0157370_10089812 | 3300013104 | Bacteria | 2886 |
| 240 | Ga0157369_10017943 | 3300013105 | Bacteria | 7945 |
| 241 | Ga0157369_10149348 | 3300013105 | Unclassified | 2470 |
| 242 | Ga0157369_10256121 | 3300013105 | Bacteria | 1826 |
| 243 | Ga0157374_10000586 | 3300013296 | Bacteria | 32231 |
| 244 | Ga0157374_10002176 | 3300013296 | Bacteria | 16513 |
| 245 | Ga0157374_10190297 | 3300013296 | Bacteria | 2007 |
| 246 | Ga0157378_10000132 | 3300013297 | Bacteria | 71918 |
| 247 | Ga0157378_10000263 | 3300013297 | Bacteria | 51475 |
| 248 | Ga0157378_10000884 | 3300013297 | Bacteria | 27646 |
| 249 | Ga0157378_10035909 | 3300013297 | Bacteria | 4386 |
| 250 | Ga0157378_10184298 | 3300013297 | Unclassified | 1965 |
| 251 | Ga0163162_10179638 | 3300013306 | Bacteria | 2242 |
| 252 | Ga0157372_10002303 | 3300013307 | Bacteria | 20713 |
| 253 | Ga0157372_10005490 | 3300013307 | Bacteria | 13473 |
| 254 | Ga0157372_10008009 | 3300013307 | Bacteria | 11240 |
| 255 | Ga0157372_10012747 | 3300013307 | Bacteria | 8956 |
| 256 | Ga0157372_10014642 | 3300013307 | Bacteria | 8391 |
| 257 | Ga0157372_10019641 | 3300013307 | Bacteria | 7283 |
| 258 | Ga0157372_10028406 | 3300013307 | Bacteria | 6103 |
| 259 | Ga0157372_10058069 | 3300013307 | Unclassified | 4325 |
| 260 | Ga0157372_10151868 | 3300013307 | Bacteria | 2674 |
| 261 | Ga0157372_10237220 | 3300013307 | Bacteria | 2115 |
| 262 | Ga0157372_10492722 | 3300013307 | Unclassified | 1429 |
| 263 | Ga0157375_10203521 | 3300013308 | Unclassified | 2136 |
| 264 | Ga0163163_10144783 | 3300014325 | Bacteria | 2419 |
| 265 | Ga0157380_10086854 | 3300014326 | Unclassified | 2571 |
| 266 | Ga0182008_10011904 | 3300014497 | Bacteria | 4610 |
| 267 | Ga0157379_10099728 | 3300014968 | Unclassified | 2607 |
| 268 | Ga0157376_10028892 | 3300014969 | Bacteria | 4413 |
| 269 | Ga0157376_10147923 | 3300014969 | Unclassified | 2115 |
| 270 | Ga0182006_1032432 | 3300015261 | Bacteria | 2099 |
| 271 | Ga0182007_10005818 | 3300015262 | Bacteria | 5361 |
| 272 | Ga0182005_1007697 | 3300015265 | Bacteria | 3217 |
| 273 | Ga0163161_10023114 | 3300017792 | Bacteria | 4381 |
| 274 | Ga0224570_100098 | 3300022730 | Bacteria | 5234 |
| 275 | Ga0224569_100189 | 3300022732 | Bacteria | 4967 |
| 276 | Ga0224569_103027 | 3300022732 | Unclassified | 1332 |
| 277 | Ga0224571_100095 | 3300022734 | Bacteria | 3425 |
| 278 | Ga0224572_1004229 | 3300024225 | Unclassified | 2484 |
| 279 | Ga0228598_1000259 | 3300024227 | Bacteria | 10151 |
| 280 | Ga0228598_1013631 | 3300024227 | Unclassified | 1610 |
| 281 | Ga0207697_10024700 | 3300025315 | Unclassified | 2459 |
| 282 | Ga0207656_10033792 | 3300025321 | Unclassified | 2132 |
| 283 | Ga0207692_10004401 | 3300025898 | Bacteria | 5574 |
| 284 | Ga0207642_10009650 | 3300025899 | Unclassified | 3367 |
| 285 | Ga0207710_10100404 | 3300025900 | Bacteria | 1364 |
| 286 | Ga0207688_10002375 | 3300025901 | Bacteria | 10134 |
| 287 | Ga0207647_10000730 | 3300025904 | Bacteria | 25805 |
| 288 | Ga0207647_10017772 | 3300025904 | Unclassified | 4827 |
| 289 | Ga0207685_10033426 | 3300025905 | Unclassified | 1858 |
| 290 | Ga0207699_10001156 | 3300025906 | Bacteria | 12472 |
| 291 | Ga0207699_10012078 | 3300025906 | Unclassified | 4385 |
| 292 | Ga0207699_10025506 | 3300025906 | Unclassified | 3246 |
| 293 | Ga0207699_10040887 | 3300025906 | Unclassified | 2674 |
| 294 | Ga0207699_10058507 | 3300025906 | Bacteria | 2306 |
| 295 | Ga0207699_10094964 | 3300025906 | Bacteria | 1879 |
| 296 | Ga0207699_10123240 | 3300025906 | Unclassified | 1680 |
| 297 | Ga0207699_10158980 | 3300025906 | Bacteria | 1502 |
| 298 | Ga0207699_10205427 | 3300025906 | Unclassified | 1337 |
| 299 | Ga0207645_10001142 | 3300025907 | Bacteria | 21910 |
| 300 | Ga0207643_10000478 | 3300025908 | Bacteria | 25853 |
| 301 | Ga0207643_10076936 | 3300025908 | Bacteria | 1928 |
| 302 | Ga0207684_10000952 | 3300025910 | Bacteria | 32606 |
| 303 | Ga0207684_10004583 | 3300025910 | Bacteria | 12986 |
| 304 | Ga0207684_10150982 | 3300025910 | Unclassified | 1999 |
| 305 | Ga0207654_10008809 | 3300025911 | Bacteria | 5118 |
| 306 | Ga0207654_10128373 | 3300025911 | Bacteria | 1602 |
| 307 | Ga0207707_10012053 | 3300025912 | Bacteria | 7518 |
| 308 | Ga0207707_10029335 | 3300025912 | Bacteria | 4808 |
| 309 | Ga0207707_10066784 | 3300025912 | Unclassified | 3132 |
| 310 | Ga0207707_10151848 | 3300025912 | Bacteria | 2024 |
| 311 | Ga0207707_10375131 | 3300025912 | Unclassified | 1223 |
| 312 | Ga0207695_10009276 | 3300025913 | Bacteria | 12187 |
| 313 | Ga0207695_10031815 | 3300025913 | Bacteria | 5781 |
| 314 | Ga0207695_10146532 | 3300025913 | Bacteria | 2305 |
| 315 | Ga0207695_10180759 | 3300025913 | Unclassified | 2030 |
| 316 | Ga0207695_10313962 | 3300025913 | Bacteria | 1457 |
| 317 | Ga0207695_10378238 | 3300025913 | Bacteria | 1302 |
| 318 | Ga0207671_10121619 | 3300025914 | Bacteria | 1996 |
| 319 | Ga0207693_10000012 | 3300025915 | Bacteria | 154708 |
| 320 | Ga0207693_10000108 | 3300025915 | Bacteria | 75296 |
| 321 | Ga0207693_10000120 | 3300025915 | Bacteria | 69565 |
| 322 | Ga0207693_10000808 | 3300025915 | Bacteria | 28014 |
| 323 | Ga0207693_10016456 | 3300025915 | Bacteria | 5909 |
| 324 | Ga0207693_10026197 | 3300025915 | Unclassified | 4616 |
| 325 | Ga0207693_10039569 | 3300025915 | Unclassified | 3713 |
| 326 | Ga0207693_10290789 | 3300025915 | Unclassified | 1281 |
| 327 | Ga0207693_10310772 | 3300025915 | Unclassified | 1234 |
| 328 | Ga0207663_10000658 | 3300025916 | Bacteria | 15321 |
| 329 | Ga0207663_10003307 | 3300025916 | Bacteria | 7864 |
| 330 | Ga0207663_10007016 | 3300025916 | Bacteria | 5813 |
| 331 | Ga0207663_10009804 | 3300025916 | Bacteria | 5070 |
| 332 | Ga0207663_10014868 | 3300025916 | Unclassified | 4277 |
| 333 | Ga0207663_10022465 | 3300025916 | Bacteria | 3606 |
| 334 | Ga0207660_10084429 | 3300025917 | Bacteria | 2341 |
| 335 | Ga0207657_10000099 | 3300025919 | Bacteria | 83148 |
| 336 | Ga0207657_10000898 | 3300025919 | Bacteria | 31448 |
| 337 | Ga0207649_10000500 | 3300025920 | Bacteria | 27825 |
| 338 | Ga0207649_10051437 | 3300025920 | Bacteria | 2551 |
| 339 | Ga0207652_10037011 | 3300025921 | Bacteria | 4128 |
| 340 | Ga0207652_10121517 | 3300025921 | Unclassified | 2324 |
| 341 | Ga0207652_10281683 | 3300025921 | Unclassified | 1500 |
| 342 | Ga0207652_10400299 | 3300025921 | Bacteria | 1239 |
| 343 | Ga0207646_10003118 | 3300025922 | Bacteria | 19028 |
| 344 | Ga0207646_10004869 | 3300025922 | Bacteria | 14386 |
| 345 | Ga0207646_10029576 | 3300025922 | Unclassified | 4975 |
| 346 | Ga0207650_10000053 | 3300025925 | Bacteria | 164599 |
| 347 | Ga0207650_10008515 | 3300025925 | Bacteria | 7001 |
| 348 | Ga0207650_10147527 | 3300025925 | Unclassified | 1854 |
| 349 | Ga0207650_10197450 | 3300025925 | Bacteria | 1610 |
| 350 | Ga0207700_10002849 | 3300025928 | Bacteria | 9948 |
| 351 | Ga0207700_10003390 | 3300025928 | Bacteria | 9254 |
| 352 | Ga0207700_10007276 | 3300025928 | Bacteria | 6755 |
| 353 | Ga0207700_10010354 | 3300025928 | Bacteria | 5878 |
| 354 | Ga0207700_10034949 | 3300025928 | Bacteria | 3614 |
| 355 | Ga0207700_10089645 | 3300025928 | Bacteria | 2425 |
| 356 | Ga0207700_10165594 | 3300025928 | Bacteria | 1839 |
| 357 | Ga0207700_10291613 | 3300025928 | Unclassified | 1406 |
| 358 | Ga0207664_10000275 | 3300025929 | Bacteria | 38913 |
| 359 | Ga0207664_10021199 | 3300025929 | Bacteria | 4827 |
| 360 | Ga0207664_10025387 | 3300025929 | Unclassified | 4463 |
| 361 | Ga0207664_10364883 | 3300025929 | Unclassified | 1280 |
| 362 | Ga0207664_10549652 | 3300025929 | Unclassified | 1036 |
| 363 | Ga0207706_10000973 | 3300025933 | Bacteria | 29233 |
| 364 | Ga0207706_10008489 | 3300025933 | Bacteria | 9476 |
| 365 | Ga0207706_10098964 | 3300025933 | Bacteria | 2566 |
| 366 | Ga0207706_10160250 | 3300025933 | Unclassified | 1978 |
| 367 | Ga0207686_10013384 | 3300025934 | Bacteria | 4538 |
| 368 | Ga0207686_10015017 | 3300025934 | Unclassified | 4323 |
| 369 | Ga0207686_10026157 | 3300025934 | Bacteria | 3402 |
| 370 | Ga0207686_10092204 | 3300025934 | Unclassified | 2003 |
| 371 | Ga0207670_10125658 | 3300025936 | Bacteria | 1871 |
| 372 | Ga0207704_10054300 | 3300025938 | Unclassified | 2442 |
| 373 | Ga0207665_10001867 | 3300025939 | Bacteria | 14204 |
| 374 | Ga0207665_10020854 | 3300025939 | Unclassified | 4308 |
| 375 | Ga0207665_10021211 | 3300025939 | Unclassified | 4270 |
| 376 | Ga0207665_10029348 | 3300025939 | Bacteria | 3636 |
| 377 | Ga0207665_10034587 | 3300025939 | Bacteria | 3353 |
| 378 | Ga0207665_10051266 | 3300025939 | Bacteria | 2777 |
| 379 | Ga0207665_10055706 | 3300025939 | Bacteria | 2668 |
| 380 | Ga0207711_10008632 | 3300025941 | Bacteria | 8520 |
| 381 | Ga0207711_10013523 | 3300025941 | Bacteria | 6775 |
| 382 | Ga0207689_10072990 | 3300025942 | Unclassified | 2819 |
| 383 | Ga0207689_10127650 | 3300025942 | Unclassified | 2091 |
| 384 | Ga0207689_10168204 | 3300025942 | Unclassified | 1806 |
| 385 | Ga0207661_10000435 | 3300025944 | Bacteria | 26948 |
| 386 | Ga0207661_10152577 | 3300025944 | Bacteria | 1998 |
| 387 | Ga0207679_10029925 | 3300025945 | Unclassified | 3796 |
| 388 | Ga0207667_10012648 | 3300025949 | Bacteria | 9698 |
| 389 | Ga0207667_10057539 | 3300025949 | Unclassified | 4081 |
| 390 | Ga0207640_10008057 | 3300025981 | Bacteria | 5827 |
| 391 | Ga0207658_10041076 | 3300025986 | Unclassified | 3347 |
| 392 | Ga0207677_10008987 | 3300026023 | Bacteria | 5605 |
| 393 | Ga0207677_10027518 | 3300026023 | Bacteria | 3582 |
| 394 | Ga0207703_10009080 | 3300026035 | Bacteria | 7828 |
| 395 | Ga0207703_10088738 | 3300026035 | Bacteria | 2596 |
| 396 | Ga0207703_10099280 | 3300026035 | Unclassified | 2464 |
| 397 | Ga0207678_10001251 | 3300026067 | Bacteria | 23440 |
| 398 | Ga0207678_10082632 | 3300026067 | Bacteria | 2748 |
| 399 | Ga0207702_10002196 | 3300026078 | Bacteria | 18698 |
| 400 | Ga0207702_10003466 | 3300026078 | Bacteria | 14379 |
| 401 | Ga0207702_10005252 | 3300026078 | Bacteria | 11370 |
| 402 | Ga0207641_10000321 | 3300026088 | Bacteria | 58896 |
| 403 | Ga0207641_10250858 | 3300026088 | Bacteria | 1653 |
| 404 | Ga0207648_10000314 | 3300026089 | Bacteria | 53108 |
| 405 | Ga0207648_10018956 | 3300026089 | Bacteria | 6214 |
| 406 | Ga0207676_10000628 | 3300026095 | Bacteria | 28671 |
| 407 | Ga0207676_10007331 | 3300026095 | Bacteria | 7822 |
| 408 | Ga0207674_10000092 | 3300026116 | Bacteria | 99761 |
| 409 | Ga0207674_10000560 | 3300026116 | Bacteria | 48628 |
| 410 | Ga0207674_10233269 | 3300026116 | Bacteria | 1788 |
| 411 | Ga0207675_100054494 | 3300026118 | Unclassified | 3730 |
| 412 | Ga0207683_10027332 | 3300026121 | Unclassified | 4930 |
| 413 | Ga0207683_10096938 | 3300026121 | Unclassified | 2629 |
| 414 | Ga0207698_10014167 | 3300026142 | Bacteria | 5290 |
| 415 | Ga0265354_1002415 | 3300028016 | Bacteria | 2315 |
| 416 | Ga0265356_1000324 | 3300028017 | Bacteria | 8795 |
| 417 | Ga0265356_1000451 | 3300028017 | Bacteria | 7493 |
| 418 | Ga0268266_10003731 | 3300028379 | Bacteria | 14975 |
| 419 | Ga0268265_10002752 | 3300028380 | Bacteria | 12981 |
| 420 | Ga0268264_10011199 | 3300028381 | Bacteria | 7408 |
| 421 | Ga0268264_10012415 | 3300028381 | Bacteria | 7012 |
| 422 | Ga0265338_10002594 | 3300028800 | Bacteria | 26721 |
| 423 | Ga0265338_10018612 | 3300028800 | Bacteria | 7422 |
| 424 | Ga0265338_10046570 | 3300028800 | Bacteria | 3973 |
| 425 | Ga0265338_10126075 | 3300028800 | Bacteria | 2031 |
| 426 | Ga0265762_1001455 | 3300030760 | Unclassified | 4282 |
| 427 | Ga0265762_1006686 | 3300030760 | Bacteria | 2061 |
| 428 | Ga0265765_1002314 | 3300030879 | Bacteria | 1834 |
| 429 | Ga0265760_10000024 | 3300031090 | Bacteria | 66666 |
| 430 | Ga0265760_10000737 | 3300031090 | Bacteria | 9350 |
| 431 | Ga0265760_10017405 | 3300031090 | Unclassified | 2064 |
| 432 | Ga0265325_10004534 | 3300031241 | Bacteria | 8752 |
| 433 | Ga0265339_10009778 | 3300031249 | Bacteria | 5994 |
| 434 | Ga0265316_10106441 | 3300031344 | Bacteria | 2127 |
| 435 | Ga0373934_0004566 | 3300035086 | Bacteria | 5116 |
| 436 | Ga0373934_0030860 | 3300035086 | Bacteria | 2097 |
| 437 | Ga0373936_0117302 | 3300035113 | Unclassified | 1134 |
| 438 | Ga0373953_0040672 | 3300035117 | Bacteria | 1847 |
| 439 | Ga0373954_0026892 | 3300035118 | Bacteria | 2639 |
| 440 | Ga0373957_0003104 | 3300035120 | Bacteria | 4848 |
| 441 | Ga0373943_0018033 | 3300035170 | Bacteria | 3239 |
| 442 | Ga0373946_0162617 | 3300035171 | Bacteria | 1049 |
| 443 | Ga0373955_0000118 | 3300035172 | Bacteria | 31719 |
| 444 | Ga0373935_0009271 | 3300035692 | Bacteria | 5891 |
| 445 | Ga0373935_0019947 | 3300035692 | Unclassified | 4091 |
| 446 | Ga0373927_0009870 | 3300035695 | Bacteria | 6402 |
| 447 | Ga0373927_0212937 | 3300035695 | Bacteria | 1269 |
| 448 | Ga0373933_0005087 | 3300035724 | Bacteria | 7170 |
| 449 | Ga0373947_0008354 | 3300035725 | Bacteria | 5962 |
| 450 | Ga0373947_0015061 | 3300035725 | Bacteria | 4438 |
| 451 | Ga0373947_0157904 | 3300035725 | Unclassified | 1465 |
| 452 | Ga0373937_0000440 | 3300036401 | Bacteria | 38396 |
| 453 | Ga0373937_0182356 | 3300036401 | Unclassified | 1972 |
| 454 | Ga0373925_0006126 | 3300037068 | Bacteria | 8883 |
| 455 | Ga0373925_0013202 | 3300037068 | Bacteria | 5979 |
| 456 | Ga0373925_0051361 | 3300037068 | Bacteria | 3078 |
| 457 | Ga0395905_0174616 | 3300037471 | Unclassified | 2018 |
| 458 | Ga0466963_0250768 | 3300044694 | Bacteria | 1242 |
| 459 | Ga0451576_0145829 | 3300045051 | Unclassified | 2468 |
| 460 | Ga0451576_0510226 | 3300045051 | Unclassified | 1263 |
| 461 | Ga0466967_0129979 | 3300045976 | Bacteria | 2337 |
| 462 | Ga0466967_0290731 | 3300045976 | Bacteria | 1570 |
| 463 | Ga0495603_0052079 | 3300046455 | Unclassified | 2431 |
| 464 | Ga0495603_0124522 | 3300046455 | Bacteria | 1502 |
| 465 | Ga0495653_0060407 | 3300046463 | Bacteria | 2872 |
| 466 | Ga0495580_0000977 | 3300046472 | Bacteria | 25057 |
| 467 | Ga0495580_0001564 | 3300046472 | Bacteria | 20142 |
| 468 | Ga0495580_0002932 | 3300046472 | Bacteria | 14649 |
| 469 | Ga0495580_0003385 | 3300046472 | Bacteria | 13617 |
| 470 | Ga0495580_0021066 | 3300046472 | Bacteria | 4814 |
| 471 | Ga0495580_0041910 | 3300046472 | Bacteria | 3263 |
| 472 | Ga0495580_0053344 | 3300046472 | Bacteria | 2853 |
| 473 | Ga0495580_0064404 | 3300046472 | Unclassified | 2570 |
| 474 | Ga0495582_0002705 | 3300046473 | Bacteria | 9892 |
| 475 | Ga0495639_0015952 | 3300046475 | Bacteria | 3258 |
| 476 | Ga0495664_0120938 | 3300046477 | Unclassified | 1584 |
| 477 | Ga0495584_0020015 | 3300046491 | Bacteria | 3400 |
| 478 | Ga0495594_0003508 | 3300046499 | Bacteria | 8078 |
| 479 | Ga0495618_0156791 | 3300046514 | Bacteria | 1453 |
| 480 | Ga0495630_0028937 | 3300046517 | Bacteria | 4118 |
| 481 | Ga0495630_0053944 | 3300046517 | Unclassified | 3011 |
| 482 | Ga0495665_0010633 | 3300046531 | Bacteria | 4984 |
| 483 | Ga0495587_0002503 | 3300046536 | Bacteria | 12269 |
| 484 | Ga0495667_0033927 | 3300046559 | Bacteria | 3414 |
| 485 | Ga0495634_0125374 | 3300046642 | Unclassified | 1641 |
| 486 | Ga0495623_0037738 | 3300046679 | Bacteria | 3090 |
| 487 | Ga0495647_0005502 | 3300046681 | Unclassified | 4151 |
| 488 | Ga0495658_0018499 | 3300046683 | Unclassified | 3624 |
| 489 | Ga0495658_0058525 | 3300046683 | Bacteria | 2204 |
| 490 | Ga0495669_0005509 | 3300046684 | Bacteria | 5286 |
| 491 | Ga0495669_0105362 | 3300046684 | Bacteria | 1313 |
| 492 | Ga0495613_0078603 | 3300046689 | Unclassified | 2399 |
| 493 | Ga0495613_0090976 | 3300046689 | Unclassified | 2210 |
| 494 | Ga0495604_0001031 | 3300047317 | Bacteria | 23236 |
| 495 | Ga0495674_0132367 | 3300047319 | Bacteria | 2101 |
| 496 | Ga0495680_0072513 | 3300047322 | Unclassified | 2619 |
| 497 | Ga0495684_0020821 | 3300047471 | Bacteria | 5054 |
| 498 | Ga0495593_0166747 | 3300047673 | Unclassified | 1111 |
| 499 | Ga0495602_0002273 | 3300048088 | Bacteria | 19439 |
| 500 | Ga0495602_0212409 | 3300048088 | Bacteria | 1467 |
| 501 | Ga0496101_0193312 | 3300048904 | Bacteria | 1571 |
| 502 | Ga0496102_0031698 | 3300048905 | Bacteria | 4744 |
| 503 | Ga0496102_0457198 | 3300048905 | Bacteria | 1197 |
| 504 | Ga0496103_0038798 | 3300048906 | Unclassified | 2925 |
| 505 | Ga0496103_0094930 | 3300048906 | Bacteria | 1884 |
| 506 | Ga0496105_0109469 | 3300048908 | Bacteria | 2280 |
| 507 | Ga0496105_0386059 | 3300048908 | Unclassified | 1114 |
| 508 | Ga0496106_0088228 | 3300048909 | Bacteria | 2391 |
| 509 | Ga0496106_0115844 | 3300048909 | Bacteria | 2090 |
| 510 | Ga0496107_0074866 | 3300048910 | Bacteria | 2464 |
| 511 | Ga0496108_0000129 | 3300048911 | Bacteria | 74408 |
| 512 | Ga0496108_0129198 | 3300048911 | Bacteria | 2171 |
| 513 | Ga0496109_0000124 | 3300048912 | Bacteria | 78766 |
| 514 | Ga0496110_0000527 | 3300048913 | Bacteria | 25993 |
| 515 | Ga0496111_0010592 | 3300048914 | Bacteria | 6195 |
| 516 | Ga0496111_0030833 | 3300048914 | Bacteria | 3815 |
| 517 | Ga0496112_0000146 | 3300048915 | Bacteria | 44267 |
| 518 | Ga0496112_0022456 | 3300048915 | Bacteria | 6014 |
| 519 | Ga0496112_0173048 | 3300048915 | Bacteria | 2124 |
| 520 | Ga0496113_0114741 | 3300048916 | Bacteria | 2100 |
| 521 | Ga0496113_0209165 | 3300048916 | Bacteria | 1552 |
| 522 | Ga0496115_0016706 | 3300048918 | Bacteria | 5594 |
| 523 | Ga0496115_0102711 | 3300048918 | Unclassified | 2345 |
| 524 | Ga0501031_0015294 | 3300049568 | Unclassified | 4984 |
| 525 | Ga0501033_0009159 | 3300049570 | Bacteria | 7628 |
| 526 | Ga0501034_0050080 | 3300049571 | Unclassified | 4213 |
| 527 | Ga0501036_0001388 | 3300049572 | Bacteria | 18611 |
| 528 | Ga0501037_0025571 | 3300049573 | Unclassified | 4361 |
| 529 | Ga0501038_0003710 | 3300049574 | Bacteria | 14236 |
| 530 | Ga0501043_0005608 | 3300049579 | Bacteria | 10104 |
| 531 | Ga0501046_0029002 | 3300049580 | Unclassified | 4503 |
| 532 | Ga0501047_0013774 | 3300049581 | Bacteria | 7680 |
| 533 | Ga0501048_0014678 | 3300049582 | Bacteria | 5796 |
| 534 | Ga0501067_0020147 | 3300049583 | Unclassified | 3689 |
| 535 | Ga0501068_0016905 | 3300049584 | Unclassified | 4211 |
| 536 | Ga0501069_0016053 | 3300049585 | Unclassified | 4018 |
| 537 | Ga0501070_0025747 | 3300049586 | Unclassified | 4935 |
| 538 | Ga0501072_0011783 | 3300049588 | Bacteria | 6677 |
| 539 | Ga0501073_0008061 | 3300049589 | Bacteria | 7815 |
| 540 | Ga0501074_0005279 | 3300049590 | Bacteria | 9302 |
| 541 | Ga0501076_0023822 | 3300049592 | Unclassified | 4724 |
| 542 | Ga0501079_0002246 | 3300049741 | Bacteria | 13936 |
| 543 | Ga0501080_0003741 | 3300049742 | Bacteria | 13431 |
| 544 | Ga0501083_0008246 | 3300049744 | Bacteria | 7365 |
| 545 | Ga0501035_0031286 | 3300049822 | Unclassified | 4846 |
| 546 | Ga0501044_0103564 | 3300049823 | Unclassified | 2860 |
| 547 | nmdc:mga0rr50_59444_c1 | 3300050513 | Bacteria | 2870 |
| 548 | nmdc:mga08x19_45595_c1 | 3300050514 | Bacteria | 2801 |
| 549 | Ga0501084_0001376 | 3300054114 | Bacteria | 19259 |
| 550 | Ga0501082_0041189 | 3300060353 | Unclassified | 3982 |
| 551 | Ga0436362_0706655 | |||
| 552 | MBSR1b_contig_198788 | |||
| 553 | JGI24743J22301_10001705 | |||
| 554 | JGI24751J29686_10000730 | |||
| 555 | rootH1_10163171 | |||
| 556 | Ga0065715_10002528 | |||
| 557 | Ga0065715_10124125 | |||
| 558 | Ga0070658_10019460 | |||
| 559 | Ga0070676_10015547 | |||
| 560 | Ga0070683_100008552 | |||
| 561 | Ga0070683_100017349 | |||
| 562 | Ga0070690_100005294 | |||
| 563 | Ga0070670_100002259 | |||
| 564 | Ga0070670_100004434 | |||
| 565 | Ga0070670_100155317 | |||
| 566 | Ga0068869_100003323 | |||
| 567 | Ga0068869_100247125 | |||
| 568 | Ga0070666_10061569 | |||
| 569 | Ga0070680_100062652 | |||
| 570 | Ga0070680_100128328 | |||
| 571 | Ga0070680_100210445 | |||
| 572 | Ga0070682_100021547 | |||
| 573 | Ga0070682_100041559 | |||
| 574 | Ga0068868_100003343 | |||
| 575 | Ga0068868_100015773 | |||
| 576 | Ga0070660_100002962 | |||
| 577 | Ga0070660_100149176 | |||
| 578 | Ga0070689_100014194 | |||
| 579 | Ga0070661_100007288 | |||
| 580 | Ga0070661_100244208 | |||
| 581 | Ga0070692_10094475 | |||
| 582 | Ga0070668_100003732 | |||
| 583 | Ga0070669_100003465 | |||
| 584 | Ga0070675_100024970 | |||
| 585 | Ga0070671_100154446 | |||
| 586 | Ga0070674_100003703 | |||
| 587 | Ga0070673_100072904 | |||
| 588 | Ga0070673_100089922 | |||
| 589 | Ga0070688_100029640 | |||
| 590 | Ga0070688_100110907 | |||
| 591 | Ga0070659_100016495 | |||
| 592 | Ga0070659_100053587 | |||
| 593 | Ga0070667_100151808 | |||
| 594 | Ga0070709_10000332 | |||
| 595 | Ga0070709_10021144 | |||
| 596 | Ga0070709_10044441 | |||
| 597 | Ga0070709_10077259 | |||
| 598 | Ga0070709_10111169 | |||
| 599 | Ga0070709_10172840 | |||
| 600 | Ga0070714_100007629 | |||
| 601 | Ga0070714_100028497 | |||
| 602 | Ga0070714_100063507 | |||
| 603 | Ga0070714_100078772 | |||
| 604 | Ga0070714_100079321 | |||
| 605 | Ga0070714_100181331 | |||
| 606 | Ga0070714_100374922 | |||
| 607 | Ga0070714_100445340 | |||
| 608 | Ga0070713_100000413 | |||
| 609 | Ga0070713_100000856 | |||
| 610 | Ga0070713_100003904 | |||
| 611 | Ga0070713_100013225 | |||
| 612 | Ga0070713_100014487 | |||
| 613 | Ga0070713_100016807 | |||
| 614 | Ga0070713_100019696 | |||
| 615 | Ga0070713_100027631 | |||
| 616 | Ga0070713_100032299 | |||
| 617 | Ga0070713_100082071 | |||
| 618 | Ga0070713_100126386 | |||
| 619 | Ga0070713_100153681 | |||
| 620 | Ga0070710_10005162 | |||
| 621 | Ga0070710_10010243 | |||
| 622 | Ga0070711_100000078 | |||
| 623 | Ga0070711_100003687 | |||
| 624 | Ga0070711_100006008 | |||
| 625 | Ga0070711_100010342 | |||
| 626 | Ga0070711_100012647 | |||
| 627 | Ga0070711_100032316 | |||
| 628 | Ga0070711_100077508 | |||
| 629 | Ga0070705_100051494 | |||
| 630 | Ga0070708_100006920 | |||
| 631 | Ga0070708_100008359 | |||
| 632 | Ga0070708_100014583 | |||
| 633 | Ga0070708_100026239 | |||
| 634 | Ga0070708_100032717 | |||
| 635 | Ga0070708_100353887 | |||
| 636 | Ga0070663_100014501 | |||
| 637 | Ga0070678_100012773 | |||
| 638 | Ga0070662_100088230 | |||
| 639 | Ga0070662_100154185 | |||
| 640 | Ga0070662_100349614 | |||
| 641 | Ga0070681_10020134 | |||
| 642 | Ga0070681_10198003 | |||
| 643 | Ga0070681_10498435 | |||
| 644 | Ga0068867_100002029 | |||
| 645 | Ga0068867_100047569 | |||
| 646 | Ga0070685_10001249 | |||
| 647 | Ga0070706_100017391 | |||
| 648 | Ga0070706_100108220 | |||
| 649 | Ga0070706_100243463 | |||
| 650 | Ga0070707_100006178 | |||
| 651 | Ga0070707_100156439 | |||
| 652 | Ga0070698_100000393 | |||
| 653 | Ga0070698_100012185 | |||
| 654 | Ga0070698_100019408 | |||
| 655 | Ga0070698_100032677 | |||
| 656 | Ga0070698_100447084 | |||
| 657 | Ga0070699_100006077 | |||
| 658 | Ga0070699_100015770 | |||
| 659 | Ga0070699_100049624 | |||
| 660 | Ga0070699_100088575 | |||
| 661 | Ga0070699_100099883 | |||
| 662 | Ga0070679_100087909 | |||
| 663 | Ga0070679_100451906 | |||
| 664 | Ga0070684_100001539 | |||
| 665 | Ga0070684_100044884 | |||
| 666 | Ga0070684_100160541 | |||
| 667 | Ga0070697_100002338 | |||
| 668 | Ga0070697_100005485 | |||
| 669 | Ga0070697_100008836 | |||
| 670 | Ga0070697_100024201 | |||
| 671 | Ga0070697_100105456 | |||
| 672 | Ga0070697_100232539 | |||
| 673 | Ga0068853_100057133 | |||
| 674 | Ga0068853_100085605 | |||
| 675 | Ga0070672_100012577 | |||
| 676 | Ga0070686_100025538 | |||
| 677 | Ga0070693_100052351 | |||
| 678 | Ga0068855_100036494 | |||
| 679 | Ga0068855_100070153 | |||
| 680 | Ga0068855_100077852 | |||
| 681 | Ga0068855_100087633 | |||
| 682 | Ga0068855_100312788 | |||
| 683 | Ga0070664_100000218 | |||
| 684 | Ga0070664_100017087 | |||
| 685 | Ga0068857_100000431 | |||
| 686 | Ga0068857_100000800 | |||
| 687 | Ga0068854_100004840 | |||
| 688 | Ga0068854_100012470 | |||
| 689 | Ga0068854_100061175 | |||
| 690 | Ga0068856_100001284 | |||
| 691 | Ga0068856_100004471 | |||
| 692 | Ga0068856_100012139 | |||
| 693 | Ga0068856_100013830 | |||
| 694 | Ga0068856_100039129 | |||
| 695 | Ga0068856_100162921 | |||
| 696 | Ga0070702_100158605 | |||
| 697 | Ga0068852_100002212 | |||
| 698 | Ga0068852_100147358 | |||
| 699 | Ga0068859_100002285 | |||
| 700 | Ga0068859_100030222 | |||
| 701 | Ga0068864_100001216 | |||
| 702 | Ga0068864_100009864 | |||
| 703 | Ga0068864_100017546 | |||
| 704 | Ga0068864_100222805 | |||
| 705 | Ga0068866_10002220 | |||
| 706 | Ga0068866_10023516 | |||
| 707 | Ga0068861_100027330 | |||
| 708 | Ga0068851_10014432 | |||
| 709 | Ga0068851_10103691 | |||
| 710 | Ga0068870_10021423 | |||
| 711 | Ga0068870_10239734 | |||
| 712 | Ga0068863_100158377 | |||
| 713 | Ga0068863_100351901 | |||
| 714 | Ga0068858_100018863 | |||
| 715 | Ga0068858_100064451 | |||
| 716 | Ga0068858_100089197 | |||
| 717 | Ga0068860_100015643 | |||
| 718 | Ga0068860_100067531 | |||
| 719 | Ga0068860_100154992 | |||
| 720 | Ga0068862_100007335 | |||
| 721 | Ga0081540_1020926 | |||
| 722 | Ga0070717_10000556 | |||
| 723 | Ga0070717_10000812 | |||
| 724 | Ga0070717_10001835 | |||
| 725 | Ga0070717_10005111 | |||
| 726 | Ga0070717_10005939 | |||
| 727 | Ga0070717_10034645 | |||
| 728 | Ga0070717_10044430 | |||
| 729 | Ga0070717_10171064 | |||
| 730 | Ga0070715_10049675 | |||
| 731 | Ga0070716_100000248 | |||
| 732 | Ga0070716_100002380 | |||
| 733 | Ga0070716_100003139 | |||
| 734 | Ga0070716_100009693 | |||
| 735 | Ga0070716_100015760 | |||
| 736 | Ga0070716_100018643 | |||
| 737 | Ga0070716_100156967 | |||
| 738 | Ga0070712_100000228 | |||
| 739 | Ga0070712_100000445 | |||
| 740 | Ga0070712_100007130 | |||
| 741 | Ga0070712_100007823 | |||
| 742 | Ga0070712_100015386 | |||
| 743 | Ga0070712_100020180 | |||
| 744 | Ga0070712_100037368 | |||
| 745 | Ga0070712_100042320 | |||
| 746 | Ga0070712_100181154 | |||
| 747 | Ga0070712_100187728 | |||
| 748 | Ga0097621_100001711 | |||
| 749 | Ga0097621_100125457 | |||
| 750 | Ga0068871_100000439 | |||
| 751 | Ga0068871_100012445 | |||
| 752 | Ga0068871_100014011 | |||
| 753 | Ga0068871_100021872 | |||
| 754 | Ga0068865_100010160 | |||
| 755 | Ga0068865_100028681 | |||
| 756 | Ga0068865_100052026 | |||
| 757 | Ga0075436_100001541 | |||
| 758 | Ga0075436_100054406 | |||
| 759 | Ga0097620_100002285 | |||
| 760 | Ga0097620_100030219 | |||
| 761 | Ga0075435_100024148 | |||
| 762 | Ga0099794_10068555 | |||
| 763 | Ga0105240_10112609 | |||
| 764 | Ga0105240_10124491 | |||
| 765 | Ga0105240_10157491 | |||
| 766 | Ga0105240_10197981 | |||
| 767 | Ga0105245_10004868 | |||
| 768 | Ga0105245_10009843 | |||
| 769 | Ga0105245_10292300 | |||
| 770 | Ga0105247_10004580 | |||
| 771 | Ga0105241_10008981 | |||
| 772 | Ga0105241_10019246 | |||
| 773 | Ga0105241_10038309 | |||
| 774 | Ga0105241_10172421 | |||
| 775 | Ga0105242_10005129 | |||
| 776 | Ga0105242_10021399 | |||
| 777 | Ga0105242_10137023 | |||
| 778 | Ga0105248_10022863 | |||
| 779 | Ga0105248_10109158 | |||
| 780 | Ga0105237_10089345 | |||
| 781 | Ga0105238_10075170 | |||
| 782 | Ga0105249_10019153 | |||
| 783 | Ga0105239_10028640 | |||
| 784 | Ga0105239_10158488 | |||
| 785 | Ga0105246_10000585 | |||
| 786 | Ga0157373_10008159 | |||
| 787 | Ga0157373_10041842 | |||
| 788 | Ga0157371_10045196 | |||
| 789 | Ga0157370_10089812 | |||
| 790 | Ga0157369_10017943 | |||
| 791 | Ga0157369_10149348 | |||
| 792 | Ga0157369_10256121 | |||
| 793 | Ga0157374_10000586 | |||
| 794 | Ga0157374_10002176 | |||
| 795 | Ga0157374_10190297 | |||
| 796 | Ga0157378_10000132 | |||
| 797 | Ga0157378_10000263 | |||
| 798 | Ga0157378_10000884 | |||
| 799 | Ga0157378_10035909 | |||
| 800 | Ga0157378_10184298 | |||
| 801 | Ga0163162_10179638 | |||
| 802 | Ga0157372_10002303 | |||
| 803 | Ga0157372_10005490 | |||
| 804 | Ga0157372_10008009 | |||
| 805 | Ga0157372_10012747 | |||
| 806 | Ga0157372_10014642 | |||
| 807 | Ga0157372_10019641 | |||
| 808 | Ga0157372_10028406 | |||
| 809 | Ga0157372_10058069 | |||
| 810 | Ga0157372_10151868 | |||
| 811 | Ga0157372_10237220 | |||
| 812 | Ga0157372_10492722 | |||
| 813 | Ga0157375_10203521 | |||
| 814 | Ga0163163_10144783 | |||
| 815 | Ga0157380_10086854 | |||
| 816 | Ga0182008_10011904 | |||
| 817 | Ga0157379_10099728 | |||
| 818 | Ga0157376_10028892 | |||
| 819 | Ga0157376_10147923 | |||
| 820 | Ga0182006_1032432 | |||
| 821 | Ga0182007_10005818 | |||
| 822 | Ga0182005_1007697 | |||
| 823 | Ga0163161_10023114 | |||
| 824 | Ga0224570_100098 | |||
| 825 | Ga0224569_100189 | |||
| 826 | Ga0224569_103027 | |||
| 827 | Ga0224571_100095 | |||
| 828 | Ga0224572_1004229 | |||
| 829 | Ga0228598_1000259 | |||
| 830 | Ga0228598_1013631 | |||
| 831 | Ga0207697_10024700 | |||
| 832 | Ga0207656_10033792 | |||
| 833 | Ga0207692_10004401 | |||
| 834 | Ga0207642_10009650 | |||
| 835 | Ga0207710_10100404 | |||
| 836 | Ga0207688_10002375 | |||
| 837 | Ga0207647_10000730 | |||
| 838 | Ga0207647_10017772 | |||
| 839 | Ga0207685_10033426 | |||
| 840 | Ga0207699_10001156 | |||
| 841 | Ga0207699_10012078 | |||
| 842 | Ga0207699_10025506 | |||
| 843 | Ga0207699_10040887 | |||
| 844 | Ga0207699_10058507 | |||
| 845 | Ga0207699_10094964 | |||
| 846 | Ga0207699_10123240 | |||
| 847 | Ga0207699_10158980 | |||
| 848 | Ga0207699_10205427 | |||
| 849 | Ga0207645_10001142 | |||
| 850 | Ga0207643_10000478 | |||
| 851 | Ga0207643_10076936 | |||
| 852 | Ga0207684_10000952 | |||
| 853 | Ga0207684_10004583 | |||
| 854 | Ga0207684_10150982 | |||
| 855 | Ga0207654_10008809 | |||
| 856 | Ga0207654_10128373 | |||
| 857 | Ga0207707_10012053 | |||
| 858 | Ga0207707_10029335 | |||
| 859 | Ga0207707_10066784 | |||
| 860 | Ga0207707_10151848 | |||
| 861 | Ga0207707_10375131 | |||
| 862 | Ga0207695_10009276 | |||
| 863 | Ga0207695_10031815 | |||
| 864 | Ga0207695_10146532 | |||
| 865 | Ga0207695_10180759 | |||
| 866 | Ga0207695_10313962 | |||
| 867 | Ga0207695_10378238 | |||
| 868 | Ga0207671_10121619 | |||
| 869 | Ga0207693_10000012 | |||
| 870 | Ga0207693_10000108 | |||
| 871 | Ga0207693_10000120 | |||
| 872 | Ga0207693_10000808 | |||
| 873 | Ga0207693_10016456 | |||
| 874 | Ga0207693_10026197 | |||
| 875 | Ga0207693_10039569 | |||
| 876 | Ga0207693_10290789 | |||
| 877 | Ga0207693_10310772 | |||
| 878 | Ga0207663_10000658 | |||
| 879 | Ga0207663_10003307 | |||
| 880 | Ga0207663_10007016 | |||
| 881 | Ga0207663_10009804 | |||
| 882 | Ga0207663_10014868 | |||
| 883 | Ga0207663_10022465 | |||
| 884 | Ga0207660_10084429 | |||
| 885 | Ga0207657_10000099 | |||
| 886 | Ga0207657_10000898 | |||
| 887 | Ga0207649_10000500 | |||
| 888 | Ga0207649_10051437 | |||
| 889 | Ga0207652_10037011 | |||
| 890 | Ga0207652_10121517 | |||
| 891 | Ga0207652_10281683 | |||
| 892 | Ga0207652_10400299 | |||
| 893 | Ga0207646_10003118 | |||
| 894 | Ga0207646_10004869 | |||
| 895 | Ga0207646_10029576 | |||
| 896 | Ga0207650_10000053 | |||
| 897 | Ga0207650_10008515 | |||
| 898 | Ga0207650_10147527 | |||
| 899 | Ga0207650_10197450 | |||
| 900 | Ga0207700_10002849 | |||
| 901 | Ga0207700_10003390 | |||
| 902 | Ga0207700_10007276 | |||
| 903 | Ga0207700_10010354 | |||
| 904 | Ga0207700_10034949 | |||
| 905 | Ga0207700_10089645 | |||
| 906 | Ga0207700_10165594 | |||
| 907 | Ga0207700_10291613 | |||
| 908 | Ga0207664_10000275 | |||
| 909 | Ga0207664_10021199 | |||
| 910 | Ga0207664_10025387 | |||
| 911 | Ga0207664_10364883 | |||
| 912 | Ga0207664_10549652 | |||
| 913 | Ga0207706_10000973 | |||
| 914 | Ga0207706_10008489 | |||
| 915 | Ga0207706_10098964 | |||
| 916 | Ga0207706_10160250 | |||
| 917 | Ga0207686_10013384 | |||
| 918 | Ga0207686_10015017 | |||
| 919 | Ga0207686_10026157 | |||
| 920 | Ga0207686_10092204 | |||
| 921 | Ga0207670_10125658 | |||
| 922 | Ga0207704_10054300 | |||
| 923 | Ga0207665_10001867 | |||
| 924 | Ga0207665_10020854 | |||
| 925 | Ga0207665_10021211 | |||
| 926 | Ga0207665_10029348 | |||
| 927 | Ga0207665_10034587 | |||
| 928 | Ga0207665_10051266 | |||
| 929 | Ga0207665_10055706 | |||
| 930 | Ga0207711_10008632 | |||
| 931 | Ga0207711_10013523 | |||
| 932 | Ga0207689_10072990 | |||
| 933 | Ga0207689_10127650 | |||
| 934 | Ga0207689_10168204 | |||
| 935 | Ga0207661_10000435 | |||
| 936 | Ga0207661_10152577 | |||
| 937 | Ga0207679_10029925 | |||
| 938 | Ga0207667_10012648 | |||
| 939 | Ga0207667_10057539 | |||
| 940 | Ga0207640_10008057 | |||
| 941 | Ga0207658_10041076 | |||
| 942 | Ga0207677_10008987 | |||
| 943 | Ga0207677_10027518 | |||
| 944 | Ga0207703_10009080 | |||
| 945 | Ga0207703_10088738 | |||
| 946 | Ga0207703_10099280 | |||
| 947 | Ga0207678_10001251 | |||
| 948 | Ga0207678_10082632 | |||
| 949 | Ga0207702_10002196 | |||
| 950 | Ga0207702_10003466 | |||
| 951 | Ga0207702_10005252 | |||
| 952 | Ga0207641_10000321 | |||
| 953 | Ga0207641_10250858 | |||
| 954 | Ga0207648_10000314 | |||
| 955 | Ga0207648_10018956 | |||
| 956 | Ga0207676_10000628 | |||
| 957 | Ga0207676_10007331 | |||
| 958 | Ga0207674_10000092 | |||
| 959 | Ga0207674_10000560 | |||
| 960 | Ga0207674_10233269 | |||
| 961 | Ga0207675_100054494 | |||
| 962 | Ga0207683_10027332 | |||
| 963 | Ga0207683_10096938 | |||
| 964 | Ga0207698_10014167 | |||
| 965 | Ga0265354_1002415 | |||
| 966 | Ga0265356_1000324 | |||
| 967 | Ga0265356_1000451 | |||
| 968 | Ga0268266_10003731 | |||
| 969 | Ga0268265_10002752 | |||
| 970 | Ga0268264_10011199 | |||
| 971 | Ga0268264_10012415 | |||
| 972 | Ga0265338_10002594 | |||
| 973 | Ga0265338_10018612 | |||
| 974 | Ga0265338_10046570 | |||
| 975 | Ga0265338_10126075 | |||
| 976 | Ga0265762_1001455 | |||
| 977 | Ga0265762_1006686 | |||
| 978 | Ga0265765_1002314 | |||
| 979 | Ga0265760_10000024 | |||
| 980 | Ga0265760_10000737 | |||
| 981 | Ga0265760_10017405 | |||
| 982 | Ga0265325_10004534 | |||
| 983 | Ga0265339_10009778 | |||
| 984 | Ga0265316_10106441 | |||
| 985 | Ga0373934_0004566 | |||
| 986 | Ga0373934_0030860 | |||
| 987 | Ga0373936_0117302 | |||
| 988 | Ga0373953_0040672 | |||
| 989 | Ga0373954_0026892 | |||
| 990 | Ga0373957_0003104 | |||
| 991 | Ga0373943_0018033 | |||
| 992 | Ga0373946_0162617 | |||
| 993 | Ga0373955_0000118 | |||
| 994 | Ga0373935_0009271 | |||
| 995 | Ga0373935_0019947 | |||
| 996 | Ga0373927_0009870 | |||
| 997 | Ga0373927_0212937 | |||
| 998 | Ga0373933_0005087 | |||
| 999 | Ga0373947_0008354 | |||
| 1000 | Ga0373947_0015061 | |||
| 1001 | Ga0373947_0157904 | |||
| 1002 | Ga0373937_0000440 | |||
| 1003 | Ga0373937_0182356 | |||
| 1004 | Ga0373925_0006126 | |||
| 1005 | Ga0373925_0013202 | |||
| 1006 | Ga0373925_0051361 | |||
| 1007 | Ga0395905_0174616 | |||
| 1008 | Ga0466963_0250768 | |||
| 1009 | Ga0451576_0145829 | |||
| 1010 | Ga0451576_0510226 | |||
| 1011 | Ga0466967_0129979 | |||
| 1012 | Ga0466967_0290731 | |||
| 1013 | Ga0495603_0052079 | |||
| 1014 | Ga0495603_0124522 | |||
| 1015 | Ga0495653_0060407 | |||
| 1016 | Ga0495580_0000977 | |||
| 1017 | Ga0495580_0001564 | |||
| 1018 | Ga0495580_0002932 | |||
| 1019 | Ga0495580_0003385 | |||
| 1020 | Ga0495580_0021066 | |||
| 1021 | Ga0495580_0041910 | |||
| 1022 | Ga0495580_0053344 | |||
| 1023 | Ga0495580_0064404 | |||
| 1024 | Ga0495582_0002705 | |||
| 1025 | Ga0495639_0015952 | |||
| 1026 | Ga0495664_0120938 | |||
| 1027 | Ga0495584_0020015 | |||
| 1028 | Ga0495594_0003508 | |||
| 1029 | Ga0495618_0156791 | |||
| 1030 | Ga0495630_0028937 | |||
| 1031 | Ga0495630_0053944 | |||
| 1032 | Ga0495665_0010633 | |||
| 1033 | Ga0495587_0002503 | |||
| 1034 | Ga0495667_0033927 | |||
| 1035 | Ga0495634_0125374 | |||
| 1036 | Ga0495623_0037738 | |||
| 1037 | Ga0495647_0005502 | |||
| 1038 | Ga0495658_0018499 | |||
| 1039 | Ga0495658_0058525 | |||
| 1040 | Ga0495669_0005509 | |||
| 1041 | Ga0495669_0105362 | |||
| 1042 | Ga0495613_0078603 | |||
| 1043 | Ga0495613_0090976 | |||
| 1044 | Ga0495604_0001031 | |||
| 1045 | Ga0495674_0132367 | |||
| 1046 | Ga0495680_0072513 | |||
| 1047 | Ga0495684_0020821 | |||
| 1048 | Ga0495593_0166747 | |||
| 1049 | Ga0495602_0002273 | |||
| 1050 | Ga0495602_0212409 | |||
| 1051 | Ga0496101_0193312 | |||
| 1052 | Ga0496102_0031698 | |||
| 1053 | Ga0496102_0457198 | |||
| 1054 | Ga0496103_0038798 | |||
| 1055 | Ga0496103_0094930 | |||
| 1056 | Ga0496105_0109469 | |||
| 1057 | Ga0496105_0386059 | |||
| 1058 | Ga0496106_0088228 | |||
| 1059 | Ga0496106_0115844 | |||
| 1060 | Ga0496107_0074866 | |||
| 1061 | Ga0496108_0000129 | |||
| 1062 | Ga0496108_0129198 | |||
| 1063 | Ga0496109_0000124 | |||
| 1064 | Ga0496110_0000527 | |||
| 1065 | Ga0496111_0010592 | |||
| 1066 | Ga0496111_0030833 | |||
| 1067 | Ga0496112_0000146 | |||
| 1068 | Ga0496112_0022456 | |||
| 1069 | Ga0496112_0173048 | |||
| 1070 | Ga0496113_0114741 | |||
| 1071 | Ga0496113_0209165 | |||
| 1072 | Ga0496115_0016706 | |||
| 1073 | Ga0496115_0102711 | |||
| 1074 | Ga0501031_0015294 | |||
| 1075 | Ga0501033_0009159 | |||
| 1076 | Ga0501034_0050080 | |||
| 1077 | Ga0501036_0001388 | |||
| 1078 | Ga0501037_0025571 | |||
| 1079 | Ga0501038_0003710 | |||
| 1080 | Ga0501043_0005608 | |||
| 1081 | Ga0501046_0029002 | |||
| 1082 | Ga0501047_0013774 | |||
| 1083 | Ga0501048_0014678 | |||
| 1084 | Ga0501067_0020147 | |||
| 1085 | Ga0501068_0016905 | |||
| 1086 | Ga0501069_0016053 | |||
| 1087 | Ga0501070_0025747 | |||
| 1088 | Ga0501072_0011783 | |||
| 1089 | Ga0501073_0008061 | |||
| 1090 | Ga0501074_0005279 | |||
| 1091 | Ga0501076_0023822 | |||
| 1092 | Ga0501079_0002246 | |||
| 1093 | Ga0501080_0003741 | |||
| 1094 | Ga0501083_0008246 | |||
| 1095 | Ga0501035_0031286 | |||
| 1096 | Ga0501044_0103564 | |||
| 1097 | nmdc:mga0rr50_59444_c1 | |||
| 1098 | nmdc:mga08x19_45595_c1 | |||
| 1099 | Ga0501084_0001376 | |||
| 1100 | Ga0501082_0041189 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e5z-assembly2.cif.gz_B | x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. | 0.9103 | 12 | 302 |
| 3e5z-assembly2.cif.gz_B | x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. | 0.9073 | 12 | 302 |
| 3dr2-assembly1.cif.gz_B | structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways | 0.9058 | 7 | 291 |
| 3dr2-assembly1.cif.gz_A | structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways | 0.9033 | 7 | 291 |
| 8dk0-assembly1.cif.gz_A | crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma-valerolactone | 0.8998 | 29 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e5zB00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9221 | 12 | 302 | 2.120.10.30 |
| 3e5zB00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.919 | 12 | 302 | 2.120.10.30 |
| 3dr2A00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9033 | 7 | 291 | 2.120.10.30 |
| 4o5sB00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8677 | 28 | 302 | 2.120.10.30 |
| 3dr2A00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8596 | 7 | 291 | 2.120.10.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q6X807-F1-model_v4 | SMP-30/Gluconolactonase/LRE-like region domain-containing protein | 0.9979 | 24 | 300 |
GO:0016787
GO:0046872 |
| AF-A0A2V9HXL1-F1-model_v4 | SMP-30/gluconolactonase/LRE family protein | 0.9965 | 9 | 302 |
GO:0016787
GO:0046872 |
| AF-A0A2V9KDP8-F1-model_v4 | SMP-30/gluconolactonase/LRE family protein | 0.9926 | 1 | 302 |
GO:0016787
GO:0046872 |
| AF-A0A1Q6X807-F1-model_v4 | SMP-30/Gluconolactonase/LRE-like region domain-containing protein | 0.9907 | 24 | 300 |
GO:0016787
GO:0046872 |
| AF-A0A2V9KDP8-F1-model_v4 | SMP-30/gluconolactonase/LRE family protein | 0.9893 | 1 | 302 |
GO:0016787
GO:0046872 |