F461921

General Info

Members Datasets Scaffolds Average Seq Length
545 270 1090 309

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_61129_c1|nmdc:mga07m45_61129_c1_134_1096
Length 315
Sequence MAPRHTDAAAQCRQLQEAMAQIIGARTPGAGDFETPIPGLGFFRRDAPAPPAACMVAPSIVLVAQGAKQMWVGGEGYPYDTSQFLVTSLNLPANSEVRLASAQQPCLGLLLKLDVRVLAELIAQGNLPSQRDRPGGATATPALLAPIARLLALLDEPEAIPVLAPMICREIHYRLLASDQAGKLRQIASVDGQGHRIARAIDWLTLNYALPLRVDELALRVRMSTPTFHHHFRQLTAMSPLQYQKWLRLNEAKRLMLAEHLDAASAAFRVGYESPSQFSREYSRLFGAPPKRDIGVLRGGARGIDGHKQALPDHA

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
57 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
84 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
88 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
89 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
90 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
91 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
92 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
93 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
94 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
95 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
96 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
97 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
100 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
103 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
104 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
105 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
186 2511231004 Pseudomonas sp. GM102 Isolate Nodule
187 2511231006 Pseudomonas sp. GM17 Isolate Nodule
188 2511231007 Pseudomonas sp. GM18 Isolate Nodule
189 2511231010 Pseudomonas sp. GM25 Isolate Nodule
190 2511231011 Pseudomonas sp. GM30 Isolate Nodule
191 2511231023 Pseudomonas sp. GM80 Isolate Nodule
192 2511231031 Pseudomonas sp. GM16 Isolate Nodule
193 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
194 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
195 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
196 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
197 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
198 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
199 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
200 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
201 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
202 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
203 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
204 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
205 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
206 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
207 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
208 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
209 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
210 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
211 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
212 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
213 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
214 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
215 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
216 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
217 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
218 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
219 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
220 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
221 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
222 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
223 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
224 2773857673 Pseudomonas sp. 443 Isolate Unclassified
225 2784132063 Pseudomonas sp. 424 Isolate Unclassified
226 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
227 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
228 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
229 2818991446 Variovorax sp. 1180 Isolate Unclassified
230 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
231 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
232 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
233 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
234 2842677519 Variovorax sp. R-72495 Isolate Unclassified
235 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
236 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
237 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
238 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
239 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
240 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
241 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
242 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
243 2899924645 Variovorax sp. 369 Isolate Unclassified
244 2904456579 Variovorax sp. 2002 Isolate Unclassified
245 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
246 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
247 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
248 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
249 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
250 2928037797 Variovorax sp. 1126 Isolate Unclassified
251 2928044640 Variovorax sp. 1128 Isolate Unclassified
252 2928051484 Variovorax sp. 1133 Isolate Unclassified
253 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
254 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
255 2929520902 Variovorax beijingensis 502 Isolate Unclassified
256 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
257 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
258 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
259 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
260 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
261 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
262 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
263 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
264 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
265 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
266 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
267 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
268 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
269 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
270 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.4
Metatranscriptomes 0
Isolates 15.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.48
Nodule 1.47
Rhizoplane 2.75
Rhizosphere 69.91
Stem 0
Stem Tuber 0.37
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_61129_c1 3300050496 Bacteria 2133
2 MRS2a_Contig_6937 2124908027 Bacteria 8377
3 JGI24739J22299_10005304 3300001989 Bacteria 4909
4 JGI25152J39213_1003829 3300002773 Bacteria 4976
5 JGI25150J39212_1000766 3300002774 Bacteria 11091
6 JGI25159J45721_1004003 3300002987 Bacteria 5018
7 JGI25151J46595_10008382 3300003187 Bacteria 4976
8 JGI25153J46596_10008325 3300003215 Bacteria 4976
9 rootH1_10022118 3300003323 Bacteria 3272
10 JGI25160J50197_1006657 3300003354 Bacteria 4650
11 JGI25161J50226_1003360 3300003374 Bacteria 3690
12 Ga0055542_1000003 3300003762 Bacteria 582721
13 Ga0055526_1009542 3300003771 Bacteria 4650
14 Ga0055537_1003676 3300003773 Bacteria 4650
15 Ga0055524_1007431 3300003775 Bacteria 4650
16 Ga0055536_1006686 3300003781 Bacteria 5303
17 Ga0055534_1003784 3300003784 Bacteria 4650
18 Ga0055534_1009158 3300003784 Bacteria 2173
19 Ga0055528_1007874 3300003790 Bacteria 4650
20 Ga0055530_10000230 3300003791 Bacteria 49999
21 Ga0055530_10000292 3300003791 Bacteria 45623
22 Ga0055530_10000648 3300003791 Bacteria 29930
23 Ga0055540_1000008 3300003792 Bacteria 309635
24 Ga0055540_1000241 3300003792 Bacteria 49999
25 Ga0055540_1007745 3300003792 Bacteria 3994
26 Ga0055540_1010302 3300003792 Bacteria 3123
27 Ga0055531_10000242 3300003794 Bacteria 59638
28 Ga0055531_10012477 3300003794 Bacteria 3994
29 Ga0055531_10029777 3300003794 Bacteria 1851
30 Ga0058692_1017930 3300003856 Bacteria 1541
31 Ga0065165_1008002 3300005262 Bacteria 5056
32 Ga0065714_10003577 3300005288 Bacteria 6672
33 Ga0065714_10003817 3300005288 Bacteria 6574
34 Ga0065714_10004032 3300005288 Bacteria 5826
35 Ga0065714_10006232 3300005288 Bacteria 3946
36 Ga0065714_10066877 3300005288 Bacteria 6162
37 Ga0065704_10091027 3300005289 Bacteria 2746
38 Ga0065704_10133220 3300005289 Bacteria 1603
39 Ga0070670_100000390 3300005331 Bacteria 36385
40 Ga0068853_100003381 3300005539 Bacteria 12217
41 Ga0068851_10001660 3300005834 Bacteria 9750
42 Ga0075365_10049238 3300006038 Bacteria 2776
43 Ga0075364_10004346 3300006051 Bacteria 8131
44 Ga0075364_10084777 3300006051 Bacteria 2098
45 Ga0075364_10124632 3300006051 Bacteria 1726
46 Ga0075432_10002059 3300006058 Bacteria 6693
47 Ga0075432_10004053 3300006058 Bacteria 5001
48 Ga0075432_10008261 3300006058 Bacteria 3548
49 Ga0075432_10013338 3300006058 Bacteria 2792
50 Ga0075432_10048765 3300006058 Bacteria 1491
51 Ga0075436_100127044 3300006914 Bacteria 1787
52 Ga0105251_10000357 3300009011 Bacteria 45041
53 Ga0105251_10016721 3300009011 Bacteria 3954
54 Ga0105251_10023051 3300009011 Bacteria 3220
55 Ga0105244_10001652 3300009036 Bacteria 17654
56 Ga0105244_10016726 3300009036 Bacteria 4169
57 Ga0105244_10019814 3300009036 Bacteria 3746
58 Ga0105244_10040647 3300009036 Bacteria 2413
59 Ga0105244_10044313 3300009036 Bacteria 2292
60 Ga0105244_10048329 3300009036 Bacteria 2177
61 Ga0105244_10057293 3300009036 Bacteria 1969
62 Ga0105250_10001913 3300009092 Bacteria 10808
63 Ga0105250_10015780 3300009092 Bacteria 3090
64 Ga0105243_10000170 3300009148 Bacteria 74646
65 Ga0105246_10105122 3300011119 Bacteria 2063
66 Ga0157345_1000082 3300012498 Bacteria 20096
67 Ga0157373_10000892 3300013100 Bacteria 23093
68 Ga0157373_10000983 3300013100 Bacteria 22040
69 Ga0157371_10007196 3300013102 Bacteria 9040
70 Ga0157371_10023628 3300013102 Bacteria 4496
71 Ga0157370_10163113 3300013104 Bacteria 2073
72 Ga0157369_10001083 3300013105 Bacteria 34030
73 Ga0157369_10024958 3300013105 Bacteria 6640
74 Ga0163162_10191899 3300013306 Bacteria 2171
75 Ga0163162_10338477 3300013306 Bacteria 1637
76 Ga0157372_10083343 3300013307 Bacteria 3622
77 Ga0157375_10000755 3300013308 Bacteria 28347
78 Ga0182008_10000429 3300014497 Bacteria 32349
79 Ga0182008_10001108 3300014497 Bacteria 18535
80 Ga0182008_10003410 3300014497 Bacteria 9600
81 Ga0182008_10025382 3300014497 Bacteria 3009
82 Ga0182008_10085543 3300014497 Bacteria 1553
83 Ga0182008_10106776 3300014497 Bacteria 1386
84 Ga0182006_1000480 3300015261 Bacteria 31300
85 Ga0182006_1006439 3300015261 Bacteria 5456
86 Ga0182006_1037936 3300015261 Bacteria 1907
87 Ga0182007_10000343 3300015262 Bacteria 29658
88 Ga0182007_10002942 3300015262 Bacteria 8266
89 Ga0182005_1001534 3300015265 Bacteria 9180
90 Ga0182005_1002919 3300015265 Bacteria 5936
91 Ga0182005_1022064 3300015265 Bacteria 1745
92 Ga0163161_10000054 3300017792 Bacteria 117153
93 Ga0163161_10004296 3300017792 Bacteria 9933
94 Ga0163161_10276736 3300017792 Bacteria 1315
95 Ga0209672_100709 3300025228 Bacteria 16591
96 Ga0209147_100791 3300025229 Bacteria 15333
97 Ga0209258_100015 3300025242 Bacteria 706310
98 Ga0207425_1000234 3300025245 Bacteria 42951
99 Ga0209148_1000028 3300025254 Bacteria 582773
100 Ga0209759_1006183 3300025256 Bacteria 4069
101 Ga0209129_1000049 3300025258 Bacteria 268086
102 Ga0209129_1003405 3300025258 Bacteria 6959
103 Ga0209565_1002581 3300025263 Bacteria 6428
104 Ga0209565_1002865 3300025263 Bacteria 5925
105 Ga0209130_1000267 3300025284 Bacteria 65435
106 Ga0209675_1004739 3300025291 Bacteria 5925
107 Ga0209675_1008661 3300025291 Bacteria 3701
108 Ga0209676_1000002 3300025292 Bacteria 1732948
109 Ga0209676_1000137 3300025292 Bacteria 179437
110 Ga0209676_1008525 3300025292 Bacteria 4557
111 Ga0209676_1022195 3300025292 Bacteria 2109
112 Ga0209676_1023457 3300025292 Bacteria 2019
113 Ga0209025_1000481 3300025294 Bacteria 77405
114 Ga0209564_1001413 3300025295 Bacteria 24762
115 Ga0209758_1000135 3300025297 Bacteria 177753
116 Ga0209050_1000006 3300025298 Bacteria 1359702
117 Ga0209050_1000009 3300025298 Bacteria 1047265
118 Ga0209050_1000015 3300025298 Bacteria 759102
119 Ga0209256_1000129 3300025299 Bacteria 163766
120 Ga0207426_1000171 3300025302 Bacteria 163766
121 Ga0209051_1000001 3300025303 Bacteria 1732974
122 Ga0209051_1000008 3300025303 Bacteria 706935
123 Ga0209051_1000010 3300025303 Bacteria 641298
124 Ga0209257_1000026 3300025304 Bacteria 723225
125 Ga0209257_1000029 3300025304 Bacteria 695617
126 Ga0209257_1010747 3300025304 Bacteria 4556
127 Ga0207656_10004778 3300025321 Bacteria 4755
128 Ga0207696_1000002 3300025711 Bacteria 1098043
129 Ga0207696_1009993 3300025711 Bacteria 3504
130 Ga0207655_1000167 3300025728 Bacteria 119650
131 Ga0207655_1000520 3300025728 Bacteria 49037
132 Ga0207655_1002113 3300025728 Bacteria 16620
133 Ga0207655_1005098 3300025728 Bacteria 9076
134 Ga0207655_1013509 3300025728 Bacteria 4685
135 Ga0207655_1018822 3300025728 Bacteria 3642
136 Ga0207713_1000058 3300025735 Bacteria 216911
137 Ga0207713_1000772 3300025735 Bacteria 29538
138 Ga0207713_1001144 3300025735 Bacteria 22477
139 Ga0207713_1001298 3300025735 Bacteria 20557
140 Ga0207713_1022326 3300025735 Bacteria 3007
141 Ga0207713_1022718 3300025735 Bacteria 2969
142 Ga0207650_10000204 3300025925 Bacteria 68172
143 Ga0207709_10000004 3300025935 Bacteria 825156
144 Ga0209371_1000365 3300027312 Bacteria 48737
145 Ga0209983_1029171 3300027665 Bacteria 1172
146 Ga0207428_10015714 3300027907 Bacteria 6539
147 Ga0207428_10029172 3300027907 Bacteria 4576
148 Ga0207428_10047225 3300027907 Bacteria 3458
149 Ga0207428_10277610 3300027907 Bacteria 1244
150 Ga0268256_1000236 3300030500 Bacteria 57974
151 Ga0307406_10027187 3300031901 Bacteria 3444
152 Ga0307412_10000948 3300031911 Bacteria 16593
153 Ga0307510_10001364 3300033180 Bacteria 26659
154 Ga0439438_000140 3300041405 Bacteria 32855
155 Ga0439438_000238 3300041405 Bacteria 24472
156 Ga0439438_002407 3300041405 Bacteria 7975
157 Ga0439438_013577 3300041405 Bacteria 2452
158 Ga0439447_000025 3300041407 Bacteria 50859
159 Ga0439447_006724 3300041407 Bacteria 3701
160 Ga0439447_013015 3300041407 Bacteria 2372
161 Ga0439466_0000115 3300041411 Bacteria 31009
162 Ga0439466_0000641 3300041411 Bacteria 13170
163 Ga0439431_0000056 3300041997 Bacteria 17418
164 Ga0439445_0001859 3300042004 Bacteria 4646
165 Ga0439432_000006 3300042006 Bacteria 102167
166 Ga0439432_000275 3300042006 Bacteria 18580
167 Ga0439432_000384 3300042006 Bacteria 16357
168 Ga0439432_010799 3300042006 Bacteria 3155
169 Ga0439452_000124 3300042010 Bacteria 59201
170 Ga0439452_005464 3300042010 Bacteria 4088
171 Ga0439456_003475 3300042013 Bacteria 3192
172 Ga0439456_010272 3300042013 Bacteria 1933
173 Ga0439456_018386 3300042013 Bacteria 1468
174 Ga0439463_000054 3300042016 Bacteria 24284
175 Ga0450911_001937 3300042115 Bacteria 4336
176 Ga0450920_009541 3300042122 Bacteria 1787
177 Ga0450903_000890 3300042138 Bacteria 5758
178 Ga0450905_008770 3300042142 Bacteria 1386
179 Ga0450907_000039 3300042146 Bacteria 57175
180 Ga0450907_000571 3300042146 Bacteria 9930
181 Ga0450910_000003 3300042147 Bacteria 81243
182 Ga0439446_0000748 3300042156 Bacteria 6822
183 Ga0439446_0002030 3300042156 Bacteria 4791
184 Ga0450908_000190 3300042184 Bacteria 12611
185 Ga0450909_000644 3300042185 Bacteria 4616
186 Ga0450909_007348 3300042185 Bacteria 1593
187 Ga0439434_0002283 3300042435 Bacteria 5572
188 Ga0439460_0000118 3300042461 Bacteria 13629
189 Ga0450893_0016397 3300042532 Bacteria 1254
190 Ga0439440_0000691 3300042993 Bacteria 5783
191 Ga0495617_000155 3300046452 Bacteria 43743
192 Ga0495617_000853 3300046452 Bacteria 14465
193 Ga0495617_001901 3300046452 Bacteria 8791
194 Ga0495617_036799 3300046452 Bacteria 1640
195 Ga0495617_048002 3300046452 Bacteria 1420
196 Ga0495627_000087 3300046453 Bacteria 110870
197 Ga0495627_000682 3300046453 Bacteria 26048
198 Ga0495592_0001332 3300046454 Bacteria 17145
199 Ga0495603_0000384 3300046455 Bacteria 24132
200 Ga0495603_0012127 3300046455 Bacteria 5220
201 Ga0495591_000054 3300046458 Bacteria 135364
202 Ga0495591_000104 3300046458 Bacteria 98228
203 Ga0495591_000437 3300046458 Bacteria 33994
204 Ga0495591_000888 3300046458 Bacteria 20936
205 Ga0495591_001773 3300046458 Bacteria 12799
206 Ga0495591_006201 3300046458 Bacteria 5335
207 Ga0495591_010526 3300046458 Bacteria 3578
208 Ga0495638_0000117 3300046460 Bacteria 127788
209 Ga0495638_0006510 3300046460 Bacteria 8493
210 Ga0495653_0000114 3300046463 Bacteria 66581
211 Ga0495653_0000208 3300046463 Bacteria 47373
212 Ga0495653_0018119 3300046463 Bacteria 5724
213 Ga0495650_0001483 3300046471 Bacteria 22473
214 Ga0495650_0039007 3300046471 Bacteria 2052
215 Ga0495605_0000145 3300046474 Bacteria 91308
216 Ga0495605_0000711 3300046474 Bacteria 24596
217 Ga0495605_0001242 3300046474 Bacteria 16979
218 Ga0495605_0001929 3300046474 Bacteria 13188
219 Ga0495605_0001972 3300046474 Bacteria 13011
220 Ga0495605_0015612 3300046474 Bacteria 4126
221 Ga0495605_0016844 3300046474 Bacteria 3948
222 Ga0495605_0033109 3300046474 Bacteria 2626
223 Ga0495605_0063508 3300046474 Bacteria 1761
224 Ga0495605_0159847 3300046474 Bacteria 1000
225 Ga0495639_0000079 3300046475 Bacteria 45534
226 Ga0495584_0002013 3300046491 Bacteria 11685
227 Ga0495584_0002059 3300046491 Bacteria 11538
228 Ga0495584_0002319 3300046491 Bacteria 10845
229 Ga0495584_0012807 3300046491 Bacteria 4280
230 Ga0495584_0026696 3300046491 Bacteria 2926
231 Ga0495585_0002517 3300046492 Bacteria 13033
232 Ga0495585_0003045 3300046492 Bacteria 11551
233 Ga0495585_0007204 3300046492 Bacteria 6834
234 Ga0495585_0007433 3300046492 Bacteria 6708
235 Ga0495585_0009396 3300046492 Bacteria 5865
236 Ga0495594_0000701 3300046499 Bacteria 17236
237 Ga0495596_0001209 3300046500 Bacteria 15089
238 Ga0495596_0062908 3300046500 Bacteria 1443
239 Ga0495607_0000197 3300046501 Bacteria 63955
240 Ga0495607_0001938 3300046501 Bacteria 17481
241 Ga0495607_0006208 3300046501 Bacteria 8434
242 Ga0495607_0047917 3300046501 Bacteria 2500
243 Ga0495607_0093988 3300046501 Bacteria 1618
244 Ga0495583_0000380 3300046506 Bacteria 68842
245 Ga0495583_0001543 3300046506 Bacteria 22817
246 Ga0495583_0003404 3300046506 Bacteria 12159
247 Ga0495583_0055186 3300046506 Bacteria 1796
248 Ga0495606_0000047 3300046507 Bacteria 207892
249 Ga0495606_0000389 3300046507 Bacteria 74347
250 Ga0495606_0001284 3300046507 Bacteria 34796
251 Ga0495606_0005279 3300046507 Bacteria 12450
252 Ga0495606_0012609 3300046507 Bacteria 6758
253 Ga0495606_0016566 3300046507 Bacteria 5612
254 Ga0495606_0025504 3300046507 Bacteria 4231
255 Ga0495606_0109212 3300046507 Bacteria 1671
256 Ga0495606_0124327 3300046507 Bacteria 1540
257 Ga0495610_0005707 3300046512 Bacteria 8769
258 Ga0495610_0028118 3300046512 Bacteria 2979
259 Ga0495610_0037608 3300046512 Bacteria 2461
260 Ga0495616_0000479 3300046513 Bacteria 30376
261 Ga0495616_0000781 3300046513 Bacteria 23271
262 Ga0495616_0011701 3300046513 Bacteria 5016
263 Ga0495616_0029049 3300046513 Bacteria 2923
264 Ga0495616_0052831 3300046513 Bacteria 2021
265 Ga0495620_0000057 3300046515 Bacteria 97601
266 Ga0495620_0000175 3300046515 Bacteria 50155
267 Ga0495620_0039376 3300046515 Bacteria 2089
268 Ga0495631_0000230 3300046518 Bacteria 38328
269 Ga0495631_0024083 3300046518 Bacteria 2815
270 Ga0495632_0000334 3300046519 Bacteria 44800
271 Ga0495632_0000931 3300046519 Bacteria 25651
272 Ga0495632_0002213 3300046519 Bacteria 15004
273 Ga0495632_0002726 3300046519 Bacteria 13120
274 Ga0495632_0022216 3300046519 Bacteria 3402
275 Ga0495637_0000016 3300046520 Bacteria 226914
276 Ga0495637_0000776 3300046520 Bacteria 21501
277 Ga0495637_0002666 3300046520 Bacteria 9751
278 Ga0495637_0005918 3300046520 Bacteria 6181
279 Ga0495643_0001663 3300046522 Bacteria 19510
280 Ga0495644_0003047 3300046523 Bacteria 6632
281 Ga0495644_0004926 3300046523 Bacteria 5241
282 Ga0495648_0000278 3300046524 Bacteria 57881
283 Ga0495648_0001176 3300046524 Bacteria 26441
284 Ga0495648_0007122 3300046524 Bacteria 8998
285 Ga0495648_0007431 3300046524 Bacteria 8768
286 Ga0495648_0009456 3300046524 Bacteria 7551
287 Ga0495648_0010105 3300046524 Bacteria 7227
288 Ga0495648_0027323 3300046524 Bacteria 3822
289 Ga0495648_0138495 3300046524 Bacteria 1284
290 Ga0495666_0010372 3300046526 Bacteria 4644
291 Ga0495666_0087737 3300046526 Bacteria 1469
292 Ga0495642_0000229 3300046528 Bacteria 32047
293 Ga0495654_0000576 3300046530 Bacteria 29518
294 Ga0495654_0001110 3300046530 Bacteria 19434
295 Ga0495654_0001278 3300046530 Bacteria 17657
296 Ga0495654_0003592 3300046530 Bacteria 9443
297 Ga0495654_0006718 3300046530 Bacteria 6510
298 Ga0495654_0009234 3300046530 Bacteria 5408
299 Ga0495654_0018515 3300046530 Bacteria 3648
300 Ga0495609_0000013 3300046538 Bacteria 328540
301 Ga0495609_0000947 3300046538 Bacteria 20988
302 Ga0495609_0009128 3300046538 Bacteria 4811
303 Ga0495609_0014454 3300046538 Bacteria 3708
304 Ga0495609_0020281 3300046538 Bacteria 3071
305 Ga0495609_0044883 3300046538 Bacteria 1982
306 Ga0495597_0000217 3300046542 Bacteria 52593
307 Ga0495597_0000568 3300046542 Bacteria 30657
308 Ga0495597_0001007 3300046542 Bacteria 21597
309 Ga0495622_0001206 3300046557 Bacteria 13319
310 Ga0495622_0041977 3300046557 Bacteria 2127
311 Ga0495622_0062974 3300046557 Bacteria 1716
312 Ga0495656_0002355 3300046615 Bacteria 6259
313 Ga0495668_0009563 3300046616 Bacteria 5939
314 Ga0495668_0071574 3300046616 Bacteria 1905
315 Ga0495634_0002050 3300046642 Bacteria 17069
316 Ga0495611_0000300 3300046648 Bacteria 33540
317 Ga0495611_0000585 3300046648 Bacteria 20985
318 Ga0495611_0000896 3300046648 Bacteria 16192
319 Ga0495625_0000052 3300046660 Bacteria 190656
320 Ga0495625_0000806 3300046660 Bacteria 43441
321 Ga0495625_0003129 3300046660 Bacteria 16904
322 Ga0495625_0005707 3300046660 Bacteria 11266
323 Ga0495625_0007633 3300046660 Bacteria 9384
324 Ga0495625_0008080 3300046660 Bacteria 9022
325 Ga0495625_0013454 3300046660 Bacteria 6576
326 Ga0495625_0025799 3300046660 Bacteria 4450
327 Ga0495625_0064099 3300046660 Bacteria 2593
328 Ga0495625_0250580 3300046660 Bacteria 1149
329 Ga0495659_0000051 3300046664 Bacteria 52604
330 Ga0495659_0002176 3300046664 Bacteria 6394
331 Ga0495661_0000001 3300046665 Bacteria 898372
332 Ga0495661_0000048 3300046665 Bacteria 144678
333 Ga0495661_0004468 3300046665 Bacteria 10091
334 Ga0495661_0038480 3300046665 Bacteria 2979
335 Ga0495661_0058978 3300046665 Bacteria 2286
336 Ga0495661_0098252 3300046665 Bacteria 1653
337 Ga0495646_0028946 3300046680 Bacteria 3466
338 Ga0495613_0067397 3300046689 Bacteria 2612
339 Ga0495624_0001345 3300046690 Bacteria 19215
340 Ga0495670_0000045 3300046691 Bacteria 66604
341 Ga0495670_0000430 3300046691 Bacteria 20138
342 Ga0495670_0001209 3300046691 Bacteria 12543
343 Ga0495670_0001808 3300046691 Bacteria 10516
344 Ga0495671_0002566 3300046692 Bacteria 11422
345 Ga0495671_0010207 3300046692 Bacteria 5216
346 Ga0495671_0016788 3300046692 Bacteria 3903
347 Ga0495671_0023810 3300046692 Bacteria 3197
348 Ga0495671_0045482 3300046692 Bacteria 2197
349 Ga0495671_0075388 3300046692 Bacteria 1654
350 Ga0495649_0000895 3300046694 Bacteria 23674
351 Ga0495649_0001499 3300046694 Bacteria 17513
352 Ga0495649_0001598 3300046694 Bacteria 16904
353 Ga0495649_0065047 3300046694 Bacteria 1957
354 Ga0495649_0075787 3300046694 Bacteria 1801
355 Ga0495589_0000057 3300046794 Bacteria 108136
356 Ga0495589_0000094 3300046794 Bacteria 84656
357 Ga0495600_0000153 3300046809 Bacteria 39418
358 Ga0495600_0029095 3300046809 Bacteria 3576
359 Ga0495660_0000287 3300046810 Bacteria 46709
360 Ga0495660_0001381 3300046810 Bacteria 16680
361 Ga0495660_0002120 3300046810 Bacteria 12829
362 Ga0495660_0017012 3300046810 Bacteria 4187
363 Ga0495660_0056549 3300046810 Bacteria 2119
364 Ga0495660_0060780 3300046810 Bacteria 2028
365 Ga0495660_0063386 3300046810 Bacteria 1979
366 Ga0495581_0003165 3300047315 Bacteria 9423
367 Ga0495636_0000444 3300047318 Bacteria 15292
368 Ga0495672_0000317 3300047320 Bacteria 64031
369 Ga0495672_0000796 3300047320 Bacteria 34103
370 Ga0495672_0002027 3300047320 Bacteria 19104
371 Ga0495672_0002251 3300047320 Bacteria 17952
372 Ga0495672_0002351 3300047320 Bacteria 17481
373 Ga0495672_0005856 3300047320 Bacteria 9641
374 Ga0495672_0012341 3300047320 Bacteria 5967
375 Ga0495672_0027453 3300047320 Bacteria 3617
376 Ga0495676_0000001 3300047321 Bacteria 624167
377 Ga0495676_0003234 3300047321 Bacteria 14730
378 Ga0495680_0054801 3300047322 Bacteria 3094
379 Ga0495683_0002284 3300047323 Bacteria 11691
380 Ga0495683_0027322 3300047323 Bacteria 2917
381 Ga0495683_0050521 3300047323 Bacteria 2080
382 Ga0495687_000590 3300047443 Bacteria 42315
383 Ga0495687_003396 3300047443 Bacteria 11602
384 Ga0495679_001898 3300047446 Bacteria 11204
385 Ga0495673_0000231 3300047469 Bacteria 81316
386 Ga0495673_0001683 3300047469 Bacteria 16993
387 Ga0495673_0005671 3300047469 Bacteria 7502
388 Ga0495673_0018602 3300047469 Bacteria 3498
389 Ga0495673_0026584 3300047469 Bacteria 2765
390 Ga0495673_0046192 3300047469 Bacteria 1931
391 Ga0495681_0000802 3300047470 Bacteria 24208
392 Ga0495681_0002590 3300047470 Bacteria 12835
393 Ga0495681_0021228 3300047470 Bacteria 3503
394 Ga0495681_0023005 3300047470 Bacteria 3321
395 Ga0495681_0029989 3300047470 Bacteria 2776
396 Ga0495684_0000608 3300047471 Bacteria 28739
397 Ga0495593_0010963 3300047673 Bacteria 5217
398 Ga0495593_0011575 3300047673 Bacteria 5062
399 Ga0495602_0026168 3300048088 Bacteria 5631
400 Ga0495626_0000008 3300048091 Bacteria 271853
401 Ga0495626_0000368 3300048091 Bacteria 47111
402 Ga0495626_0000537 3300048091 Bacteria 37703
403 Ga0495626_0002871 3300048091 Bacteria 11489
404 Ga0495626_0004167 3300048091 Bacteria 8976
405 Ga0495626_0009182 3300048091 Bacteria 5355
406 Ga0495626_0012916 3300048091 Bacteria 4358
407 Ga0496102_0311693 3300048905 Bacteria 1483
408 Ga0496106_0087019 3300048909 Bacteria 2407
409 Ga0496116_0001196 3300048919 Bacteria 30443
410 Ga0496116_0001263 3300048919 Bacteria 29190
411 Ga0496116_0001813 3300048919 Bacteria 23145
412 Ga0496116_0004076 3300048919 Bacteria 14120
413 Ga0496116_0178336 3300048919 Bacteria 1141
414 Ga0496117_0004196 3300048920 Bacteria 16096
415 Ga0496117_0040347 3300048920 Bacteria 3434
416 Ga0496117_0043760 3300048920 Bacteria 3251
417 Ga0496118_0005723 3300048921 Bacteria 13985
418 Ga0496118_0048020 3300048921 Bacteria 3302
419 Ga0496118_0054352 3300048921 Bacteria 3033
420 Ga0496118_0087997 3300048921 Bacteria 2151
421 Ga0496119_0098569 3300048922 Bacteria 1645
422 Ga0496120_0061869 3300048923 Bacteria 2087
423 Ga0496120_0097213 3300048923 Bacteria 1562
424 Ga0496121_0001354 3300048924 Bacteria 41904
425 Ga0496121_0001691 3300048924 Bacteria 36289
426 Ga0496121_0002367 3300048924 Bacteria 29015
427 Ga0496121_0008796 3300048924 Bacteria 11766
428 Ga0496121_0050613 3300048924 Bacteria 3507
429 Ga0496122_0002501 3300048925 Bacteria 25955
430 Ga0496122_0060923 3300048925 Bacteria 2775
431 Ga0496122_0083842 3300048925 Bacteria 2207
432 Ga0496123_0020449 3300048926 Bacteria 5178
433 Ga0496123_0027882 3300048926 Bacteria 4194
434 Ga0496124_0000272 3300048927 Bacteria 99703
435 Ga0496124_0026711 3300048927 Bacteria 5202
436 Ga0496124_0045351 3300048927 Bacteria 3768
437 Ga0496124_0052252 3300048927 Bacteria 3472
438 Ga0496124_0102112 3300048927 Bacteria 2321
439 Ga0496125_0006812 3300048928 Bacteria 12265
440 Ga0496125_0007483 3300048928 Bacteria 11618
441 Ga0496125_0085424 3300048928 Bacteria 2391
442 Ga0496126_0008826 3300048929 Bacteria 10809
443 Ga0495678_000888 3300049459 Bacteria 26591
444 Ga0495678_001413 3300049459 Bacteria 19021
445 Ga0495678_002054 3300049459 Bacteria 14395
446 Ga0495678_003183 3300049459 Bacteria 10339
447 Ga0495678_019014 3300049459 Bacteria 3075
448 Ga0495678_028198 3300049459 Bacteria 2373
449 Ga0495678_081163 3300049459 Bacteria 1164
450 Ga0495682_0000557 3300049460 Bacteria 25623
451 Ga0495682_0003666 3300049460 Bacteria 6772
452 Ga0495682_0007471 3300049460 Bacteria 4341
453 Ga0495682_0031395 3300049460 Bacteria 1963
454 Ga0501226_000826 3300049853 Bacteria 4147
455 nmdc:mga03683_27635_c1 3300050489 Bacteria 2249
456 nmdc:mga03683_55567_c1 3300050489 Bacteria 1663
457 nmdc:mga00v17_129965_c1 3300050491 Bacteria 1609
458 nmdc:mga00v17_135222_c1 3300050491 Bacteria 1578
459 nmdc:mga00v17_5587_c1 3300050491 Bacteria 6630
460 Ga0500586_008480 3300053145 Bacteria 2802
461 2511255210 2511231004 Bacteria 6669789
462 2511264292 2511231006 Bacteria 6794709
463 2511274198 2511231007 Bacteria 6306603
464 2511290264 2511231010 Bacteria 6373152
465 2511293173 2511231011 Bacteria 6149768
466 2511368647 2511231023 Bacteria 6808468
467 2511414184 2511231031 Bacteria 6558529
468 2512327495 2512047018 Bacteria 6663241
469 2583791844 2582580891 Bacteria 6800976
470 2597858593 2597489887 Bacteria 6666321
471 2599488100 2599185185 Bacteria 6652270
472 2599611389 2599185212 Bacteria 6765997
473 2599803187 2599185257 Bacteria 6492581
474 2599967925 2599185306 Bacteria 6637356
475 2599976865 2599185308 Bacteria 6621546
476 2600011034 2599185314 Bacteria 6621749
477 2600037371 2599185318 Bacteria 6961590
478 2600057337 2599185322 Bacteria 6763055
479 2600362457 2600254931 Bacteria 6734225
480 2601799494 2600255318 Bacteria 6383414
481 2606078272 2603880185 Bacteria 6379190
482 2606130380 2603880199 Bacteria 6377649
483 2621300526 2619619299 Bacteria 6649820
484 2624480462 2623620443 Bacteria 6427864
485 2624491695 2623620446 Bacteria 6500345
486 2643870415 2643221571 Bacteria 6228673
487 2644159782 2643221628 Bacteria 5745828
488 2644188545 2643221633 Bacteria 6733554
489 2644286738 2643221650 Bacteria 7029547
490 2671769191 2671180172 Bacteria 6495783
491 2678262809 2675903515 Bacteria 6580491
492 2715759376 2713897149 Bacteria 6506249
493 2738673190 2738541265 Bacteria 6594665
494 2738751583 2738541282 Bacteria 6593925
495 2738860624 2738541303 Bacteria 6591772
496 2739197171 2738543004 Bacteria 6381073
497 2739311677 2738543025 Bacteria 6600348
498 2745009145 2744054620 Bacteria 6551379
499 2774134206 2773857673 Bacteria 6513460
500 2784264013 2784132063 Bacteria 6262788
501 2794596719 2791355520 Bacteria 5948615
502 2808940731 2808606379 Bacteria 5022697
503 2817490398 2816332298 Bacteria 6852809
504 2819598042 2818991446 Bacteria 7757362
505 2819657914 2818991456 Bacteria 6123676
506 2825651566 2825651385 Bacteria 6715909
507 2831269032 2831265667 Bacteria 7184833
508 2838058458 2838054893 Bacteria 7451788
509 2842679498 2842677519 Bacteria 5615038
510 2844671002 2844665904 Bacteria 6817974
511 2852657907 2852657418 Bacteria 6472974
512 2854605706 2854601825 Bacteria 4797592
513 2857576966 2857576091 Bacteria 5465855
514 2871277107 2871272651 Bacteria 5042015
515 2878032396 2878029506 Bacteria 6418441
516 2880233922 2880230671 Bacteria 6140320
517 2891637189 2891633521 Bacteria 4602265
518 2899929461 2899924645 Bacteria 7487985
519 2904459171 2904456579 Bacteria 6819253
520 2904523221 2904518522 Bacteria 6068986
521 2913038785 2913036834 Bacteria 6704877
522 2919065246 2919063839 Bacteria 6302690
523 2919462528 2919462493 Bacteria 5817112
524 2919697881 2919697872 Bacteria 6553725
525 2928040095 2928037797 Bacteria 7273642
526 2928047156 2928044640 Bacteria 7271509
527 2928057641 2928051484 Bacteria 7773759
528 2928067977 2928064002 Bacteria 7419480
529 2929146241 2929144301 Bacteria 6622272
530 2929523971 2929520902 Bacteria 6765052
531 2931370396 2931369376 Bacteria 6847892
532 2945972769 2945972063 Bacteria 6086495
533 2969307271 2969304461 Bacteria 6601805
534 2988733764 2988728565 Bacteria 6124362
535 3007317785 3007315729 Bacteria 5076637
536 3007423806 3007419365 Bacteria 7026924
537 3007615123 3007614139 Bacteria 6053559
538 3007870072 3007866637 Bacteria 5899198
539 8015691332 8015687852 Bacteria 6613826
540 8019778553 8019775933 Bacteria 6858656
541 8055774510 8055770955 Bacteria 6827675
542 8056145175 8056143049 Bacteria 6307666
543 8056154834 8056148874 Bacteria 6479865
544 8056158006 8056155041 Bacteria 6486948
545 8056574100 8056569372 Bacteria 5997322
546 nmdc:mga07m45_61129_c1
547 MRS2a_Contig_6937
548 JGI24739J22299_10005304
549 JGI25152J39213_1003829
550 JGI25150J39212_1000766
551 JGI25159J45721_1004003
552 JGI25151J46595_10008382
553 JGI25153J46596_10008325
554 rootH1_10022118
555 JGI25160J50197_1006657
556 JGI25161J50226_1003360
557 Ga0055542_1000003
558 Ga0055526_1009542
559 Ga0055537_1003676
560 Ga0055524_1007431
561 Ga0055536_1006686
562 Ga0055534_1003784
563 Ga0055534_1009158
564 Ga0055528_1007874
565 Ga0055530_10000230
566 Ga0055530_10000292
567 Ga0055530_10000648
568 Ga0055540_1000008
569 Ga0055540_1000241
570 Ga0055540_1007745
571 Ga0055540_1010302
572 Ga0055531_10000242
573 Ga0055531_10012477
574 Ga0055531_10029777
575 Ga0058692_1017930
576 Ga0065165_1008002
577 Ga0065714_10003577
578 Ga0065714_10003817
579 Ga0065714_10004032
580 Ga0065714_10006232
581 Ga0065714_10066877
582 Ga0065704_10091027
583 Ga0065704_10133220
584 Ga0070670_100000390
585 Ga0068853_100003381
586 Ga0068851_10001660
587 Ga0075365_10049238
588 Ga0075364_10004346
589 Ga0075364_10084777
590 Ga0075364_10124632
591 Ga0075432_10002059
592 Ga0075432_10004053
593 Ga0075432_10008261
594 Ga0075432_10013338
595 Ga0075432_10048765
596 Ga0075436_100127044
597 Ga0105251_10000357
598 Ga0105251_10016721
599 Ga0105251_10023051
600 Ga0105244_10001652
601 Ga0105244_10016726
602 Ga0105244_10019814
603 Ga0105244_10040647
604 Ga0105244_10044313
605 Ga0105244_10048329
606 Ga0105244_10057293
607 Ga0105250_10001913
608 Ga0105250_10015780
609 Ga0105243_10000170
610 Ga0105246_10105122
611 Ga0157345_1000082
612 Ga0157373_10000892
613 Ga0157373_10000983
614 Ga0157371_10007196
615 Ga0157371_10023628
616 Ga0157370_10163113
617 Ga0157369_10001083
618 Ga0157369_10024958
619 Ga0163162_10191899
620 Ga0163162_10338477
621 Ga0157372_10083343
622 Ga0157375_10000755
623 Ga0182008_10000429
624 Ga0182008_10001108
625 Ga0182008_10003410
626 Ga0182008_10025382
627 Ga0182008_10085543
628 Ga0182008_10106776
629 Ga0182006_1000480
630 Ga0182006_1006439
631 Ga0182006_1037936
632 Ga0182007_10000343
633 Ga0182007_10002942
634 Ga0182005_1001534
635 Ga0182005_1002919
636 Ga0182005_1022064
637 Ga0163161_10000054
638 Ga0163161_10004296
639 Ga0163161_10276736
640 Ga0209672_100709
641 Ga0209147_100791
642 Ga0209258_100015
643 Ga0207425_1000234
644 Ga0209148_1000028
645 Ga0209759_1006183
646 Ga0209129_1000049
647 Ga0209129_1003405
648 Ga0209565_1002581
649 Ga0209565_1002865
650 Ga0209130_1000267
651 Ga0209675_1004739
652 Ga0209675_1008661
653 Ga0209676_1000002
654 Ga0209676_1000137
655 Ga0209676_1008525
656 Ga0209676_1022195
657 Ga0209676_1023457
658 Ga0209025_1000481
659 Ga0209564_1001413
660 Ga0209758_1000135
661 Ga0209050_1000006
662 Ga0209050_1000009
663 Ga0209050_1000015
664 Ga0209256_1000129
665 Ga0207426_1000171
666 Ga0209051_1000001
667 Ga0209051_1000008
668 Ga0209051_1000010
669 Ga0209257_1000026
670 Ga0209257_1000029
671 Ga0209257_1010747
672 Ga0207656_10004778
673 Ga0207696_1000002
674 Ga0207696_1009993
675 Ga0207655_1000167
676 Ga0207655_1000520
677 Ga0207655_1002113
678 Ga0207655_1005098
679 Ga0207655_1013509
680 Ga0207655_1018822
681 Ga0207713_1000058
682 Ga0207713_1000772
683 Ga0207713_1001144
684 Ga0207713_1001298
685 Ga0207713_1022326
686 Ga0207713_1022718
687 Ga0207650_10000204
688 Ga0207709_10000004
689 Ga0209371_1000365
690 Ga0209983_1029171
691 Ga0207428_10015714
692 Ga0207428_10029172
693 Ga0207428_10047225
694 Ga0207428_10277610
695 Ga0268256_1000236
696 Ga0307406_10027187
697 Ga0307412_10000948
698 Ga0307510_10001364
699 Ga0439438_000140
700 Ga0439438_000238
701 Ga0439438_002407
702 Ga0439438_013577
703 Ga0439447_000025
704 Ga0439447_006724
705 Ga0439447_013015
706 Ga0439466_0000115
707 Ga0439466_0000641
708 Ga0439431_0000056
709 Ga0439445_0001859
710 Ga0439432_000006
711 Ga0439432_000275
712 Ga0439432_000384
713 Ga0439432_010799
714 Ga0439452_000124
715 Ga0439452_005464
716 Ga0439456_003475
717 Ga0439456_010272
718 Ga0439456_018386
719 Ga0439463_000054
720 Ga0450911_001937
721 Ga0450920_009541
722 Ga0450903_000890
723 Ga0450905_008770
724 Ga0450907_000039
725 Ga0450907_000571
726 Ga0450910_000003
727 Ga0439446_0000748
728 Ga0439446_0002030
729 Ga0450908_000190
730 Ga0450909_000644
731 Ga0450909_007348
732 Ga0439434_0002283
733 Ga0439460_0000118
734 Ga0450893_0016397
735 Ga0439440_0000691
736 Ga0495617_000155
737 Ga0495617_000853
738 Ga0495617_001901
739 Ga0495617_036799
740 Ga0495617_048002
741 Ga0495627_000087
742 Ga0495627_000682
743 Ga0495592_0001332
744 Ga0495603_0000384
745 Ga0495603_0012127
746 Ga0495591_000054
747 Ga0495591_000104
748 Ga0495591_000437
749 Ga0495591_000888
750 Ga0495591_001773
751 Ga0495591_006201
752 Ga0495591_010526
753 Ga0495638_0000117
754 Ga0495638_0006510
755 Ga0495653_0000114
756 Ga0495653_0000208
757 Ga0495653_0018119
758 Ga0495650_0001483
759 Ga0495650_0039007
760 Ga0495605_0000145
761 Ga0495605_0000711
762 Ga0495605_0001242
763 Ga0495605_0001929
764 Ga0495605_0001972
765 Ga0495605_0015612
766 Ga0495605_0016844
767 Ga0495605_0033109
768 Ga0495605_0063508
769 Ga0495605_0159847
770 Ga0495639_0000079
771 Ga0495584_0002013
772 Ga0495584_0002059
773 Ga0495584_0002319
774 Ga0495584_0012807
775 Ga0495584_0026696
776 Ga0495585_0002517
777 Ga0495585_0003045
778 Ga0495585_0007204
779 Ga0495585_0007433
780 Ga0495585_0009396
781 Ga0495594_0000701
782 Ga0495596_0001209
783 Ga0495596_0062908
784 Ga0495607_0000197
785 Ga0495607_0001938
786 Ga0495607_0006208
787 Ga0495607_0047917
788 Ga0495607_0093988
789 Ga0495583_0000380
790 Ga0495583_0001543
791 Ga0495583_0003404
792 Ga0495583_0055186
793 Ga0495606_0000047
794 Ga0495606_0000389
795 Ga0495606_0001284
796 Ga0495606_0005279
797 Ga0495606_0012609
798 Ga0495606_0016566
799 Ga0495606_0025504
800 Ga0495606_0109212
801 Ga0495606_0124327
802 Ga0495610_0005707
803 Ga0495610_0028118
804 Ga0495610_0037608
805 Ga0495616_0000479
806 Ga0495616_0000781
807 Ga0495616_0011701
808 Ga0495616_0029049
809 Ga0495616_0052831
810 Ga0495620_0000057
811 Ga0495620_0000175
812 Ga0495620_0039376
813 Ga0495631_0000230
814 Ga0495631_0024083
815 Ga0495632_0000334
816 Ga0495632_0000931
817 Ga0495632_0002213
818 Ga0495632_0002726
819 Ga0495632_0022216
820 Ga0495637_0000016
821 Ga0495637_0000776
822 Ga0495637_0002666
823 Ga0495637_0005918
824 Ga0495643_0001663
825 Ga0495644_0003047
826 Ga0495644_0004926
827 Ga0495648_0000278
828 Ga0495648_0001176
829 Ga0495648_0007122
830 Ga0495648_0007431
831 Ga0495648_0009456
832 Ga0495648_0010105
833 Ga0495648_0027323
834 Ga0495648_0138495
835 Ga0495666_0010372
836 Ga0495666_0087737
837 Ga0495642_0000229
838 Ga0495654_0000576
839 Ga0495654_0001110
840 Ga0495654_0001278
841 Ga0495654_0003592
842 Ga0495654_0006718
843 Ga0495654_0009234
844 Ga0495654_0018515
845 Ga0495609_0000013
846 Ga0495609_0000947
847 Ga0495609_0009128
848 Ga0495609_0014454
849 Ga0495609_0020281
850 Ga0495609_0044883
851 Ga0495597_0000217
852 Ga0495597_0000568
853 Ga0495597_0001007
854 Ga0495622_0001206
855 Ga0495622_0041977
856 Ga0495622_0062974
857 Ga0495656_0002355
858 Ga0495668_0009563
859 Ga0495668_0071574
860 Ga0495634_0002050
861 Ga0495611_0000300
862 Ga0495611_0000585
863 Ga0495611_0000896
864 Ga0495625_0000052
865 Ga0495625_0000806
866 Ga0495625_0003129
867 Ga0495625_0005707
868 Ga0495625_0007633
869 Ga0495625_0008080
870 Ga0495625_0013454
871 Ga0495625_0025799
872 Ga0495625_0064099
873 Ga0495625_0250580
874 Ga0495659_0000051
875 Ga0495659_0002176
876 Ga0495661_0000001
877 Ga0495661_0000048
878 Ga0495661_0004468
879 Ga0495661_0038480
880 Ga0495661_0058978
881 Ga0495661_0098252
882 Ga0495646_0028946
883 Ga0495613_0067397
884 Ga0495624_0001345
885 Ga0495670_0000045
886 Ga0495670_0000430
887 Ga0495670_0001209
888 Ga0495670_0001808
889 Ga0495671_0002566
890 Ga0495671_0010207
891 Ga0495671_0016788
892 Ga0495671_0023810
893 Ga0495671_0045482
894 Ga0495671_0075388
895 Ga0495649_0000895
896 Ga0495649_0001499
897 Ga0495649_0001598
898 Ga0495649_0065047
899 Ga0495649_0075787
900 Ga0495589_0000057
901 Ga0495589_0000094
902 Ga0495600_0000153
903 Ga0495600_0029095
904 Ga0495660_0000287
905 Ga0495660_0001381
906 Ga0495660_0002120
907 Ga0495660_0017012
908 Ga0495660_0056549
909 Ga0495660_0060780
910 Ga0495660_0063386
911 Ga0495581_0003165
912 Ga0495636_0000444
913 Ga0495672_0000317
914 Ga0495672_0000796
915 Ga0495672_0002027
916 Ga0495672_0002251
917 Ga0495672_0002351
918 Ga0495672_0005856
919 Ga0495672_0012341
920 Ga0495672_0027453
921 Ga0495676_0000001
922 Ga0495676_0003234
923 Ga0495680_0054801
924 Ga0495683_0002284
925 Ga0495683_0027322
926 Ga0495683_0050521
927 Ga0495687_000590
928 Ga0495687_003396
929 Ga0495679_001898
930 Ga0495673_0000231
931 Ga0495673_0001683
932 Ga0495673_0005671
933 Ga0495673_0018602
934 Ga0495673_0026584
935 Ga0495673_0046192
936 Ga0495681_0000802
937 Ga0495681_0002590
938 Ga0495681_0021228
939 Ga0495681_0023005
940 Ga0495681_0029989
941 Ga0495684_0000608
942 Ga0495593_0010963
943 Ga0495593_0011575
944 Ga0495602_0026168
945 Ga0495626_0000008
946 Ga0495626_0000368
947 Ga0495626_0000537
948 Ga0495626_0002871
949 Ga0495626_0004167
950 Ga0495626_0009182
951 Ga0495626_0012916
952 Ga0496102_0311693
953 Ga0496106_0087019
954 Ga0496116_0001196
955 Ga0496116_0001263
956 Ga0496116_0001813
957 Ga0496116_0004076
958 Ga0496116_0178336
959 Ga0496117_0004196
960 Ga0496117_0040347
961 Ga0496117_0043760
962 Ga0496118_0005723
963 Ga0496118_0048020
964 Ga0496118_0054352
965 Ga0496118_0087997
966 Ga0496119_0098569
967 Ga0496120_0061869
968 Ga0496120_0097213
969 Ga0496121_0001354
970 Ga0496121_0001691
971 Ga0496121_0002367
972 Ga0496121_0008796
973 Ga0496121_0050613
974 Ga0496122_0002501
975 Ga0496122_0060923
976 Ga0496122_0083842
977 Ga0496123_0020449
978 Ga0496123_0027882
979 Ga0496124_0000272
980 Ga0496124_0026711
981 Ga0496124_0045351
982 Ga0496124_0052252
983 Ga0496124_0102112
984 Ga0496125_0006812
985 Ga0496125_0007483
986 Ga0496125_0085424
987 Ga0496126_0008826
988 Ga0495678_000888
989 Ga0495678_001413
990 Ga0495678_002054
991 Ga0495678_003183
992 Ga0495678_019014
993 Ga0495678_028198
994 Ga0495678_081163
995 Ga0495682_0000557
996 Ga0495682_0003666
997 Ga0495682_0007471
998 Ga0495682_0031395
999 Ga0501226_000826
1000 nmdc:mga03683_27635_c1
1001 nmdc:mga03683_55567_c1
1002 nmdc:mga00v17_129965_c1
1003 nmdc:mga00v17_135222_c1
1004 nmdc:mga00v17_5587_c1
1005 Ga0500586_008480
1006 2511255210
1007 2511264292
1008 2511274198
1009 2511290264
1010 2511293173
1011 2511368647
1012 2511414184
1013 2512327495
1014 2583791844
1015 2597858593
1016 2599488100
1017 2599611389
1018 2599803187
1019 2599967925
1020 2599976865
1021 2600011034
1022 2600037371
1023 2600057337
1024 2600362457
1025 2601799494
1026 2606078272
1027 2606130380
1028 2621300526
1029 2624480462
1030 2624491695
1031 2643870415
1032 2644159782
1033 2644188545
1034 2644286738
1035 2671769191
1036 2678262809
1037 2715759376
1038 2738673190
1039 2738751583
1040 2738860624
1041 2739197171
1042 2739311677
1043 2745009145
1044 2774134206
1045 2784264013
1046 2794596719
1047 2808940731
1048 2817490398
1049 2819598042
1050 2819657914
1051 2825651566
1052 2831269032
1053 2838058458
1054 2842679498
1055 2844671002
1056 2852657907
1057 2854605706
1058 2857576966
1059 2871277107
1060 2878032396
1061 2880233922
1062 2891637189
1063 2899929461
1064 2904459171
1065 2904523221
1066 2913038785
1067 2919065246
1068 2919462528
1069 2919697881
1070 2928040095
1071 2928047156
1072 2928057641
1073 2928067977
1074 2929146241
1075 2929523971
1076 2931370396
1077 2945972769
1078 2969307271
1079 2988733764
1080 3007317785
1081 3007423806
1082 3007615123
1083 3007870072
1084 8015691332
1085 8019778553
1086 8055774510
1087 8056145175
1088 8056154834
1089 8056158006
1090 8056574100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

217

293

0.97

PF06719

AraC_N

AraC-type transcriptional regulator N-terminus

36

183

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u8b-assembly1.cif.gz_A crystal structure of the methylated n-ada/dna complex 0.79 241 302
2ic1-assembly1.cif.gz_A crystal structure of human cysteine dioxygenase in complex with substrate cysteine 0.7445 38 109
2pyt-assembly1.cif.gz_B crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution 0.7439 38 110
6xb9-assembly1.cif.gz_F-2 crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.7308 38 110
6xb9-assembly6.cif.gz_L crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.7308 38 110
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9432 254 297 1.10.10.60
3lsgC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9167 254 297 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9157 255 297 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9082 246 301 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9026 254 295 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A455UA82-F1-model_v4 Transcription regulator HTH AraC N-terminal domain-containing protein 0.9098 1 182 GO:0006355
AF-A0A4V1V7Z5-F1-model_v4 deleted 0.9018 18 120
AF-A0A4V1V7Z5-F1-model_v4 deleted 0.8778 18 120
AF-A0A2N7SGC7-F1-model_v4 deleted 0.8771 13 206
AF-A0A455UA82-F1-model_v4 Transcription regulator HTH AraC N-terminal domain-containing protein 0.8652 1 182 GO:0006355

Map