F461804

General Info

Members Datasets Scaffolds Average Seq Length
544 487 220 215

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2841734538|2841736482
Length 244
Sequence SGPRGRLKASKRPLRVQSNRTIQGQTGMKLFFSRNPNPRLAVAVARYLNAKVEFEFASPFAPGQAERFRPLNPNLSLPILVGSGKSLWEADAIACRLSRDAHSDLWRTGDDEPEMIRWLSWGKENFARACDVVHFERGTKQRYGLGPIDQDRVEEGLRDFRTAAATLEAALSDREWLVENSVSYADFRMATFLPFNDVARLPLADYPSVGRWYRQFEEIDAWRDPFKGLDAPELPPVPAQAKPA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
9 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
14 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
15 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
23 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
24 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
25 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
26 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
27 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
28 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
29 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
30 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
31 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
32 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
33 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
34 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
35 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
36 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
37 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
38 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
39 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
40 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
41 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
42 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
43 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
44 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
45 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
46 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
47 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
48 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
49 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
50 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
51 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
52 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
53 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
54 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
55 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
56 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
57 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
58 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
59 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
60 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
61 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
62 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
63 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
64 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
65 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
66 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
67 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
68 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
69 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
70 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
71 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
72 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
73 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
74 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
75 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
76 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
77 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
78 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
79 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
80 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
81 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
82 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
83 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
84 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
85 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
86 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
87 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
88 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
89 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
90 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
91 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
92 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
93 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
94 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
95 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
96 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
97 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
98 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
99 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
100 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
101 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
102 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
103 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
104 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
105 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
106 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
107 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
108 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
109 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
110 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
111 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
112 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
113 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
114 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
115 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
116 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
117 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
118 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
119 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
120 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
121 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
122 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
123 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
124 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
125 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
126 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
127 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
128 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
129 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
130 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
131 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
132 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
133 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
134 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
135 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
136 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
137 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
138 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
139 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
140 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
141 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
142 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
143 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
144 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
145 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
146 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
147 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
148 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
149 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
150 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
151 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
152 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
153 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
154 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
155 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
156 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
157 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
158 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
159 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
160 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
161 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
162 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
163 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
164 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
165 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
166 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
167 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
168 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
169 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
170 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
171 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
172 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
173 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
174 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
175 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
176 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
177 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
178 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
179 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
180 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
181 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
182 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
183 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
184 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
185 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
186 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
187 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
188 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
189 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
190 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
191 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
192 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
193 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
194 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
195 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
196 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
197 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
198 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
199 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
200 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
201 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
202 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
203 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
204 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
205 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
206 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
207 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
208 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
209 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
210 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
211 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
212 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
213 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
214 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
215 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
216 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
217 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
218 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
219 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
220 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
221 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
222 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
223 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
224 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
225 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
226 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
227 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
228 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
229 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
230 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
231 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
232 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
233 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
234 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
235 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
236 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
237 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
238 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
239 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
240 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
241 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
242 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
243 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
244 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
245 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
246 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
247 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
248 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
249 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
250 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
251 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
252 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
253 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
254 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
255 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
256 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
257 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
258 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
259 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
260 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
261 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
262 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
263 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
264 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
265 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
266 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
267 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
268 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
269 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
270 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
271 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
272 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
273 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
274 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
275 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
276 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
277 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
278 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
279 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
280 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
281 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
282 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
283 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
284 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
285 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
286 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
287 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
288 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
289 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
290 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
291 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
292 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
293 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
294 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
295 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
296 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
297 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
298 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
299 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
300 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
301 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
302 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
303 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
304 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
305 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
306 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
307 3004167301 Mesorhizobium loti 582 Isolate Unclassified
308 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
309 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
310 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
311 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
312 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
313 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
314 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
315 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
316 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
317 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
318 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
319 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
320 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
321 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
322 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
323 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
324 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
325 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
326 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
327 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
328 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
329 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
330 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
331 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
332 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
333 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
334 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
335 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
336 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
337 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
338 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
339 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
340 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
341 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
342 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
343 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
344 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
345 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
346 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
347 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
348 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
349 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
350 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
351 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
352 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
353 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
354 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
355 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
356 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
357 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
358 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
359 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
360 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
361 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
362 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
364 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
365 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
367 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
390 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
391 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
392 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
394 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
395 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
396 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
397 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
398 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
399 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
400 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
401 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
402 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
403 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
404 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
405 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
406 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
407 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
408 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
409 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
410 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
411 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
412 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
413 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
414 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
415 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
416 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
417 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
418 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
419 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
420 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
421 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
422 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
423 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
424 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
425 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
426 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
427 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
428 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
429 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
430 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
431 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
432 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
433 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
434 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
435 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
436 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
437 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
438 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
439 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
440 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
441 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
442 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
443 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
444 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
445 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
446 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
447 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
448 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
450 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
451 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
452 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
453 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
454 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
455 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
456 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
457 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
458 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
459 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
460 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
461 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
462 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
463 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
466 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
467 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
468 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
469 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
470 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
471 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
472 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
473 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
474 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
475 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
476 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
477 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
478 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
479 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
480 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
481 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
482 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
483 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
484 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
485 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
486 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
487 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.44
Metatranscriptomes 0
Isolates 59.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 58.46
Rhizoplane 1.47
Rhizosphere 28.86
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002068 3300001989 Bacteria 7683
2 JGI24737J22298_10000689 3300001990 Bacteria 11862
3 JGI24737J22298_10032812 3300001990 Unclassified 1615
4 JGI24735J21928_10001660 3300002067 Bacteria 7884
5 JGI24735J21928_10085130 3300002067 Bacteria 906
6 JGI24738J21930_10000106 3300002075 Bacteria 19367
7 JGI24738J21930_10028069 3300002075 Bacteria 1152
8 JGI25153J46596_10000016 3300003215 Bacteria 285917
9 rootH1_10131574 3300003316 Bacteria 2040
10 Ga0055542_1002943 3300003762 Bacteria 5008
11 Ga0055529_1005030 3300003763 Bacteria 1954
12 Ga0070658_10005327 3300005327 Bacteria 10443
13 Ga0070658_10039621 3300005327 Bacteria 3801
14 Ga0070658_10323763 3300005327 Bacteria 1316
15 Ga0068868_100479562 3300005338 Bacteria 1086
16 Ga0070660_100004014 3300005339 Bacteria 10161
17 Ga0070674_100006199 3300005356 Bacteria 6958
18 Ga0070673_100150821 3300005364 Bacteria 1969
19 Ga0070659_100018813 3300005366 Bacteria 5216
20 Ga0070659_100238009 3300005366 Bacteria 1505
21 Ga0070667_100029453 3300005367 Bacteria 4574
22 Ga0070700_100143313 3300005441 Bacteria 1626
23 Ga0070662_100047876 3300005457 Bacteria 3078
24 Ga0070662_100084832 3300005457 Bacteria 2366
25 Ga0068853_100097725 3300005539 Bacteria 2592
26 Ga0070665_100101791 3300005548 Bacteria 2877
27 Ga0068855_100000027 3300005563 Bacteria 173316
28 Ga0068855_100057275 3300005563 Bacteria 4569
29 Ga0068857_100838437 3300005577 Bacteria 879
30 Ga0068854_100000257 3300005578 Bacteria 36219
31 Ga0068852_100201579 3300005616 Bacteria 1883
32 Ga0075365_10033595 3300006038 Bacteria 3307
33 Ga0075368_10045913 3300006042 Bacteria 1727
34 Ga0075363_100037612 3300006048 Bacteria 2542
35 Ga0075364_10014909 3300006051 Bacteria 4810
36 Ga0075370_10026436 3300006353 Bacteria 3216
37 Ga0075370_10134673 3300006353 Bacteria 1443
38 Ga0068871_100034956 3300006358 Bacteria 3991
39 Ga0079104_1020146 3300006946 Bacteria 1845
40 Ga0099826_10131978 3300006948 Bacteria 1455
41 Ga0105240_10022319 3300009093 Bacteria 8395
42 Ga0105240_10416269 3300009093 Bacteria 1511
43 Ga0105245_10297512 3300009098 Bacteria 1582
44 Ga0105243_10432802 3300009148 Bacteria 1230
45 Ga0105238_10384365 3300009551 Bacteria 1395
46 Ga0105238_11090982 3300009551 Bacteria 821
47 Ga0105239_10038914 3300010375 Bacteria 5209
48 Ga0105239_10754459 3300010375 Bacteria 1114
49 Ga0157373_10534074 3300013100 Bacteria 849
50 Ga0157371_10137293 3300013102 Bacteria 1741
51 Ga0157370_10000008 3300013104 Bacteria 240668
52 Ga0157370_10067601 3300013104 Bacteria 3378
53 Ga0157369_10035476 3300013105 Bacteria 5468
54 Ga0157369_10168241 3300013105 Bacteria 2311
55 Ga0157369_10209990 3300013105 Bacteria 2041
56 Ga0157369_10817275 3300013105 Bacteria 957
57 Ga0157374_10571545 3300013296 Bacteria 1139
58 Ga0157374_11199312 3300013296 Bacteria 780
59 Ga0163162_10351024 3300013306 Bacteria 1608
60 Ga0157372_10005420 3300013307 Bacteria 13558
61 Ga0157372_10134750 3300013307 Bacteria 2844
62 Ga0157372_10556155 3300013307 Unclassified 1337
63 Ga0157372_10681124 3300013307 Bacteria 1197
64 Ga0182008_10111470 3300014497 Bacteria 1356
65 Ga0182007_10119031 3300015262 Bacteria 883
66 Ga0163161_10118456 3300017792 Bacteria 1987
67 Ga0228711_1000006 3300022739 Bacteria 202437
68 Ga0228710_1000004 3300022740 Bacteria 250560
69 Ga0209148_1000037 3300025254 Bacteria 494767
70 Ga0209148_1000116 3300025254 Bacteria 190078
71 Ga0209759_1037275 3300025256 Bacteria 876
72 Ga0209233_1004658 3300025261 Bacteria 4632
73 Ga0209455_1000036 3300025272 Bacteria 473309
74 Ga0209758_1000035 3300025297 Bacteria 448190
75 Ga0207688_10149929 3300025901 Bacteria 1377
76 Ga0207647_10001519 3300025904 Bacteria 17826
77 Ga0207647_10015094 3300025904 Bacteria 5306
78 Ga0207647_10026247 3300025904 Bacteria 3814
79 Ga0207705_10001961 3300025909 Bacteria 16049
80 Ga0207705_10177897 3300025909 Bacteria 1604
81 Ga0207695_10285650 3300025913 Bacteria 1543
82 Ga0207695_10342087 3300025913 Bacteria 1383
83 Ga0207695_10492091 3300025913 Bacteria 1108
84 Ga0207671_10069201 3300025914 Bacteria 2631
85 Ga0207657_10000273 3300025919 Bacteria 54891
86 Ga0207649_10440242 3300025920 Bacteria 982
87 Ga0207664_10322113 3300025929 Bacteria 1364
88 Ga0207690_10175503 3300025932 Bacteria 1609
89 Ga0207706_10008114 3300025933 Bacteria 9690
90 Ga0207706_10008313 3300025933 Bacteria 9569
91 Ga0207706_10031913 3300025933 Bacteria 4693
92 Ga0207669_10001641 3300025937 Bacteria 9503
93 Ga0207704_10196675 3300025938 Bacteria 1471
94 Ga0207667_10000013 3300025949 Bacteria 435875
95 Ga0207667_10046380 3300025949 Bacteria 4601
96 Ga0207667_10101933 3300025949 Bacteria 2961
97 Ga0207640_10000369 3300025981 Bacteria 29179
98 Ga0207640_10169362 3300025981 Bacteria 1626
99 Ga0207658_10042267 3300025986 Bacteria 3305
100 Ga0207639_11147865 3300026041 Bacteria 729
101 Ga0207678_10633860 3300026067 Bacteria 938
102 Ga0207708_11010196 3300026075 Bacteria 723
103 Ga0207702_10107483 3300026078 Bacteria 2474
104 Ga0207674_10839799 3300026116 Bacteria 886
105 Ga0207683_10134361 3300026121 Bacteria 2226
106 Ga0207698_10179704 3300026142 Bacteria 1873
107 Ga0209281_1000102 3300027111 Bacteria 221665
108 Ga0209281_1000563 3300027111 Bacteria 44757
109 Ga0209282_1000013 3300027666 Bacteria 215053
110 Ga0209813_10040525 3300027866 Bacteria 1416
111 Ga0268266_10152204 3300028379 Bacteria 2086
112 Ga0307517_10087294 3300028786 Bacteria 2593
113 Ga0314311_1113666 3300030733 Bacteria 1779
114 Ga0307509_10000007 3300031507 Bacteria 409278
115 Ga0307408_100311917 3300031548 Bacteria 1322
116 Ga0307410_10087108 3300031852 Bacteria 2208
117 Ga0315914_1000004 3300031967 Bacteria 288534
118 Ga0307510_10302883 3300033180 Bacteria 1060
119 Ga0315913_1000055 3300033430 Bacteria 58182
120 Ga0315915_1000003 3300033464 Bacteria 407996
121 Ga0373936_0140621 3300035113 Bacteria 1042
122 Ga0395900_0139097 3300037418 Bacteria 2487
123 Ga0395900_0498801 3300037418 Bacteria 1168
124 Ga0395898_0087403 3300037466 Bacteria 3003
125 Ga0395898_0179416 3300037466 Bacteria 2024
126 Ga0395898_0327863 3300037466 Bacteria 1460
127 Ga0395905_0079719 3300037471 Bacteria 3069
128 Ga0395905_0113459 3300037471 Bacteria 2546
129 Ga0395905_0291746 3300037471 Bacteria 1518
130 Ga0439436_0007839 3300041404 Bacteria 3282
131 Ga0439431_0030910 3300041997 Bacteria 1329
132 Ga0439448_0008687 3300042005 Bacteria 2976
133 Ga0439455_0015566 3300042012 Bacteria 1749
134 Ga0439458_0001350 3300042157 Bacteria 6184
135 Ga0466965_0008536 3300044683 Bacteria 4739
136 Ga0466966_0015382 3300044684 Bacteria 5059
137 Ga0466970_0001267 3300044765 Bacteria 12216
138 Ga0466959_0113694 3300045049 Bacteria 1930
139 Ga0466959_0463451 3300045049 Bacteria 858
140 Ga0466958_0038843 3300045836 Bacteria 2857
141 Ga0495638_0152129 3300046460 Bacteria 1342
142 Ga0495650_0000370 3300046471 Bacteria 78408
143 Ga0495584_0057052 3300046491 Bacteria 1965
144 Ga0495584_0061769 3300046491 Bacteria 1883
145 Ga0495585_0002508 3300046492 Bacteria 13062
146 Ga0495596_0011295 3300046500 Bacteria 3857
147 Ga0495583_0047339 3300046506 Bacteria 1978
148 Ga0495606_0000486 3300046507 Bacteria 64993
149 Ga0495606_0079489 3300046507 Bacteria 2042
150 Ga0495620_0135030 3300046515 Bacteria 967
151 Ga0495637_0082197 3300046520 Bacteria 1283
152 Ga0495643_0001290 3300046522 Bacteria 23913
153 Ga0495643_0004613 3300046522 Bacteria 9592
154 Ga0495643_0012762 3300046522 Bacteria 5055
155 Ga0495643_0035721 3300046522 Bacteria 2735
156 Ga0495648_0000069 3300046524 Bacteria 136934
157 Ga0495663_0000132 3300046525 Bacteria 30593
158 Ga0495663_0000842 3300046525 Bacteria 10470
159 Ga0495642_0007884 3300046528 Bacteria 4079
160 Ga0495654_0155959 3300046530 Bacteria 1006
161 Ga0495622_0057422 3300046557 Bacteria 1804
162 Ga0495633_0001965 3300046558 Bacteria 14904
163 Ga0495633_0214855 3300046558 Bacteria 881
164 Ga0495668_0000109 3300046616 Bacteria 132453
165 Ga0495668_0043026 3300046616 Bacteria 2513
166 Ga0495611_0017553 3300046648 Bacteria 3062
167 Ga0495625_0000341 3300046660 Bacteria 71410
168 Ga0495625_0020589 3300046660 Bacteria 5089
169 Ga0495625_0051719 3300046660 Bacteria 2944
170 Ga0495625_0145161 3300046660 Bacteria 1598
171 Ga0495625_0316280 3300046660 Bacteria 995
172 Ga0495625_0395242 3300046660 Bacteria 865
173 Ga0495588_0387695 3300046674 Bacteria 734
174 Ga0495669_0000038 3300046684 Bacteria 93166
175 Ga0495670_0054960 3300046691 Bacteria 1996
176 Ga0495649_0061784 3300046694 Bacteria 2014
177 Ga0495649_0096364 3300046694 Bacteria 1574
178 Ga0495600_0001349 3300046809 Bacteria 13535
179 Ga0495660_0056149 3300046810 Bacteria 2129
180 Ga0495683_0020319 3300047323 Bacteria 3426
181 Ga0495683_0042501 3300047323 Bacteria 2291
182 Ga0495687_000045 3300047443 Bacteria 211968
183 Ga0495687_000089 3300047443 Bacteria 141448
184 Ga0495677_0026991 3300047445 Bacteria 2083
185 Ga0495681_0003732 3300047470 Bacteria 10552
186 Ga0496102_0000067 3300048905 Bacteria 156790
187 Ga0496103_0002686 3300048906 Bacteria 11110
188 Ga0496104_0672324 3300048907 Bacteria 944
189 Ga0496105_0231252 3300048908 Bacteria 1502
190 Ga0496110_0028006 3300048913 Bacteria 4835
191 Ga0496112_0055207 3300048915 Bacteria 3905
192 Ga0496114_0005723 3300048917 Bacteria 9751
193 Ga0496115_0000358 3300048918 Bacteria 38210
194 Ga0496116_0004336 3300048919 Bacteria 13570
195 Ga0496117_0000114 3300048920 Bacteria 180658
196 Ga0496118_0000082 3300048921 Bacteria 185820
197 Ga0496120_0028073 3300048923 Bacteria 3453
198 Ga0496120_0095795 3300048923 Bacteria 1577
199 Ga0496121_0000758 3300048924 Bacteria 59289
200 Ga0496124_0000068 3300048927 Bacteria 221819
201 Ga0496126_0000157 3300048929 Bacteria 156203
202 nmdc:mga03n38_60445_c1 3300050490 Bacteria 1723
203 nmdc:mga0yw44_43498_c1 3300050492 Bacteria 2682
204 nmdc:mga0yw44_73766_c1 3300050492 Bacteria 2124
205 nmdc:mga0k408_201683_c1 3300050493 Bacteria 1187
206 nmdc:mga06z11_319072_c1 3300050494 Bacteria 926
207 nmdc:mga04h51_48544_c1 3300050495 Bacteria 1415
208 nmdc:mga07m45_74384_c1 3300050496 Bacteria 1935
209 Ga0500610_0000318 3300053079 Bacteria 14494
210 Ga0500554_062488 3300053102 Bacteria 1198
211 Ga0500595_022053 3300053119 Bacteria 2262
212 Ga0500595_065654 3300053119 Bacteria 1086
213 Ga0500614_046100 3300053123 Bacteria 1127
214 Ga0500642_0024047 3300053130 Bacteria 2455
215 Ga0500658_0024701 3300053134 Unclassified 2304
216 Ga0500577_0100041 3300053142 Bacteria 1184
217 Ga0500619_013742 3300053154 Bacteria 2156
218 Ga0500620_000058 3300053155 Bacteria 20321
219 Ga0500611_018512 3300053727 Bacteria 1286
220 Ga0500645_000008 3300053730 Bacteria 212254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053134 Ga0500658_0024701 Ga0500658_0024701_497_1174 192
2 iso_pu_bacteria 2876399893 2876403347 197
3 iso_pu_bacteria 2970524798 2970526189 205
4 3300005327 Ga0070658_10323763 Ga0070658_103237631 206
5 3300006038 Ga0075365_10033595 Ga0075365_100335955 206
6 3300009098 Ga0105245_10297512 Ga0105245_102975122 206
7 3300005563 Ga0068855_100000027 Ga0068855_10000002711 208
8 3300025949 Ga0207667_10000013 Ga0207667_10000013238 208
9 iso_pu_bacteria 2597489875 2597810757 208
10 iso_pu_bacteria 2643221627 2644155715 208
11 iso_pu_bacteria 2643221634 2644192180 208
12 iso_pu_bacteria 2791355123 2792752911 208
13 iso_pu_bacteria 2888343758 2888344470 208
14 iso_pu_bacteria 3004167301 3004170094 208
15 3300042005 Ga0439448_0008687 Ga0439448_0008687_1347_1979 209
16 iso_pu_bacteria 2508501127 2509144456 209
17 iso_pu_bacteria 2509276018 2509373198 209
18 iso_pu_bacteria 2510065057 2510307143 209
19 iso_pu_bacteria 2510065059 2510317158 209
20 iso_pu_bacteria 2511231052 2511498710 209
21 iso_pu_bacteria 2512047086 2512534847 209
22 iso_pu_bacteria 2512875026 2512973325 209
23 iso_pu_bacteria 2513237086 2513587030 209
24 iso_pu_bacteria 2513237089 2513603680 209
25 iso_pu_bacteria 2513237091 2513619448 209
26 iso_pu_bacteria 2513237140 2513886046 209
27 iso_pu_bacteria 2513237143 2513904384 209
28 iso_pu_bacteria 2513237160 2514005920 209
29 iso_pu_bacteria 2515154107 2515607150 209
30 iso_pu_bacteria 2516653046 2516894987 209
31 iso_pu_bacteria 2517487022 2517571672 209
32 iso_pu_bacteria 2524023207 2524452599 209
33 iso_pu_bacteria 2551306084 2551675568 209
34 iso_pu_bacteria 2551306085 2551685317 209
35 iso_pu_bacteria 2551306086 2551695938 209
36 iso_pu_bacteria 2551306087 2551699566 209
37 iso_pu_bacteria 2551306089 2551713105 209
38 iso_pu_bacteria 2551306090 2551716943 209
39 iso_pu_bacteria 2551306091 2551728268 209
40 iso_pu_bacteria 2551306092 2551734130 209
41 iso_pu_bacteria 2551306093 2551740252 209
42 iso_pu_bacteria 2582581866 2585392429 209
43 iso_pu_bacteria 2643221595 2643987165 209
44 iso_pu_bacteria 2687453392 2688599162 209
45 iso_pu_bacteria 2802428858 2802721254 209
46 iso_pu_bacteria 2802428859 2802724567 209
47 iso_pu_bacteria 2802428860 2802729766 209
48 iso_pu_bacteria 2802428861 2802737112 209
49 iso_pu_bacteria 2802428862 2802746875 209
50 iso_pu_bacteria 2802428863 2802751729 209
51 iso_pu_bacteria 2844002411 2844006697 209
52 iso_pu_bacteria 2844009547 2844014339 209
53 iso_pu_bacteria 2855825444 2855827622 209
54 iso_pu_bacteria 2856328259 2856329111 209
55 iso_pu_bacteria 2856334872 2856341976 209
56 iso_pu_bacteria 2856342000 2856348645 209
57 iso_pu_bacteria 2858800743 2858801953 209
58 iso_pu_bacteria 2869169390 2869175930 209
59 iso_pu_bacteria 2869249662 2869252233 209
60 iso_pu_bacteria 2869264136 2869268160 209
61 iso_pu_bacteria 2869271264 2869278028 209
62 iso_pu_bacteria 2871435913 2871443483 209
63 iso_pu_bacteria 2871459585 2871460138 209
64 iso_pu_bacteria 2871466892 2871467705 209
65 iso_pu_bacteria 2871474448 2871475147 209
66 iso_pu_bacteria 2871481445 2871481973 209
67 iso_pu_bacteria 2874162495 2874164160 209
68 iso_pu_bacteria 2876386047 2876386575 209
69 iso_pu_bacteria 2876420981 2876422231 209
70 iso_pu_bacteria 2878730984 2878737195 209
71 iso_pu_bacteria 2878774303 2878777811 209
72 iso_pu_bacteria 2878781027 2878781094 209
73 iso_pu_bacteria 2885312484 2885314023 209
74 iso_pu_bacteria 2903513507 2903520182 209
75 iso_pu_bacteria 2906363423 2906365564 209
76 iso_pu_bacteria 2906370794 2906375488 209
77 iso_pu_bacteria 2906378014 2906378299 209
78 iso_pu_bacteria 2906386501 2906392329 209
79 iso_pu_bacteria 2906401398 2906402118 209
80 iso_pu_bacteria 2906408224 2906414347 209
81 iso_pu_bacteria 2915980308 2915983209 209
82 iso_pu_bacteria 2915993759 2915998936 209
83 iso_pu_bacteria 2916000859 2916002887 209
84 iso_pu_bacteria 2916007675 2916011235 209
85 iso_pu_bacteria 2916014648 2916018745 209
86 iso_pu_bacteria 2916021584 2916025405 209
87 iso_pu_bacteria 2916028427 2916032215 209
88 iso_pu_bacteria 2916035215 2916038112 209
89 iso_pu_bacteria 2916041962 2916042362 209
90 iso_pu_bacteria 2916048683 2916050087 209
91 iso_pu_bacteria 2916055098 2916059009 209
92 iso_pu_bacteria 2916061851 2916063520 209
93 iso_pu_bacteria 2916068649 2916075089 209
94 iso_pu_bacteria 2916076590 2916078502 209
95 iso_pu_bacteria 2921201388 2921206384 209
96 iso_pu_bacteria 2921208531 2921211246 209
97 iso_pu_bacteria 2921237296 2921241206 209
98 iso_pu_bacteria 2921244191 2921249364 209
99 iso_pu_bacteria 2921250672 2921256205 209
100 iso_pu_bacteria 2921257292 2921258750 209
101 iso_pu_bacteria 2921263974 2921268229 209
102 iso_pu_bacteria 2921282425 2921285266 209
103 iso_pu_bacteria 2921289301 2921293416 209
104 iso_pu_bacteria 2921296804 2921301111 209
105 iso_pu_bacteria 2922151315 2922153760 209
106 iso_pu_bacteria 2922172374 2922173090 209
107 iso_pu_bacteria 2922178524 2922184432 209
108 iso_pu_bacteria 2924144063 2924147848 209
109 iso_pu_bacteria 2924150972 2924151911 209
110 iso_pu_bacteria 2924158325 2924163291 209
111 iso_pu_bacteria 2924165586 2924171104 209
112 iso_pu_bacteria 2924172951 2924178483 209
113 iso_pu_bacteria 2924179722 2924184998 209
114 iso_pu_bacteria 2924186466 2924192103 209
115 iso_pu_bacteria 2924193448 2924196290 209
116 iso_pu_bacteria 2924200457 2924203994 209
117 iso_pu_bacteria 2924207177 2924210660 209
118 iso_pu_bacteria 2924214083 2924219970 209
119 iso_pu_bacteria 2924221636 2924225552 209
120 iso_pu_bacteria 2924228884 2924232390 209
121 iso_pu_bacteria 2924710171 2924714887 209
122 iso_pu_bacteria 2924748358 2924752118 209
123 iso_pu_bacteria 2924754689 2924758067 209
124 iso_pu_bacteria 2936996657 2936998863 209
125 iso_pu_bacteria 2937002841 2937007127 209
126 iso_pu_bacteria 2937009748 2937013260 209
127 iso_pu_bacteria 2937016420 2937019950 209
128 iso_pu_bacteria 2937023124 2937025546 209
129 iso_pu_bacteria 2937029754 2937032512 209
130 iso_pu_bacteria 2937036028 2937039175 209
131 iso_pu_bacteria 2937042894 2937043217 209
132 iso_pu_bacteria 2937049772 2937053154 209
133 iso_pu_bacteria 2937056579 2937061970 209
134 iso_pu_bacteria 2937063883 2937065704 209
135 iso_pu_bacteria 2937071275 2937075751 209
136 iso_pu_bacteria 2937078374 2937084046 209
137 iso_pu_bacteria 2937084907 2937087341 209
138 iso_pu_bacteria 2937091812 2937097662 209
139 iso_pu_bacteria 2937098957 2937105829 209
140 iso_pu_bacteria 2937106411 2937111194 209
141 iso_pu_bacteria 2937113482 2937115941 209
142 iso_pu_bacteria 2937119839 2937123515 209
143 iso_pu_bacteria 2937126314 2937129162 209
144 iso_pu_bacteria 2937836603 2937838942 209
145 iso_pu_bacteria 2937868953 2937874575 209
146 iso_pu_bacteria 2957375807 2957378140 209
147 iso_pu_bacteria 2957382221 2957386324 209
148 iso_pu_bacteria 2957388812 2957392675 209
149 iso_pu_bacteria 2957395598 2957401634 209
150 iso_pu_bacteria 2957402308 2957404959 209
151 iso_pu_bacteria 2957408893 2957411940 209
152 iso_pu_bacteria 2957415311 2957417138 209
153 iso_pu_bacteria 2957422303 2957427984 209
154 iso_pu_bacteria 2957430029 2957433006 209
155 iso_pu_bacteria 2957437181 2957439241 209
156 iso_pu_bacteria 2957443900 2957446575 209
157 iso_pu_bacteria 2957450854 2957455832 209
158 iso_pu_bacteria 2957457609 2957461200 209
159 iso_pu_bacteria 2957464669 2957467684 209
160 iso_pu_bacteria 2957471148 2957471797 209
161 iso_pu_bacteria 2957478035 2957483176 209
162 iso_pu_bacteria 2957484790 2957486977 209
163 iso_pu_bacteria 2957491536 2957493847 209
164 iso_pu_bacteria 2957498199 2957502327 209
165 iso_pu_bacteria 2957505466 2957506292 209
166 iso_pu_bacteria 2958071322 2958075340 209
167 iso_pu_bacteria 2958108152 2958108946 209
168 iso_pu_bacteria 2958122699 2958128366 209
169 iso_pu_bacteria 2958137437 2958143978 209
170 iso_pu_bacteria 2958158011 2958164565 209
171 iso_pu_bacteria 2960584000 2960587198 209
172 iso_pu_bacteria 2960591022 2960593045 209
173 iso_pu_bacteria 2960597568 2960601176 209
174 iso_pu_bacteria 2960603979 2960608165 209
175 iso_pu_bacteria 2960610863 2960612275 209
176 iso_pu_bacteria 2960617483 2960620256 209
177 iso_pu_bacteria 2960624210 2960626015 209
178 iso_pu_bacteria 2960631154 2960635496 209
179 iso_pu_bacteria 2960637947 2960643900 209
180 iso_pu_bacteria 2960645483 2960651961 209
181 iso_pu_bacteria 2960652885 2960655939 209
182 iso_pu_bacteria 2960660292 2960663086 209
183 iso_pu_bacteria 2960667422 2960671327 209
184 iso_pu_bacteria 2960674078 2960678036 209
185 iso_pu_bacteria 2960680706 2960683815 209
186 iso_pu_bacteria 2960687367 2960689230 209
187 iso_pu_bacteria 2960693952 2960697049 209
188 iso_pu_bacteria 2961136820 2961143181 209
189 iso_pu_bacteria 2961183825 2961186625 209
190 iso_pu_bacteria 2964607997 2964613676 209
191 iso_pu_bacteria 2964615318 2964616372 209
192 iso_pu_bacteria 2964621998 2964625352 209
193 iso_pu_bacteria 2964628898 2964632046 209
194 iso_pu_bacteria 2964636051 2964640469 209
195 iso_pu_bacteria 2964643177 2964647367 209
196 iso_pu_bacteria 2964649959 2964653741 209
197 iso_pu_bacteria 2964656573 2964662414 209
198 iso_pu_bacteria 2964663802 2964667427 209
199 iso_pu_bacteria 2964678106 2964684967 209
200 iso_pu_bacteria 2964685014 2964687818 209
201 iso_pu_bacteria 2964691889 2964695723 209
202 iso_pu_bacteria 2964698721 2964702359 209
203 iso_pu_bacteria 2964705432 2964708143 209
204 iso_pu_bacteria 2964712639 2964717423 209
205 iso_pu_bacteria 2964719344 2964722579 209
206 iso_pu_bacteria 2965025482 2965029264 209
207 iso_pu_bacteria 2965032056 2965036092 209
208 iso_pu_bacteria 2965040258 2965042712 209
209 iso_pu_bacteria 2965047637 2965049855 209
210 iso_pu_bacteria 2965089291 2965091069 209
211 iso_pu_bacteria 2965102966 2965107973 209
212 iso_pu_bacteria 2965110997 2965115903 209
213 iso_pu_bacteria 2967664464 2967669731 209
214 iso_pu_bacteria 2967671571 2967675229 209
215 iso_pu_bacteria 2967678726 2967684286 209
216 iso_pu_bacteria 2967686174 2967688330 209
217 iso_pu_bacteria 2967693043 2967695759 209
218 iso_pu_bacteria 2967699805 2967700220 209
219 iso_pu_bacteria 2967706974 2967711261 209
220 iso_pu_bacteria 2967714385 2967719504 209
221 iso_pu_bacteria 2967721400 2967727573 209
222 iso_pu_bacteria 2967728569 2967733937 209
223 iso_pu_bacteria 2967735183 2967738580 209
224 iso_pu_bacteria 2967742019 2967747572 209
225 iso_pu_bacteria 2967748971 2967752891 209
226 iso_pu_bacteria 2967755722 2967756440 209
227 iso_pu_bacteria 2967762386 2967765328 209
228 iso_pu_bacteria 2967769361 2967773028 209
229 iso_pu_bacteria 2967775926 2967781432 209
230 iso_pu_bacteria 2968138860 2968142140 209
231 iso_pu_bacteria 2970019648 2970025358 209
232 iso_pu_bacteria 2970026789 2970028821 209
233 iso_pu_bacteria 2970033650 2970038095 209
234 iso_pu_bacteria 2970040964 2970044382 209
235 iso_pu_bacteria 2970047711 2970054289 209
236 iso_pu_bacteria 2970054988 2970059128 209
237 iso_pu_bacteria 2970061556 2970067963 209
238 iso_pu_bacteria 2970068827 2970074323 209
239 iso_pu_bacteria 2970076120 2970080240 209
240 iso_pu_bacteria 2970082768 2970087645 209
241 iso_pu_bacteria 2970088815 2970092130 209
242 iso_pu_bacteria 2970095765 2970097852 209
243 iso_pu_bacteria 2970102677 2970104381 209
244 iso_pu_bacteria 2970109326 2970111798 209
245 iso_pu_bacteria 2970116247 2970120825 209
246 iso_pu_bacteria 2970122695 2970122900 209
247 iso_pu_bacteria 2970129317 2970132265 209
248 iso_pu_bacteria 2970136068 2970137740 209
249 iso_pu_bacteria 2970143518 2970145425 209
250 iso_pu_bacteria 2970149975 2970153760 209
251 iso_pu_bacteria 2970156795 2970163870 209
252 iso_pu_bacteria 2970164137 2970168526 209
253 iso_pu_bacteria 2970170962 2970174552 209
254 iso_pu_bacteria 2970177841 2970184378 209
255 iso_pu_bacteria 2970184632 2970190348 209
256 iso_pu_bacteria 2970191845 2970195880 209
257 iso_pu_bacteria 2970489779 2970489810 209
258 iso_pu_bacteria 2970540015 2970547083 209
259 iso_pu_bacteria 2970547951 2970551910 209
260 iso_pu_bacteria 2970619444 2970622286 209
261 iso_pu_bacteria 2970627176 2970630782 209
262 iso_pu_bacteria 2977516862 2977522220 209
263 iso_pu_bacteria 2977523885 2977525687 209
264 iso_pu_bacteria 2977530762 2977530778 209
265 iso_pu_bacteria 2977537788 2977540687 209
266 iso_pu_bacteria 2977544691 2977546805 209
267 iso_pu_bacteria 2977551784 2977557129 209
268 iso_pu_bacteria 2977558990 2977562081 209
269 iso_pu_bacteria 2977565890 2977568750 209
270 iso_pu_bacteria 2977572785 2977576780 209
271 iso_pu_bacteria 2977579622 2977582556 209
272 iso_pu_bacteria 2977872689 2977879519 209
273 iso_pu_bacteria 2977898635 2977906441 209
274 iso_pu_bacteria 2977915119 2977916043 209
275 iso_pu_bacteria 2977935797 2977937547 209
276 iso_pu_bacteria 2977950692 2977953990 209
277 iso_pu_bacteria 2977957713 2977960276 209
278 iso_pu_bacteria 2979793036 2979798513 209
279 iso_pu_bacteria 2987645492 2987647296 209
280 iso_pu_bacteria 2987673487 2987677038 209
281 iso_pu_bacteria 2996386984 2996388300 209
282 iso_pu_bacteria 3000135777 3000136490 209
283 iso_pu_bacteria 3004195979 3004202104 209
284 iso_pu_bacteria 3004239961 3004240411 209
285 iso_pu_bacteria 3004248173 3004248317 209
286 iso_pu_bacteria 648276728 648740445 209
287 iso_pu_bacteria 649633066 649873592 209
288 iso_pu_bacteria 8003992118 8003995577 209
289 iso_pu_bacteria 8003999396 8004003344 209
290 iso_pu_bacteria 8004300914 8004302198 209
291 iso_pu_bacteria 8004361976 8004367517 209
292 iso_pu_bacteria 8004395343 8004396633 209
293 iso_pu_bacteria 8004695233 8004701256 209
294 iso_pu_bacteria 8004727605 8004733128 209
295 iso_pu_bacteria 8055617313 8055618008 209
296 3300005339 Ga0070660_100004014 Ga0070660_1000040142 210
297 3300005356 Ga0070674_100006199 Ga0070674_1000061996 210
298 3300005364 Ga0070673_100150821 Ga0070673_1001508213 210
299 3300005366 Ga0070659_100018813 Ga0070659_1000188134 210
300 3300005367 Ga0070667_100029453 Ga0070667_1000294534 210
301 3300005441 Ga0070700_100143313 Ga0070700_1001433131 210
302 3300005539 Ga0068853_100097725 Ga0068853_1000977252 210
303 3300005548 Ga0070665_100101791 Ga0070665_1001017913 210
304 3300005563 Ga0068855_100057275 Ga0068855_1000572754 210
305 3300010375 Ga0105239_10038914 Ga0105239_100389141 210
306 3300013104 Ga0157370_10067601 Ga0157370_100676013 210
307 3300013105 Ga0157369_10168241 Ga0157369_101682412 210
308 3300013296 Ga0157374_10571545 Ga0157374_105715452 210
309 3300017792 Ga0163161_10118456 Ga0163161_101184562 210
310 3300025904 Ga0207647_10026247 Ga0207647_100262474 210
311 3300025914 Ga0207671_10069201 Ga0207671_100692012 210
312 3300025919 Ga0207657_10000273 Ga0207657_1000027327 210
313 3300025933 Ga0207706_10031913 Ga0207706_100319135 210
314 3300025937 Ga0207669_10001641 Ga0207669_100016412 210
315 3300025949 Ga0207667_10046380 Ga0207667_100463802 210
316 3300025986 Ga0207658_10042267 Ga0207658_100422672 210
317 3300026075 Ga0207708_11010196 Ga0207708_110101961 210
318 3300028379 Ga0268266_10152204 Ga0268266_101522043 210
319 3300033180 Ga0307510_10302883 Ga0307510_103028832 210
320 3300037471 Ga0395905_0291746 Ga0395905_0291746_842_1489 210
321 3300046471 Ga0495650_0000370 Ga0495650_0000370_37582_38229 210
322 3300046491 Ga0495584_0057052 Ga0495584_0057052_626_1273 210
323 3300046491 Ga0495584_0061769 Ga0495584_0061769_992_1711 210
324 3300046492 Ga0495585_0002508 Ga0495585_0002508_12110_12760 210
325 3300046500 Ga0495596_0011295 Ga0495596_0011295_2262_2951 210
326 3300046506 Ga0495583_0047339 Ga0495583_0047339_189_839 210
327 3300046507 Ga0495606_0000486 Ga0495606_0000486_48023_48673 210
328 3300046507 Ga0495606_0079489 Ga0495606_0079489_216_935 210
329 3300046522 Ga0495643_0001290 Ga0495643_0001290_335_982 210
330 3300046522 Ga0495643_0004613 Ga0495643_0004613_286_936 210
331 3300046522 Ga0495643_0012762 Ga0495643_0012762_4177_4824 210
332 3300046522 Ga0495643_0035721 Ga0495643_0035721_170_820 210
333 3300046524 Ga0495648_0000069 Ga0495648_0000069_58990_59637 210
334 3300046525 Ga0495663_0000842 Ga0495663_0000842_9091_9741 210
335 3300046528 Ga0495642_0007884 Ga0495642_0007884_19_669 210
336 3300046557 Ga0495622_0057422 Ga0495622_0057422_316_963 210
337 3300046558 Ga0495633_0001965 Ga0495633_0001965_1561_2208 210
338 3300046616 Ga0495668_0000109 Ga0495668_0000109_16134_16781 210
339 3300046648 Ga0495611_0017553 Ga0495611_0017553_2182_2826 210
340 3300046660 Ga0495625_0000341 Ga0495625_0000341_49428_50147 210
341 3300046660 Ga0495625_0051719 Ga0495625_0051719_1918_2565 210
342 3300046660 Ga0495625_0145161 Ga0495625_0145161_774_1421 210
343 3300046660 Ga0495625_0316280 Ga0495625_0316280_88_735 210
344 3300046684 Ga0495669_0000038 Ga0495669_0000038_57676_58323 210
345 3300046691 Ga0495670_0054960 Ga0495670_0054960_1181_1828 210
346 3300046694 Ga0495649_0061784 Ga0495649_0061784_1135_1782 210
347 3300046694 Ga0495649_0096364 Ga0495649_0096364_280_930 210
348 3300046809 Ga0495600_0001349 Ga0495600_0001349_10761_11408 210
349 3300046810 Ga0495660_0056149 Ga0495660_0056149_49_693 210
350 3300047323 Ga0495683_0020319 Ga0495683_0020319_1533_2222 210
351 3300047323 Ga0495683_0042501 Ga0495683_0042501_1367_2017 210
352 3300047443 Ga0495687_000045 Ga0495687_000045_40931_41578 210
353 3300047443 Ga0495687_000089 Ga0495687_000089_117633_118280 210
354 3300047445 Ga0495677_0026991 Ga0495677_0026991_432_1082 210
355 3300047470 Ga0495681_0003732 Ga0495681_0003732_1635_2282 210
356 3300048905 Ga0496102_0000067 Ga0496102_0000067_32510_33163 210
357 3300048906 Ga0496103_0002686 Ga0496103_0002686_201_854 210
358 3300048907 Ga0496104_0672324 Ga0496104_0672324_60_713 210
359 3300048908 Ga0496105_0231252 Ga0496105_0231252_194_847 210
360 3300048913 Ga0496110_0028006 Ga0496110_0028006_2946_3599 210
361 3300048917 Ga0496114_0005723 Ga0496114_0005723_1451_2104 210
362 3300048918 Ga0496115_0000358 Ga0496115_0000358_19370_20023 210
363 3300048919 Ga0496116_0004336 Ga0496116_0004336_2333_2986 210
364 3300048920 Ga0496117_0000114 Ga0496117_0000114_123587_124240 210
365 3300048921 Ga0496118_0000082 Ga0496118_0000082_60945_61598 210
366 3300048923 Ga0496120_0028073 Ga0496120_0028073_2673_3326 210
367 3300048924 Ga0496121_0000758 Ga0496121_0000758_26823_27476 210
368 3300048927 Ga0496124_0000068 Ga0496124_0000068_123724_124377 210
369 3300048929 Ga0496126_0000157 Ga0496126_0000157_123736_124389 210
370 3300050493 nmdc:mga0k408_201683_c1 nmdc:mga0k408_201683_c1_218_865 210
371 3300053079 Ga0500610_0000318 Ga0500610_0000318_3039_3683 210
372 3300053119 Ga0500595_022053 Ga0500595_022053_1223_1870 210
373 3300053130 Ga0500642_0024047 Ga0500642_0024047_1661_2311 210
374 3300053154 Ga0500619_013742 Ga0500619_013742_1147_1794 210
375 3300053730 Ga0500645_000008 Ga0500645_000008_110410_111057 210
376 3300009093 Ga0105240_10416269 Ga0105240_104162692 211
377 3300013104 Ga0157370_10000008 Ga0157370_10000008167 211
378 3300025913 Ga0207695_10342087 Ga0207695_103420872 211
379 3300037418 Ga0395900_0139097 Ga0395900_0139097_1647_2282 211
380 3300037466 Ga0395898_0327863 Ga0395898_0327863_418_1053 211
381 3300031507 Ga0307509_10000007 Ga0307509_10000007117 212
382 3300042012 Ga0439455_0015566 Ga0439455_0015566_128_772 212
383 3300042157 Ga0439458_0001350 Ga0439458_0001350_2486_3130 212
384 3300045049 Ga0466959_0113694 Ga0466959_0113694_1173_1811 212
385 3300046558 Ga0495633_0214855 Ga0495633_0214855_11_652 212
386 3300046660 Ga0495625_0395242 Ga0495625_0395242_200_841 212
387 3300046674 Ga0495588_0387695 Ga0495588_0387695_31_672 212
388 3300053102 Ga0500554_062488 Ga0500554_062488_83_724 212
389 3300053123 Ga0500614_046100 Ga0500614_046100_257_898 212
390 3300001989 JGI24739J22299_10002068 JGI24739J22299_100020682 213
391 3300001990 JGI24737J22298_10000689 JGI24737J22298_100006899 213
392 3300001990 JGI24737J22298_10032812 JGI24737J22298_100328124 213
393 3300002067 JGI24735J21928_10001660 JGI24735J21928_100016605 213
394 3300002067 JGI24735J21928_10085130 JGI24735J21928_100851301 213
395 3300002075 JGI24738J21930_10000106 JGI24738J21930_1000010619 213
396 3300002075 JGI24738J21930_10028069 JGI24738J21930_100280692 213
397 3300003215 JGI25153J46596_10000016 JGI25153J46596_10000016199 213
398 3300003316 rootH1_10131574 rootH1_101315743 213
399 3300003762 Ga0055542_1002943 Ga0055542_10029434 213
400 3300003763 Ga0055529_1005030 Ga0055529_10050302 213
401 3300005327 Ga0070658_10005327 Ga0070658_100053272 213
402 3300005327 Ga0070658_10039621 Ga0070658_100396215 213
403 3300005338 Ga0068868_100479562 Ga0068868_1004795622 213
404 3300005366 Ga0070659_100238009 Ga0070659_1002380091 213
405 3300005457 Ga0070662_100047876 Ga0070662_1000478765 213
406 3300005457 Ga0070662_100084832 Ga0070662_1000848322 213
407 3300005577 Ga0068857_100838437 Ga0068857_1008384372 213
408 3300005578 Ga0068854_100000257 Ga0068854_10000025734 213
409 3300005616 Ga0068852_100201579 Ga0068852_1002015792 213
410 3300006042 Ga0075368_10045913 Ga0075368_100459133 213
411 3300006048 Ga0075363_100037612 Ga0075363_1000376122 213
412 3300006051 Ga0075364_10014909 Ga0075364_100149093 213
413 3300006353 Ga0075370_10026436 Ga0075370_100264362 213
414 3300006353 Ga0075370_10134673 Ga0075370_101346733 213
415 3300006358 Ga0068871_100034956 Ga0068871_1000349566 213
416 3300006946 Ga0079104_1020146 Ga0079104_10201462 213
417 3300006948 Ga0099826_10131978 Ga0099826_101319782 213
418 3300009093 Ga0105240_10022319 Ga0105240_100223197 213
419 3300009148 Ga0105243_10432802 Ga0105243_104328022 213
420 3300009551 Ga0105238_10384365 Ga0105238_103843651 213
421 3300009551 Ga0105238_11090982 Ga0105238_110909821 213
422 3300010375 Ga0105239_10754459 Ga0105239_107544592 213
423 3300013100 Ga0157373_10534074 Ga0157373_105340741 213
424 3300013102 Ga0157371_10137293 Ga0157371_101372932 213
425 3300013105 Ga0157369_10035476 Ga0157369_100354763 213
426 3300013105 Ga0157369_10209990 Ga0157369_102099902 213
427 3300013105 Ga0157369_10817275 Ga0157369_108172751 213
428 3300013296 Ga0157374_11199312 Ga0157374_111993121 213
429 3300013306 Ga0163162_10351024 Ga0163162_103510241 213
430 3300013307 Ga0157372_10005420 Ga0157372_100054203 213
431 3300013307 Ga0157372_10134750 Ga0157372_101347503 213
432 3300013307 Ga0157372_10556155 Ga0157372_105561552 213
433 3300013307 Ga0157372_10681124 Ga0157372_106811241 213
434 3300014497 Ga0182008_10111470 Ga0182008_101114702 213
435 3300015262 Ga0182007_10119031 Ga0182007_101190311 213
436 3300022739 Ga0228711_1000006 Ga0228711_1000006179 213
437 3300022740 Ga0228710_1000004 Ga0228710_1000004230 213
438 3300025254 Ga0209148_1000037 Ga0209148_1000037389 213
439 3300025254 Ga0209148_1000116 Ga0209148_1000116158 213
440 3300025256 Ga0209759_1037275 Ga0209759_10372751 213
441 3300025261 Ga0209233_1004658 Ga0209233_10046583 213
442 3300025272 Ga0209455_1000036 Ga0209455_1000036366 213
443 3300025297 Ga0209758_1000035 Ga0209758_1000035271 213
444 3300025901 Ga0207688_10149929 Ga0207688_101499292 213
445 3300025904 Ga0207647_10001519 Ga0207647_100015198 213
446 3300025904 Ga0207647_10015094 Ga0207647_100150945 213
447 3300025909 Ga0207705_10001961 Ga0207705_100019613 213
448 3300025909 Ga0207705_10177897 Ga0207705_101778972 213
449 3300025913 Ga0207695_10285650 Ga0207695_102856503 213
450 3300025913 Ga0207695_10492091 Ga0207695_104920911 213
451 3300025920 Ga0207649_10440242 Ga0207649_104402422 213
452 3300025929 Ga0207664_10322113 Ga0207664_103221132 213
453 3300025932 Ga0207690_10175503 Ga0207690_101755031 213
454 3300025933 Ga0207706_10008114 Ga0207706_100081145 213
455 3300025933 Ga0207706_10008313 Ga0207706_100083139 213
456 3300025938 Ga0207704_10196675 Ga0207704_101966751 213
457 3300025949 Ga0207667_10101933 Ga0207667_101019332 213
458 3300025981 Ga0207640_10000369 Ga0207640_1000036930 213
459 3300025981 Ga0207640_10169362 Ga0207640_101693622 213
460 3300026041 Ga0207639_11147865 Ga0207639_111478651 213
461 3300026067 Ga0207678_10633860 Ga0207678_106338602 213
462 3300026078 Ga0207702_10107483 Ga0207702_101074832 213
463 3300026116 Ga0207674_10839799 Ga0207674_108397991 213
464 3300026121 Ga0207683_10134361 Ga0207683_101343612 213
465 3300026142 Ga0207698_10179704 Ga0207698_101797042 213
466 3300027111 Ga0209281_1000102 Ga0209281_1000102162 213
467 3300027111 Ga0209281_1000563 Ga0209281_100056313 213
468 3300027666 Ga0209282_1000013 Ga0209282_1000013197 213
469 3300027866 Ga0209813_10040525 Ga0209813_100405252 213
470 3300028786 Ga0307517_10087294 Ga0307517_100872942 213
471 3300030733 Ga0314311_1113666 Ga0314311_11136662 213
472 3300031548 Ga0307408_100311917 Ga0307408_1003119171 213
473 3300031852 Ga0307410_10087108 Ga0307410_100871083 213
474 3300031967 Ga0315914_1000004 Ga0315914_1000004232 213
475 3300033430 Ga0315913_1000055 Ga0315913_100005517 213
476 3300033464 Ga0315915_1000003 Ga0315915_1000003339 213
477 3300035113 Ga0373936_0140621 Ga0373936_0140621_219_863 213
478 3300037418 Ga0395900_0498801 Ga0395900_0498801_447_1091 213
479 3300037466 Ga0395898_0087403 Ga0395898_0087403_1000_1659 213
480 3300037466 Ga0395898_0179416 Ga0395898_0179416_114_764 213
481 3300037471 Ga0395905_0079719 Ga0395905_0079719_1219_1863 213
482 3300037471 Ga0395905_0113459 Ga0395905_0113459_380_1021 213
483 3300041404 Ga0439436_0007839 Ga0439436_0007839_2141_2791 213
484 3300041997 Ga0439431_0030910 Ga0439431_0030910_621_1289 213
485 3300044683 Ga0466965_0008536 Ga0466965_0008536_917_1558 213
486 3300044684 Ga0466966_0015382 Ga0466966_0015382_4269_4910 213
487 3300044765 Ga0466970_0001267 Ga0466970_0001267_8364_9005 213
488 3300045049 Ga0466959_0463451 Ga0466959_0463451_42_683 213
489 3300045836 Ga0466958_0038843 Ga0466958_0038843_1449_2090 213
490 3300046460 Ga0495638_0152129 Ga0495638_0152129_107_748 213
491 3300046515 Ga0495620_0135030 Ga0495620_0135030_264_905 213
492 3300046520 Ga0495637_0082197 Ga0495637_0082197_127_768 213
493 3300046525 Ga0495663_0000132 Ga0495663_0000132_20592_21242 213
494 3300046530 Ga0495654_0155959 Ga0495654_0155959_25_675 213
495 3300046616 Ga0495668_0043026 Ga0495668_0043026_1109_1762 213
496 3300046660 Ga0495625_0020589 Ga0495625_0020589_787_1428 213
497 3300048915 Ga0496112_0055207 Ga0496112_0055207_899_1594 213
498 3300048923 Ga0496120_0095795 Ga0496120_0095795_290_970 213
499 3300050490 nmdc:mga03n38_60445_c1 nmdc:mga03n38_60445_c1_875_1561 213
500 3300050492 nmdc:mga0yw44_43498_c1 nmdc:mga0yw44_43498_c1_361_1047 213
501 3300050492 nmdc:mga0yw44_73766_c1 nmdc:mga0yw44_73766_c1_631_1302 213
502 3300050494 nmdc:mga06z11_319072_c1 nmdc:mga06z11_319072_c1_170_856 213
503 3300050495 nmdc:mga04h51_48544_c1 nmdc:mga04h51_48544_c1_240_926 213
504 3300050496 nmdc:mga07m45_74384_c1 nmdc:mga07m45_74384_c1_1070_1714 213
505 3300053119 Ga0500595_065654 Ga0500595_065654_368_1063 213
506 3300053142 Ga0500577_0100041 Ga0500577_0100041_436_1086 213
507 3300053155 Ga0500620_000058 Ga0500620_000058_16470_17111 213
508 3300053727 Ga0500611_018512 Ga0500611_018512_137_778 213
509 iso_pu_bacteria 2503198000 2503201313 213
510 iso_pu_bacteria 2509276022 2509396088 213
511 iso_pu_bacteria 2512875016 2512931718 213
512 iso_pu_bacteria 2513237164 2514038801 213
513 iso_pu_bacteria 2588253730 2588517578 213
514 iso_pu_bacteria 2841734538 2841736482 213
515 iso_pu_bacteria 2856320880 2856327708 213
516 iso_pu_bacteria 2869278585 2869283314 213
517 iso_pu_bacteria 2876363079 2876368701 213
518 iso_pu_bacteria 2878738818 2878744989 213
519 iso_pu_bacteria 2878788777 2878796406 213
520 iso_pu_bacteria 2888337043 2888339185 213
521 iso_pu_bacteria 2903448605 2903451072 213
522 iso_pu_bacteria 2903521522 2903527700 213
523 iso_pu_bacteria 2903528002 2903529551 213
524 iso_pu_bacteria 2906427513 2906427711 213
525 iso_pu_bacteria 2924718760 2924718989 213
526 iso_pu_bacteria 2924776078 2924783126 213
527 iso_pu_bacteria 2937877337 2937882346 213
528 iso_pu_bacteria 2937972304 2937978814 213
529 iso_pu_bacteria 2958034702 2958039827 213
530 iso_pu_bacteria 2958041894 2958054172 213
531 iso_pu_bacteria 2958084443 2958089469 213
532 iso_pu_bacteria 2958144490 2958147002 213
533 iso_pu_bacteria 2963644680 2963647492 213
534 iso_pu_bacteria 2968016561 2968018676 213
535 iso_pu_bacteria 2968083720 2968090102 213
536 iso_pu_bacteria 2970469710 2970471151 213
537 iso_pu_bacteria 2970593180 2970598260 213
538 iso_pu_bacteria 2977986579 2977992946 213
539 iso_pu_bacteria 2979764755 2979765030 213
540 iso_pu_bacteria 2996348954 2996349250 213
541 iso_pu_bacteria 3004275668 3004275962 213
542 iso_pu_bacteria 3004289098 3004293124 213
543 iso_pu_bacteria 3004334049 3004334727 213
544 iso_pu_bacteria 637000159 637074820 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

150

215

0.94

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

131

220

0.9

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

26

98

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tk8-assembly1.cif.gz_AAA-2 gstf1 f122t variant from alopecurus myosuroides 0.9193 2 198
8agq-assembly1.cif.gz_A crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione 0.9161 2 200
5ey6-assembly1.cif.gz_A crystal structure of glutathione transferase f2 from populus trichocarpa 0.9158 2 200
7obo-assembly1.cif.gz_AAA-2 gstf1 from alopecurus myosuroides 0.9155 2 198
5f05-assembly1.cif.gz_B crystal structure of glutathione transferase f5 from populus trichocarpa 0.9051 2 200
ID Description Score Start End Superfamily
af_A0A0P0V328_116_239_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9226 84 197 1.20.1050.10
5f07A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9125 80 197 1.20.1050.10
af_I1LXD9_1_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9062 1 75 3.40.30.10
3touA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9009 2 72 3.40.30.10
3touB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9008 2 72 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A5R2N5Q3-F1-model_v4 Glutathione S-transferase family protein 0.9935 85 211 GO:0016740
AF-A0A435W057-F1-model_v4 deleted 0.9898 68 213
AF-A0A503L547-F1-model_v4 Glutathione S-transferase family protein 0.9886 1 211 GO:0016740
AF-A0A503T3S1-F1-model_v4 Glutathione S-transferase family protein 0.9879 2 210 GO:0016740
AF-A0A527ZEL5-F1-model_v4 Glutathione S-transferase family protein 0.9871 62 171 GO:0016740

Feature Viewer

pLDDT pTM Quality
93.77 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map