F461581

General Info

Members Datasets Scaffolds Average Seq Length
543 219 1086 164

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100254492|Ga0070670_1002544922
Length 183
Sequence MIHVTRAIVRRWLDALLHIQDTPKRTAAAFSLGVFFGFSPFLGLHTLLGIGFAFLFNLNRVAVLLGVYSNLPWIIAPYYAFATMAGAMITGTRVPEGFRTQLVALFELSALGGEFWDRLITLLKPLLWPYTVGSTFGALALALIAYPLALAFVTSRRKIREIIHHKKELEGLEGGKAEGPKGK

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.39
Rhizosphere 97.61
Stem 0
Stem Tuber 0
Unclassified 16.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100254492 3300005331 Bacteria 1530
2 Ga0065704_10527995 3300005289 Bacteria 649
3 Ga0065715_10366535 3300005293 Bacteria 927
4 Ga0065707_10524561 3300005295 Bacteria 739
5 Ga0070658_10257977 3300005327 Unclassified 1480
6 Ga0070676_10000655 3300005328 Bacteria 16861
7 Ga0070676_10250481 3300005328 Bacteria 1182
8 Ga0070676_10731633 3300005328 Bacteria 725
9 Ga0070683_100896979 3300005329 Unclassified 850
10 Ga0070690_100035345 3300005330 Bacteria 3135
11 Ga0070690_100089044 3300005330 Bacteria 2030
12 Ga0070690_100129640 3300005330 Bacteria 1702
13 Ga0070670_101147894 3300005331 Bacteria 709
14 Ga0070666_10012339 3300005335 Bacteria 5385
15 Ga0070666_10171308 3300005335 Bacteria 1520
16 Ga0070666_10229524 3300005335 Bacteria 1311
17 Ga0070666_10808063 3300005335 Unclassified 691
18 Ga0070680_100481301 3300005336 Bacteria 1061
19 Ga0070680_100778209 3300005336 Bacteria 824
20 Ga0068868_100031637 3300005338 Bacteria 4066
21 Ga0068868_100142745 3300005338 Bacteria 1967
22 Ga0068868_100537224 3300005338 Bacteria 1029
23 Ga0070689_100219604 3300005340 Bacteria 1559
24 Ga0070689_100260965 3300005340 Bacteria 1432
25 Ga0070691_10003179 3300005341 Bacteria 7358
26 Ga0070687_100005904 3300005343 Bacteria 4979
27 Ga0070668_100394290 3300005347 Bacteria 1181
28 Ga0070668_101166433 3300005347 Bacteria 697
29 Ga0070669_100017450 3300005353 Bacteria 5120
30 Ga0070669_100105138 3300005353 Bacteria 2135
31 Ga0070669_100133730 3300005353 Bacteria 1906
32 Ga0070669_100153066 3300005353 Bacteria 1786
33 Ga0070669_100843252 3300005353 Bacteria 781
34 Ga0070675_100046127 3300005354 Bacteria 3568
35 Ga0070675_100110918 3300005354 Bacteria 2321
36 Ga0070675_100405524 3300005354 Bacteria 1217
37 Ga0070671_100005790 3300005355 Bacteria 9843
38 Ga0070671_100351606 3300005355 Bacteria 1258
39 Ga0070674_100078525 3300005356 Bacteria 2352
40 Ga0070674_100108835 3300005356 Bacteria 2031
41 Ga0070674_101686001 3300005356 Unclassified 573
42 Ga0070673_100208726 3300005364 Unclassified 1686
43 Ga0070673_100504475 3300005364 Bacteria 1095
44 Ga0070659_100178446 3300005366 Bacteria 1742
45 Ga0070659_100318850 3300005366 Bacteria 1299
46 Ga0070659_100584947 3300005366 Bacteria 958
47 Ga0070659_100868777 3300005366 Bacteria 787
48 Ga0070667_100050170 3300005367 Unclassified 3516
49 Ga0070667_100053259 3300005367 Bacteria 3415
50 Ga0070709_10540517 3300005434 Unclassified 890
51 Ga0070714_100015782 3300005435 Bacteria 6086
52 Ga0070713_100153269 3300005436 Bacteria 2052
53 Ga0070713_100632713 3300005436 Bacteria 1018
54 Ga0070713_101670522 3300005436 Unclassified 618
55 Ga0070701_10578370 3300005438 Bacteria 741
56 Ga0070701_10681900 3300005438 Unclassified 689
57 Ga0070711_100531654 3300005439 Bacteria 973
58 Ga0070705_100066145 3300005440 Bacteria 2167
59 Ga0070705_100170591 3300005440 Bacteria 1464
60 Ga0070705_100983400 3300005440 Bacteria 684
61 Ga0070700_100001940 3300005441 Bacteria 10476
62 Ga0070700_100049757 3300005441 Bacteria 2603
63 Ga0070694_100073818 3300005444 Bacteria 2357
64 Ga0070694_100274570 3300005444 Bacteria 1283
65 Ga0070694_100289138 3300005444 Bacteria 1252
66 Ga0070694_100668950 3300005444 Bacteria 842
67 Ga0070708_100364955 3300005445 Unclassified 1361
68 Ga0070708_100551454 3300005445 Unclassified 1087
69 Ga0070678_100176677 3300005456 Unclassified 1744
70 Ga0070678_100341810 3300005456 Unclassified 1284
71 Ga0070678_100463453 3300005456 Bacteria 1112
72 Ga0070681_10056112 3300005458 Bacteria 3920
73 Ga0070681_10267176 3300005458 Bacteria 1622
74 Ga0070681_10304109 3300005458 Bacteria 1504
75 Ga0068867_100017463 3300005459 Bacteria 5096
76 Ga0068867_100073462 3300005459 Bacteria 2561
77 Ga0068867_100074992 3300005459 Bacteria 2537
78 Ga0070707_100022047 3300005468 Bacteria 6022
79 Ga0070707_100044236 3300005468 Bacteria 4262
80 Ga0070707_100049017 3300005468 Bacteria 4048
81 Ga0070707_100293442 3300005468 Bacteria 1580
82 Ga0070698_100087767 3300005471 Bacteria 3096
83 Ga0070698_100284069 3300005471 Bacteria 1586
84 Ga0070699_100004340 3300005518 Bacteria 12542
85 Ga0070699_100153736 3300005518 Bacteria 2036
86 Ga0070699_100277519 3300005518 Unclassified 1501
87 Ga0070679_100145727 3300005530 Bacteria 2346
88 Ga0070684_101116446 3300005535 Bacteria 741
89 Ga0070697_100242066 3300005536 Bacteria 1541
90 Ga0070672_100032363 3300005543 Bacteria 3945
91 Ga0070672_100246345 3300005543 Bacteria 1504
92 Ga0070686_100019043 3300005544 Bacteria 4039
93 Ga0070686_100100527 3300005544 Bacteria 1953
94 Ga0070686_100392089 3300005544 Unclassified 1054
95 Ga0070695_100004799 3300005545 Bacteria 7957
96 Ga0070695_100693500 3300005545 Unclassified 808
97 Ga0070695_100808792 3300005545 Unclassified 751
98 Ga0070696_100039199 3300005546 Bacteria 3272
99 Ga0070696_100082898 3300005546 Bacteria 2273
100 Ga0070696_100096098 3300005546 Bacteria 2117
101 Ga0070696_100259544 3300005546 Bacteria 1317
102 Ga0070696_100878202 3300005546 Unclassified 743
103 Ga0070693_100546940 3300005547 Bacteria 828
104 Ga0070665_100001231 3300005548 Bacteria 31098
105 Ga0070665_100100663 3300005548 Bacteria 2894
106 Ga0070704_100013235 3300005549 Bacteria 5114
107 Ga0070704_100015822 3300005549 Bacteria 4749
108 Ga0070704_100025911 3300005549 Bacteria 3866
109 Ga0068855_100002008 3300005563 Bacteria 25247
110 Ga0070664_100725489 3300005564 Bacteria 927
111 Ga0068854_100009092 3300005578 Bacteria 6404
112 Ga0068854_100018317 3300005578 Bacteria 4700
113 Ga0068856_100586713 3300005614 Bacteria 1136
114 Ga0070702_100016573 3300005615 Bacteria 3783
115 Ga0068852_100527669 3300005616 Bacteria 1179
116 Ga0068859_100505227 3300005617 Bacteria 1304
117 Ga0068859_100621470 3300005617 Bacteria 1173
118 Ga0068859_100680297 3300005617 Bacteria 1120
119 Ga0068859_100724930 3300005617 Bacteria 1084
120 Ga0068859_100769392 3300005617 Unclassified 1051
121 Ga0068859_100811818 3300005617 Bacteria 1023
122 Ga0068859_100857600 3300005617 Unclassified 994
123 Ga0068864_100058885 3300005618 Bacteria 3322
124 Ga0068864_100178853 3300005618 Bacteria 1938
125 Ga0068866_10032995 3300005718 Bacteria 2507
126 Ga0068861_100007145 3300005719 Bacteria 7646
127 Ga0068861_100038713 3300005719 Bacteria 3555
128 Ga0068861_100243250 3300005719 Bacteria 1531
129 Ga0068861_100301696 3300005719 Bacteria 1388
130 Ga0068861_100693078 3300005719 Unclassified 946
131 Ga0068851_10373765 3300005834 Bacteria 834
132 Ga0068863_100008935 3300005841 Bacteria 9783
133 Ga0068863_100135880 3300005841 Bacteria 2349
134 Ga0068863_100354526 3300005841 Bacteria 1429
135 Ga0068858_100039482 3300005842 Bacteria 4376
136 Ga0068858_100143250 3300005842 Bacteria 2244
137 Ga0068858_100235823 3300005842 Bacteria 1735
138 Ga0068858_100432490 3300005842 Bacteria 1267
139 Ga0068858_101376217 3300005842 Unclassified 695
140 Ga0068860_100110902 3300005843 Bacteria 2623
141 Ga0068860_100301265 3300005843 Unclassified 1570
142 Ga0068860_100686526 3300005843 Unclassified 1033
143 Ga0068860_100964938 3300005843 Bacteria 870
144 Ga0068860_101887336 3300005843 Unclassified 619
145 Ga0068862_100046417 3300005844 Bacteria 3706
146 Ga0068862_100108637 3300005844 Unclassified 2433
147 Ga0068862_100151357 3300005844 Bacteria 2065
148 Ga0068862_100263448 3300005844 Bacteria 1574
149 Ga0068862_100303210 3300005844 Bacteria 1470
150 Ga0068862_100356945 3300005844 Bacteria 1357
151 Ga0081455_10016927 3300005937 Bacteria 7008
152 Ga0081539_10027768 3300005985 Bacteria 3576
153 Ga0081539_10138335 3300005985 Bacteria 1186
154 Ga0075432_10053382 3300006058 Bacteria 1429
155 Ga0097621_100030845 3300006237 Bacteria 4247
156 Ga0097621_100086565 3300006237 Bacteria 2615
157 Ga0097621_100176573 3300006237 Bacteria 1844
158 Ga0097621_100250722 3300006237 Unclassified 1550
159 Ga0097621_101027389 3300006237 Bacteria 772
160 Ga0068871_100000496 3300006358 Bacteria 26925
161 Ga0068871_100036643 3300006358 Bacteria 3906
162 Ga0068871_100152478 3300006358 Bacteria 1971
163 Ga0068871_100165656 3300006358 Unclassified 1892
164 Ga0068871_100287530 3300006358 Bacteria 1440
165 Ga0068871_101037958 3300006358 Unclassified 765
166 Ga0075428_100145004 3300006844 Bacteria 2581
167 Ga0075428_100260924 3300006844 Bacteria 1865
168 Ga0075433_10036059 3300006852 Bacteria 4258
169 Ga0075433_10200657 3300006852 Bacteria 1773
170 Ga0075433_10211102 3300006852 Bacteria 1725
171 Ga0075433_10230351 3300006852 Bacteria 1645
172 Ga0075433_10426316 3300006852 Bacteria 1170
173 Ga0075433_10623532 3300006852 Bacteria 946
174 Ga0075434_100003553 3300006871 Bacteria 13917
175 Ga0075434_100006223 3300006871 Bacteria 10935
176 Ga0075434_100045570 3300006871 Bacteria 4351
177 Ga0075434_100056968 3300006871 Bacteria 3883
178 Ga0075434_100094922 3300006871 Bacteria 2988
179 Ga0075434_100381795 3300006871 Bacteria 1430
180 Ga0075434_101298601 3300006871 Unclassified 739
181 Ga0068865_100167666 3300006881 Bacteria 1680
182 Ga0068865_100196912 3300006881 Bacteria 1562
183 Ga0068865_100315387 3300006881 Bacteria 1256
184 Ga0068865_100659858 3300006881 Unclassified 890
185 Ga0068865_101482764 3300006881 Unclassified 607
186 Ga0075436_100000920 3300006914 Bacteria 19615
187 Ga0075436_100010676 3300006914 Bacteria 6299
188 Ga0075436_100018113 3300006914 Bacteria 4823
189 Ga0075436_100031987 3300006914 Bacteria 3625
190 Ga0075436_100041749 3300006914 Bacteria 3165
191 Ga0075436_100135250 3300006914 Unclassified 1730
192 Ga0075436_100249284 3300006914 Bacteria 1264
193 Ga0075436_100381625 3300006914 Bacteria 1019
194 Ga0097620_100505119 3300006931 Bacteria 1304
195 Ga0097620_100621396 3300006931 Bacteria 1173
196 Ga0097620_100680200 3300006931 Bacteria 1120
197 Ga0097620_100725120 3300006931 Bacteria 1084
198 Ga0097620_100769395 3300006931 Unclassified 1051
199 Ga0097620_100811833 3300006931 Bacteria 1023
200 Ga0097620_100857850 3300006931 Unclassified 994
201 Ga0075435_100000723 3300007076 Bacteria 20481
202 Ga0075435_100001995 3300007076 Bacteria 13353
203 Ga0075435_100063076 3300007076 Bacteria 3009
204 Ga0075435_100233008 3300007076 Bacteria 1565
205 Ga0075435_100295035 3300007076 Bacteria 1386
206 Ga0099794_10127519 3300007265 Unclassified 1283
207 Ga0105240_10058581 3300009093 Bacteria 4808
208 Ga0105240_10263017 3300009093 Bacteria 1989
209 Ga0105240_10701185 3300009093 Bacteria 1105
210 Ga0111539_10001304 3300009094 Bacteria 33303
211 Ga0111539_10017922 3300009094 Bacteria 8771
212 Ga0111539_10018234 3300009094 Bacteria 8692
213 Ga0111539_10133758 3300009094 Bacteria 2903
214 Ga0111539_10289750 3300009094 Bacteria 1905
215 Ga0111539_10712312 3300009094 Bacteria 1168
216 Ga0111539_11170682 3300009094 Unclassified 893
217 Ga0105245_10017784 3300009098 Bacteria 6205
218 Ga0105245_10343291 3300009098 Bacteria 1477
219 Ga0105245_10404639 3300009098 Unclassified 1365
220 Ga0105245_10524488 3300009098 Unclassified 1203
221 Ga0105245_10739198 3300009098 Bacteria 1019
222 Ga0105247_10037751 3300009101 Bacteria 2947
223 Ga0105247_10246372 3300009101 Bacteria 1220
224 Ga0105247_10728675 3300009101 Unclassified 749
225 Ga0105247_11429406 3300009101 Unclassified 561
226 Ga0114129_10001746 3300009147 Bacteria 29578
227 Ga0114129_10014396 3300009147 Bacteria 11274
228 Ga0114129_10020941 3300009147 Bacteria 9289
229 Ga0114129_10025100 3300009147 Bacteria 8447
230 Ga0114129_10043341 3300009147 Bacteria 6330
231 Ga0114129_10066514 3300009147 Bacteria 5028
232 Ga0114129_10134980 3300009147 Bacteria 3386
233 Ga0114129_10260508 3300009147 Bacteria 2324
234 Ga0105243_10038497 3300009148 Bacteria 3723
235 Ga0105243_10040515 3300009148 Bacteria 3638
236 Ga0105241_10565547 3300009174 Bacteria 1023
237 Ga0105242_10002713 3300009176 Bacteria 13864
238 Ga0105242_10031296 3300009176 Bacteria 4248
239 Ga0105242_10063543 3300009176 Bacteria 3040
240 Ga0105242_10165921 3300009176 Bacteria 1937
241 Ga0105242_10193916 3300009176 Bacteria 1800
242 Ga0105242_11024926 3300009176 Bacteria 835
243 Ga0105248_10018313 3300009177 Bacteria 7733
244 Ga0105248_10025967 3300009177 Bacteria 6515
245 Ga0105248_10041103 3300009177 Bacteria 5183
246 Ga0105248_10115715 3300009177 Bacteria 3024
247 Ga0105248_10154117 3300009177 Bacteria 2592
248 Ga0105248_10191430 3300009177 Bacteria 2305
249 Ga0105248_11302070 3300009177 Bacteria 822
250 Ga0105248_11514389 3300009177 Unclassified 759
251 Ga0105237_11441898 3300009545 Unclassified 695
252 Ga0105238_10369304 3300009551 Bacteria 1425
253 Ga0105238_10439132 3300009551 Bacteria 1301
254 Ga0105249_10283332 3300009553 Bacteria 1656
255 Ga0105249_10804297 3300009553 Bacteria 1004
256 Ga0105249_11013478 3300009553 Bacteria 899
257 Ga0105249_11497497 3300009553 Unclassified 747
258 Ga0105249_11651947 3300009553 Unclassified 713
259 Ga0105249_13033116 3300009553 Unclassified 539
260 Ga0105246_10061356 3300011119 Bacteria 2616
261 Ga0105246_11593917 3300011119 Unclassified 617
262 Ga0157374_10095366 3300013296 Bacteria 2845
263 Ga0157374_10732827 3300013296 Unclassified 1003
264 Ga0157374_11967537 3300013296 Bacteria 611
265 Ga0157378_10152396 3300013297 Bacteria 2155
266 Ga0157378_10257543 3300013297 Bacteria 1673
267 Ga0157378_11337229 3300013297 Bacteria 758
268 Ga0157378_12052946 3300013297 Unclassified 622
269 Ga0163162_10154366 3300013306 Bacteria 2415
270 Ga0163162_12577043 3300013306 Unclassified 585
271 Ga0157375_10119647 3300013308 Bacteria 2741
272 Ga0157375_10688564 3300013308 Unclassified 1176
273 Ga0157375_10980278 3300013308 Unclassified 986
274 Ga0163163_10062818 3300014325 Bacteria 3681
275 Ga0163163_10077810 3300014325 Bacteria 3313
276 Ga0163163_10321689 3300014325 Bacteria 1601
277 Ga0157380_10224611 3300014326 Bacteria 1682
278 Ga0157380_11737503 3300014326 Unclassified 682
279 Ga0157377_10254691 3300014745 Bacteria 1139
280 Ga0157377_11044081 3300014745 Bacteria 622
281 Ga0157379_10018170 3300014968 Bacteria 6195
282 Ga0157379_10062343 3300014968 Bacteria 3335
283 Ga0157379_10354167 3300014968 Bacteria 1344
284 Ga0157376_10144051 3300014969 Bacteria 2141
285 Ga0157376_10151777 3300014969 Bacteria 2090
286 Ga0157376_10223477 3300014969 Bacteria 1745
287 Ga0157376_10792201 3300014969 Unclassified 960
288 Ga0207653_10144734 3300025885 Unclassified 871
289 Ga0207682_10004922 3300025893 Bacteria 5496
290 Ga0207642_10050771 3300025899 Bacteria 1872
291 Ga0207642_10072263 3300025899 Bacteria 1646
292 Ga0207710_10034173 3300025900 Bacteria 2233
293 Ga0207710_10292699 3300025900 Bacteria 821
294 Ga0207688_10129793 3300025901 Bacteria 1477
295 Ga0207680_10206860 3300025903 Bacteria 1340
296 Ga0207680_10225502 3300025903 Bacteria 1286
297 Ga0207645_10001896 3300025907 Bacteria 16883
298 Ga0207645_10355828 3300025907 Bacteria 980
299 Ga0207684_10678682 3300025910 Bacteria 877
300 Ga0207654_10049999 3300025911 Bacteria 2400
301 Ga0207707_10019226 3300025912 Bacteria 5962
302 Ga0207707_10278980 3300025912 Bacteria 1448
303 Ga0207671_10693523 3300025914 Unclassified 810
304 Ga0207662_10011013 3300025918 Bacteria 5004
305 Ga0207662_10167064 3300025918 Bacteria 1409
306 Ga0207657_10005912 3300025919 Bacteria 12734
307 Ga0207652_10053220 3300025921 Bacteria 3477
308 Ga0207652_10073231 3300025921 Bacteria 2980
309 Ga0207652_10254497 3300025921 Bacteria 1584
310 Ga0207646_10026617 3300025922 Bacteria 5276
311 Ga0207646_10931006 3300025922 Unclassified 770
312 Ga0207681_10039156 3300025923 Bacteria 3145
313 Ga0207681_10081081 3300025923 Bacteria 2290
314 Ga0207681_10391013 3300025923 Bacteria 1121
315 Ga0207681_11108163 3300025923 Unclassified 665
316 Ga0207681_11186378 3300025923 Bacteria 641
317 Ga0207650_10018438 3300025925 Bacteria 4898
318 Ga0207650_10148078 3300025925 Bacteria 1851
319 Ga0207659_10096592 3300025926 Bacteria 2218
320 Ga0207659_10111781 3300025926 Unclassified 2078
321 Ga0207687_10040400 3300025927 Bacteria 3197
322 Ga0207687_10470946 3300025927 Bacteria 1044
323 Ga0207644_10036233 3300025931 Unclassified 3462
324 Ga0207690_10444537 3300025932 Bacteria 1041
325 Ga0207690_10950756 3300025932 Bacteria 714
326 Ga0207690_11270935 3300025932 Bacteria 615
327 Ga0207706_10449439 3300025933 Bacteria 1115
328 Ga0207706_10451335 3300025933 Bacteria 1112
329 Ga0207706_10518070 3300025933 Bacteria 1028
330 Ga0207686_10016785 3300025934 Bacteria 4112
331 Ga0207686_10053278 3300025934 Bacteria 2528
332 Ga0207686_10097181 3300025934 Bacteria 1958
333 Ga0207686_10994650 3300025934 Bacteria 680
334 Ga0207709_10032586 3300025935 Bacteria 3052
335 Ga0207709_10123537 3300025935 Bacteria 1752
336 Ga0207709_10526882 3300025935 Unclassified 926
337 Ga0207670_10167756 3300025936 Bacteria 1643
338 Ga0207670_10182236 3300025936 Bacteria 1583
339 Ga0207669_10052595 3300025937 Bacteria 2448
340 Ga0207669_10197368 3300025937 Bacteria 1457
341 Ga0207704_10068842 3300025938 Bacteria 2233
342 Ga0207704_10271681 3300025938 Bacteria 1284
343 Ga0207704_10277815 3300025938 Bacteria 1272
344 Ga0207704_10287021 3300025938 Bacteria 1254
345 Ga0207704_10338704 3300025938 Bacteria 1167
346 Ga0207704_10536841 3300025938 Unclassified 948
347 Ga0207665_10085291 3300025939 Bacteria 2180
348 Ga0207691_10012856 3300025940 Bacteria 8013
349 Ga0207691_10325090 3300025940 Unclassified 1318
350 Ga0207691_10610603 3300025940 Bacteria 923
351 Ga0207711_10185373 3300025941 Bacteria 1894
352 Ga0207711_10226797 3300025941 Bacteria 1710
353 Ga0207711_10298448 3300025941 Bacteria 1486
354 Ga0207711_10532956 3300025941 Bacteria 1095
355 Ga0207689_10443128 3300025942 Bacteria 1085
356 Ga0207661_10101160 3300025944 Bacteria 2421
357 Ga0207679_10426329 3300025945 Bacteria 1172
358 Ga0207679_10474337 3300025945 Bacteria 1113
359 Ga0207667_10109682 3300025949 Bacteria 2846
360 Ga0207667_11408442 3300025949 Unclassified 670
361 Ga0207651_10088488 3300025960 Bacteria 2258
362 Ga0207651_10182305 3300025960 Bacteria 1667
363 Ga0207651_11168774 3300025960 Bacteria 690
364 Ga0207712_10089855 3300025961 Bacteria 2259
365 Ga0207712_10457559 3300025961 Bacteria 1083
366 Ga0207712_10473836 3300025961 Bacteria 1066
367 Ga0207668_10036149 3300025972 Bacteria 3295
368 Ga0207668_10135984 3300025972 Bacteria 1883
369 Ga0207668_11382605 3300025972 Bacteria 634
370 Ga0207640_10002813 3300025981 Bacteria 9328
371 Ga0207640_10222338 3300025981 Bacteria 1446
372 Ga0207658_10090366 3300025986 Bacteria 2373
373 Ga0207658_10448743 3300025986 Bacteria 1141
374 Ga0207677_10017759 3300026023 Bacteria 4251
375 Ga0207677_10182757 3300026023 Bacteria 1651
376 Ga0207677_10464942 3300026023 Bacteria 1087
377 Ga0207703_10009110 3300026035 Bacteria 7816
378 Ga0207703_10089104 3300026035 Bacteria 2591
379 Ga0207703_10140878 3300026035 Bacteria 2093
380 Ga0207703_10177703 3300026035 Bacteria 1876
381 Ga0207703_10518860 3300026035 Bacteria 1120
382 Ga0207708_10001104 3300026075 Bacteria 20221
383 Ga0207708_10071741 3300026075 Bacteria 2653
384 Ga0207708_10242351 3300026075 Bacteria 1450
385 Ga0207702_10441870 3300026078 Unclassified 1261
386 Ga0207641_10003983 3300026088 Bacteria 12891
387 Ga0207641_10081329 3300026088 Bacteria 2813
388 Ga0207641_11155875 3300026088 Unclassified 773
389 Ga0207648_10001574 3300026089 Bacteria 25012
390 Ga0207648_10031078 3300026089 Bacteria 4723
391 Ga0207648_10124323 3300026089 Bacteria 2269
392 Ga0207676_10038298 3300026095 Bacteria 3658
393 Ga0207676_10375279 3300026095 Unclassified 1322
394 Ga0207676_10838606 3300026095 Bacteria 898
395 Ga0207675_100007206 3300026118 Bacteria 10502
396 Ga0207675_100107715 3300026118 Bacteria 2628
397 Ga0207675_100299772 3300026118 Bacteria 1565
398 Ga0207675_100460929 3300026118 Bacteria 1261
399 Ga0207675_100549016 3300026118 Bacteria 1154
400 Ga0207675_100628495 3300026118 Unclassified 1079
401 Ga0207675_100676305 3300026118 Archaea 1040
402 Ga0207675_100843181 3300026118 Bacteria 931
403 Ga0207675_100950069 3300026118 Bacteria 877
404 Ga0207683_10127084 3300026121 Unclassified 2291
405 Ga0207698_10205172 3300026142 Bacteria 1769
406 Ga0207428_10001029 3300027907 Bacteria 30783
407 Ga0207428_10024809 3300027907 Bacteria 5031
408 Ga0207428_10071759 3300027907 Bacteria 2719
409 Ga0207428_10649642 3300027907 Bacteria 757
410 Ga0268266_10012076 3300028379 Bacteria 7474
411 Ga0268266_10058450 3300028379 Bacteria 3320
412 Ga0268265_10105119 3300028380 Bacteria 2290
413 Ga0268265_10280231 3300028380 Unclassified 1491
414 Ga0268265_10423093 3300028380 Bacteria 1237
415 Ga0268265_10432785 3300028380 Bacteria 1224
416 Ga0268265_10475664 3300028380 Archaea 1172
417 Ga0268264_10018996 3300028381 Bacteria 5619
418 Ga0268264_10191792 3300028381 Bacteria 1863
419 Ga0268264_10215309 3300028381 Unclassified 1766
420 Ga0268264_10377339 3300028381 Unclassified 1357
421 Ga0268264_11465400 3300028381 Bacteria 693
422 Ga0268264_11835843 3300028381 Bacteria 616
423 Ga0265332_10084476 3300031238 Bacteria 1345
424 Ga0307408_101022248 3300031548 Bacteria 763
425 Ga0307408_101024215 3300031548 Unclassified 762
426 Ga0373930_0009947 3300034816 Bacteria 1690
427 Ga0373948_0013410 3300034817 Bacteria 1479
428 Ga0373958_0003813 3300034819 Bacteria 2198
429 Ga0373959_0003377 3300034820 Bacteria 2538
430 Ga0373938_0010807 3300034957 Bacteria 1686
431 Ga0373928_0002308 3300035084 Bacteria 3705
432 Ga0373929_0001356 3300035085 Bacteria 4692
433 Ga0373934_0090349 3300035086 Bacteria 1234
434 Ga0373940_0024880 3300035088 Bacteria 1555
435 Ga0373949_0001730 3300035090 Bacteria 6039
436 Ga0373951_0001892 3300035091 Bacteria 5391
437 Ga0373952_0001858 3300035092 Bacteria 3833
438 Ga0373932_0000233 3300035112 Bacteria 16786
439 Ga0373932_0020030 3300035112 Bacteria 1750
440 Ga0373936_0132794 3300035113 Unclassified 1071
441 Ga0373939_0000258 3300035114 Bacteria 14206
442 Ga0373941_0003236 3300035115 Bacteria 3667
443 Ga0373956_0041918 3300035119 Bacteria 2034
444 Ga0373957_0091930 3300035120 Bacteria 1207
445 Ga0373957_0191702 3300035120 Bacteria 850
446 Ga0373957_0242260 3300035120 Unclassified 758
447 Ga0373960_0009999 3300035121 Bacteria 2309
448 Ga0373943_0406525 3300035170 Bacteria 787
449 Ga0373942_0029643 3300035207 Bacteria 1437
450 Ga0373961_0000815 3300035241 Bacteria 10615
451 Ga0373961_0017543 3300035241 Bacteria 1859
452 Ga0373962_0001310 3300035242 Bacteria 5850
453 Ga0373962_0086799 3300035242 Bacteria 958
454 Ga0373931_0016820 3300035691 Bacteria 3606
455 Ga0373933_0164144 3300035724 Bacteria 1412
456 Ga0373947_0443655 3300035725 Unclassified 879
457 Ga0373937_0202912 3300036401 Bacteria 1864
458 Ga0373937_0485867 3300036401 Unclassified 1173
459 Ga0373925_0437627 3300037068 Unclassified 1070
460 Ga0373925_0675685 3300037068 Bacteria 851
461 Ga0373925_1647805 3300037068 Unclassified 524
462 Ga0439460_0130469 3300042461 Unclassified 828
463 Ga0466960_0124205 3300044901 Bacteria 1355
464 Ga0451576_0014235 3300045051 Bacteria 8863
465 Ga0451576_0774297 3300045051 Bacteria 1008
466 Ga0495592_0634475 3300046454 Unclassified 649
467 Ga0495582_0140825 3300046473 Bacteria 1367
468 Ga0495663_0209770 3300046525 Bacteria 682
469 Ga0495586_0245546 3300046535 Bacteria 1021
470 Ga0495645_0005751 3300046543 Bacteria 8549
471 Ga0495634_0285136 3300046642 Bacteria 1002
472 Ga0495647_0033169 3300046681 Bacteria 1929
473 Ga0495647_0292328 3300046681 Unclassified 733
474 Ga0495647_0326384 3300046681 Bacteria 695
475 Ga0495658_0023851 3300046683 Bacteria 3252
476 Ga0495658_0463803 3300046683 Bacteria 810
477 Ga0495669_0368710 3300046684 Bacteria 695
478 Ga0495624_0464953 3300046690 Bacteria 758
479 Ga0495604_0388325 3300047317 Bacteria 921
480 Ga0495674_0131432 3300047319 Bacteria 2109
481 Ga0495680_0882015 3300047322 Unclassified 579
482 Ga0495684_0230777 3300047471 Bacteria 1354
483 Ga0495684_0488740 3300047471 Bacteria 848
484 Ga0496102_0813973 3300048905 Bacteria 856
485 Ga0496102_1175327 3300048905 Bacteria 687
486 Ga0496104_0041679 3300048907 Bacteria 4306
487 Ga0496105_0276526 3300048908 Unclassified 1355
488 Ga0496105_0956245 3300048908 Unclassified 643
489 Ga0496106_0172058 3300048909 Bacteria 1717
490 Ga0496106_0531946 3300048909 Bacteria 944
491 Ga0496108_0156250 3300048911 Bacteria 1970
492 Ga0496109_0095417 3300048912 Bacteria 2754
493 Ga0496109_0995354 3300048912 Unclassified 776
494 Ga0496112_0059572 3300048915 Bacteria 3762
495 Ga0496112_0607261 3300048915 Bacteria 1026
496 Ga0496113_0119924 3300048916 Bacteria 2055
497 Ga0501074_1083044 3300049590 Unclassified 563
498 Ga0501202_138943 3300049652 Bacteria 626
499 Ga0501081_0771111 3300049743 Unclassified 723
500 Ga0501045_0262806 3300049824 Unclassified 1285
501 nmdc:mga05p37_1256_c1 3300050507 Bacteria 29440
502 nmdc:mga05p37_14921_c1 3300050507 Bacteria 9328
503 nmdc:mga05p37_15750_c1 3300050507 Bacteria 9091
504 nmdc:mga05p37_266498_c1 3300050507 Bacteria 2048
505 nmdc:mga05p37_361318_c1 3300050507 Bacteria 1707
506 nmdc:mga05p37_86323_c1 3300050507 Bacteria 3867
507 nmdc:mga05p37_887840_c1 3300050507 Unclassified 963
508 nmdc:mga05p37_97240_c1 3300050507 Bacteria 3627
509 nmdc:mga08y16_10630_c1 3300050511 Bacteria 9658
510 nmdc:mga08y16_134669_c1 3300050511 Bacteria 2568
511 nmdc:mga08y16_152205_c1 3300050511 Bacteria 2404
512 nmdc:mga08y16_3723_c1 3300050511 Bacteria 15877
513 nmdc:mga08y16_913_c1 3300050511 Bacteria 28616
514 nmdc:mga0n895_1057083_c1 3300050512 Unclassified 791
515 nmdc:mga0n895_121623_c1 3300050512 Bacteria 2632
516 nmdc:mga0n895_142512_c1 3300050512 Bacteria 2426
517 nmdc:mga0n895_177_c1 3300050512 Bacteria 39316
518 nmdc:mga0n895_31547_c1 3300050512 Bacteria 5075
519 nmdc:mga0n895_380258_c1 3300050512 Bacteria 1429
520 nmdc:mga0n895_661111_c1 3300050512 Bacteria 1043
521 nmdc:mga0n895_9966_c1 3300050512 Bacteria 8360
522 nmdc:mga0rr50_117207_c1 3300050513 Bacteria 2115
523 nmdc:mga0rr50_33814_c1 3300050513 Bacteria 3656
524 nmdc:mga0rr50_36_c1 3300050513 Bacteria 89726
525 nmdc:mga0rr50_396807_c1 3300050513 Bacteria 1165
526 nmdc:mga0rr50_693_c1 3300050513 Bacteria 18015
527 nmdc:mga0rr50_773189_c1 3300050513 Unclassified 820
528 nmdc:mga08x19_172479_c1 3300050514 Bacteria 1473
529 nmdc:mga08x19_22564_c1 3300050514 Bacteria 3899
530 nmdc:mga08x19_31403_c1 3300050514 Bacteria 3341
531 nmdc:mga08x19_32555_c1 3300050514 Bacteria 3287
532 nmdc:mga08x19_32781_c1 3300050514 Bacteria 3276
533 nmdc:mga08x19_567_c1 3300050514 Bacteria 24222
534 nmdc:mga08x19_80767_c1 3300050514 Bacteria 2135
535 nmdc:mga0a205_199363_c1 3300050515 Bacteria 1892
536 nmdc:mga0a205_25598_c1 3300050515 Bacteria 5622
537 nmdc:mga0a205_5434_c1 3300050515 Bacteria 11481
538 Ga0495601_0124138 3300053077 Bacteria 1679
539 Ga0495595_0082861 3300053084 Bacteria 1530
540 Ga0495619_0046097 3300053085 Bacteria 2866
541 Ga0495619_0182290 3300053085 Bacteria 1453
542 Ga0495619_0196904 3300053085 Bacteria 1395
543 Ga0530510_0359098 3300061734 Bacteria 1095
544 Ga0070670_100254492
545 Ga0065704_10527995
546 Ga0065715_10366535
547 Ga0065707_10524561
548 Ga0070658_10257977
549 Ga0070676_10000655
550 Ga0070676_10250481
551 Ga0070676_10731633
552 Ga0070683_100896979
553 Ga0070690_100035345
554 Ga0070690_100089044
555 Ga0070690_100129640
556 Ga0070670_101147894
557 Ga0070666_10012339
558 Ga0070666_10171308
559 Ga0070666_10229524
560 Ga0070666_10808063
561 Ga0070680_100481301
562 Ga0070680_100778209
563 Ga0068868_100031637
564 Ga0068868_100142745
565 Ga0068868_100537224
566 Ga0070689_100219604
567 Ga0070689_100260965
568 Ga0070691_10003179
569 Ga0070687_100005904
570 Ga0070668_100394290
571 Ga0070668_101166433
572 Ga0070669_100017450
573 Ga0070669_100105138
574 Ga0070669_100133730
575 Ga0070669_100153066
576 Ga0070669_100843252
577 Ga0070675_100046127
578 Ga0070675_100110918
579 Ga0070675_100405524
580 Ga0070671_100005790
581 Ga0070671_100351606
582 Ga0070674_100078525
583 Ga0070674_100108835
584 Ga0070674_101686001
585 Ga0070673_100208726
586 Ga0070673_100504475
587 Ga0070659_100178446
588 Ga0070659_100318850
589 Ga0070659_100584947
590 Ga0070659_100868777
591 Ga0070667_100050170
592 Ga0070667_100053259
593 Ga0070709_10540517
594 Ga0070714_100015782
595 Ga0070713_100153269
596 Ga0070713_100632713
597 Ga0070713_101670522
598 Ga0070701_10578370
599 Ga0070701_10681900
600 Ga0070711_100531654
601 Ga0070705_100066145
602 Ga0070705_100170591
603 Ga0070705_100983400
604 Ga0070700_100001940
605 Ga0070700_100049757
606 Ga0070694_100073818
607 Ga0070694_100274570
608 Ga0070694_100289138
609 Ga0070694_100668950
610 Ga0070708_100364955
611 Ga0070708_100551454
612 Ga0070678_100176677
613 Ga0070678_100341810
614 Ga0070678_100463453
615 Ga0070681_10056112
616 Ga0070681_10267176
617 Ga0070681_10304109
618 Ga0068867_100017463
619 Ga0068867_100073462
620 Ga0068867_100074992
621 Ga0070707_100022047
622 Ga0070707_100044236
623 Ga0070707_100049017
624 Ga0070707_100293442
625 Ga0070698_100087767
626 Ga0070698_100284069
627 Ga0070699_100004340
628 Ga0070699_100153736
629 Ga0070699_100277519
630 Ga0070679_100145727
631 Ga0070684_101116446
632 Ga0070697_100242066
633 Ga0070672_100032363
634 Ga0070672_100246345
635 Ga0070686_100019043
636 Ga0070686_100100527
637 Ga0070686_100392089
638 Ga0070695_100004799
639 Ga0070695_100693500
640 Ga0070695_100808792
641 Ga0070696_100039199
642 Ga0070696_100082898
643 Ga0070696_100096098
644 Ga0070696_100259544
645 Ga0070696_100878202
646 Ga0070693_100546940
647 Ga0070665_100001231
648 Ga0070665_100100663
649 Ga0070704_100013235
650 Ga0070704_100015822
651 Ga0070704_100025911
652 Ga0068855_100002008
653 Ga0070664_100725489
654 Ga0068854_100009092
655 Ga0068854_100018317
656 Ga0068856_100586713
657 Ga0070702_100016573
658 Ga0068852_100527669
659 Ga0068859_100505227
660 Ga0068859_100621470
661 Ga0068859_100680297
662 Ga0068859_100724930
663 Ga0068859_100769392
664 Ga0068859_100811818
665 Ga0068859_100857600
666 Ga0068864_100058885
667 Ga0068864_100178853
668 Ga0068866_10032995
669 Ga0068861_100007145
670 Ga0068861_100038713
671 Ga0068861_100243250
672 Ga0068861_100301696
673 Ga0068861_100693078
674 Ga0068851_10373765
675 Ga0068863_100008935
676 Ga0068863_100135880
677 Ga0068863_100354526
678 Ga0068858_100039482
679 Ga0068858_100143250
680 Ga0068858_100235823
681 Ga0068858_100432490
682 Ga0068858_101376217
683 Ga0068860_100110902
684 Ga0068860_100301265
685 Ga0068860_100686526
686 Ga0068860_100964938
687 Ga0068860_101887336
688 Ga0068862_100046417
689 Ga0068862_100108637
690 Ga0068862_100151357
691 Ga0068862_100263448
692 Ga0068862_100303210
693 Ga0068862_100356945
694 Ga0081455_10016927
695 Ga0081539_10027768
696 Ga0081539_10138335
697 Ga0075432_10053382
698 Ga0097621_100030845
699 Ga0097621_100086565
700 Ga0097621_100176573
701 Ga0097621_100250722
702 Ga0097621_101027389
703 Ga0068871_100000496
704 Ga0068871_100036643
705 Ga0068871_100152478
706 Ga0068871_100165656
707 Ga0068871_100287530
708 Ga0068871_101037958
709 Ga0075428_100145004
710 Ga0075428_100260924
711 Ga0075433_10036059
712 Ga0075433_10200657
713 Ga0075433_10211102
714 Ga0075433_10230351
715 Ga0075433_10426316
716 Ga0075433_10623532
717 Ga0075434_100003553
718 Ga0075434_100006223
719 Ga0075434_100045570
720 Ga0075434_100056968
721 Ga0075434_100094922
722 Ga0075434_100381795
723 Ga0075434_101298601
724 Ga0068865_100167666
725 Ga0068865_100196912
726 Ga0068865_100315387
727 Ga0068865_100659858
728 Ga0068865_101482764
729 Ga0075436_100000920
730 Ga0075436_100010676
731 Ga0075436_100018113
732 Ga0075436_100031987
733 Ga0075436_100041749
734 Ga0075436_100135250
735 Ga0075436_100249284
736 Ga0075436_100381625
737 Ga0097620_100505119
738 Ga0097620_100621396
739 Ga0097620_100680200
740 Ga0097620_100725120
741 Ga0097620_100769395
742 Ga0097620_100811833
743 Ga0097620_100857850
744 Ga0075435_100000723
745 Ga0075435_100001995
746 Ga0075435_100063076
747 Ga0075435_100233008
748 Ga0075435_100295035
749 Ga0099794_10127519
750 Ga0105240_10058581
751 Ga0105240_10263017
752 Ga0105240_10701185
753 Ga0111539_10001304
754 Ga0111539_10017922
755 Ga0111539_10018234
756 Ga0111539_10133758
757 Ga0111539_10289750
758 Ga0111539_10712312
759 Ga0111539_11170682
760 Ga0105245_10017784
761 Ga0105245_10343291
762 Ga0105245_10404639
763 Ga0105245_10524488
764 Ga0105245_10739198
765 Ga0105247_10037751
766 Ga0105247_10246372
767 Ga0105247_10728675
768 Ga0105247_11429406
769 Ga0114129_10001746
770 Ga0114129_10014396
771 Ga0114129_10020941
772 Ga0114129_10025100
773 Ga0114129_10043341
774 Ga0114129_10066514
775 Ga0114129_10134980
776 Ga0114129_10260508
777 Ga0105243_10038497
778 Ga0105243_10040515
779 Ga0105241_10565547
780 Ga0105242_10002713
781 Ga0105242_10031296
782 Ga0105242_10063543
783 Ga0105242_10165921
784 Ga0105242_10193916
785 Ga0105242_11024926
786 Ga0105248_10018313
787 Ga0105248_10025967
788 Ga0105248_10041103
789 Ga0105248_10115715
790 Ga0105248_10154117
791 Ga0105248_10191430
792 Ga0105248_11302070
793 Ga0105248_11514389
794 Ga0105237_11441898
795 Ga0105238_10369304
796 Ga0105238_10439132
797 Ga0105249_10283332
798 Ga0105249_10804297
799 Ga0105249_11013478
800 Ga0105249_11497497
801 Ga0105249_11651947
802 Ga0105249_13033116
803 Ga0105246_10061356
804 Ga0105246_11593917
805 Ga0157374_10095366
806 Ga0157374_10732827
807 Ga0157374_11967537
808 Ga0157378_10152396
809 Ga0157378_10257543
810 Ga0157378_11337229
811 Ga0157378_12052946
812 Ga0163162_10154366
813 Ga0163162_12577043
814 Ga0157375_10119647
815 Ga0157375_10688564
816 Ga0157375_10980278
817 Ga0163163_10062818
818 Ga0163163_10077810
819 Ga0163163_10321689
820 Ga0157380_10224611
821 Ga0157380_11737503
822 Ga0157377_10254691
823 Ga0157377_11044081
824 Ga0157379_10018170
825 Ga0157379_10062343
826 Ga0157379_10354167
827 Ga0157376_10144051
828 Ga0157376_10151777
829 Ga0157376_10223477
830 Ga0157376_10792201
831 Ga0207653_10144734
832 Ga0207682_10004922
833 Ga0207642_10050771
834 Ga0207642_10072263
835 Ga0207710_10034173
836 Ga0207710_10292699
837 Ga0207688_10129793
838 Ga0207680_10206860
839 Ga0207680_10225502
840 Ga0207645_10001896
841 Ga0207645_10355828
842 Ga0207684_10678682
843 Ga0207654_10049999
844 Ga0207707_10019226
845 Ga0207707_10278980
846 Ga0207671_10693523
847 Ga0207662_10011013
848 Ga0207662_10167064
849 Ga0207657_10005912
850 Ga0207652_10053220
851 Ga0207652_10073231
852 Ga0207652_10254497
853 Ga0207646_10026617
854 Ga0207646_10931006
855 Ga0207681_10039156
856 Ga0207681_10081081
857 Ga0207681_10391013
858 Ga0207681_11108163
859 Ga0207681_11186378
860 Ga0207650_10018438
861 Ga0207650_10148078
862 Ga0207659_10096592
863 Ga0207659_10111781
864 Ga0207687_10040400
865 Ga0207687_10470946
866 Ga0207644_10036233
867 Ga0207690_10444537
868 Ga0207690_10950756
869 Ga0207690_11270935
870 Ga0207706_10449439
871 Ga0207706_10451335
872 Ga0207706_10518070
873 Ga0207686_10016785
874 Ga0207686_10053278
875 Ga0207686_10097181
876 Ga0207686_10994650
877 Ga0207709_10032586
878 Ga0207709_10123537
879 Ga0207709_10526882
880 Ga0207670_10167756
881 Ga0207670_10182236
882 Ga0207669_10052595
883 Ga0207669_10197368
884 Ga0207704_10068842
885 Ga0207704_10271681
886 Ga0207704_10277815
887 Ga0207704_10287021
888 Ga0207704_10338704
889 Ga0207704_10536841
890 Ga0207665_10085291
891 Ga0207691_10012856
892 Ga0207691_10325090
893 Ga0207691_10610603
894 Ga0207711_10185373
895 Ga0207711_10226797
896 Ga0207711_10298448
897 Ga0207711_10532956
898 Ga0207689_10443128
899 Ga0207661_10101160
900 Ga0207679_10426329
901 Ga0207679_10474337
902 Ga0207667_10109682
903 Ga0207667_11408442
904 Ga0207651_10088488
905 Ga0207651_10182305
906 Ga0207651_11168774
907 Ga0207712_10089855
908 Ga0207712_10457559
909 Ga0207712_10473836
910 Ga0207668_10036149
911 Ga0207668_10135984
912 Ga0207668_11382605
913 Ga0207640_10002813
914 Ga0207640_10222338
915 Ga0207658_10090366
916 Ga0207658_10448743
917 Ga0207677_10017759
918 Ga0207677_10182757
919 Ga0207677_10464942
920 Ga0207703_10009110
921 Ga0207703_10089104
922 Ga0207703_10140878
923 Ga0207703_10177703
924 Ga0207703_10518860
925 Ga0207708_10001104
926 Ga0207708_10071741
927 Ga0207708_10242351
928 Ga0207702_10441870
929 Ga0207641_10003983
930 Ga0207641_10081329
931 Ga0207641_11155875
932 Ga0207648_10001574
933 Ga0207648_10031078
934 Ga0207648_10124323
935 Ga0207676_10038298
936 Ga0207676_10375279
937 Ga0207676_10838606
938 Ga0207675_100007206
939 Ga0207675_100107715
940 Ga0207675_100299772
941 Ga0207675_100460929
942 Ga0207675_100549016
943 Ga0207675_100628495
944 Ga0207675_100676305
945 Ga0207675_100843181
946 Ga0207675_100950069
947 Ga0207683_10127084
948 Ga0207698_10205172
949 Ga0207428_10001029
950 Ga0207428_10024809
951 Ga0207428_10071759
952 Ga0207428_10649642
953 Ga0268266_10012076
954 Ga0268266_10058450
955 Ga0268265_10105119
956 Ga0268265_10280231
957 Ga0268265_10423093
958 Ga0268265_10432785
959 Ga0268265_10475664
960 Ga0268264_10018996
961 Ga0268264_10191792
962 Ga0268264_10215309
963 Ga0268264_10377339
964 Ga0268264_11465400
965 Ga0268264_11835843
966 Ga0265332_10084476
967 Ga0307408_101022248
968 Ga0307408_101024215
969 Ga0373930_0009947
970 Ga0373948_0013410
971 Ga0373958_0003813
972 Ga0373959_0003377
973 Ga0373938_0010807
974 Ga0373928_0002308
975 Ga0373929_0001356
976 Ga0373934_0090349
977 Ga0373940_0024880
978 Ga0373949_0001730
979 Ga0373951_0001892
980 Ga0373952_0001858
981 Ga0373932_0000233
982 Ga0373932_0020030
983 Ga0373936_0132794
984 Ga0373939_0000258
985 Ga0373941_0003236
986 Ga0373956_0041918
987 Ga0373957_0091930
988 Ga0373957_0191702
989 Ga0373957_0242260
990 Ga0373960_0009999
991 Ga0373943_0406525
992 Ga0373942_0029643
993 Ga0373961_0000815
994 Ga0373961_0017543
995 Ga0373962_0001310
996 Ga0373962_0086799
997 Ga0373931_0016820
998 Ga0373933_0164144
999 Ga0373947_0443655
1000 Ga0373937_0202912
1001 Ga0373937_0485867
1002 Ga0373925_0437627
1003 Ga0373925_0675685
1004 Ga0373925_1647805
1005 Ga0439460_0130469
1006 Ga0466960_0124205
1007 Ga0451576_0014235
1008 Ga0451576_0774297
1009 Ga0495592_0634475
1010 Ga0495582_0140825
1011 Ga0495663_0209770
1012 Ga0495586_0245546
1013 Ga0495645_0005751
1014 Ga0495634_0285136
1015 Ga0495647_0033169
1016 Ga0495647_0292328
1017 Ga0495647_0326384
1018 Ga0495658_0023851
1019 Ga0495658_0463803
1020 Ga0495669_0368710
1021 Ga0495624_0464953
1022 Ga0495604_0388325
1023 Ga0495674_0131432
1024 Ga0495680_0882015
1025 Ga0495684_0230777
1026 Ga0495684_0488740
1027 Ga0496102_0813973
1028 Ga0496102_1175327
1029 Ga0496104_0041679
1030 Ga0496105_0276526
1031 Ga0496105_0956245
1032 Ga0496106_0172058
1033 Ga0496106_0531946
1034 Ga0496108_0156250
1035 Ga0496109_0095417
1036 Ga0496109_0995354
1037 Ga0496112_0059572
1038 Ga0496112_0607261
1039 Ga0496113_0119924
1040 Ga0501074_1083044
1041 Ga0501202_138943
1042 Ga0501081_0771111
1043 Ga0501045_0262806
1044 nmdc:mga05p37_1256_c1
1045 nmdc:mga05p37_14921_c1
1046 nmdc:mga05p37_15750_c1
1047 nmdc:mga05p37_266498_c1
1048 nmdc:mga05p37_361318_c1
1049 nmdc:mga05p37_86323_c1
1050 nmdc:mga05p37_887840_c1
1051 nmdc:mga05p37_97240_c1
1052 nmdc:mga08y16_10630_c1
1053 nmdc:mga08y16_134669_c1
1054 nmdc:mga08y16_152205_c1
1055 nmdc:mga08y16_3723_c1
1056 nmdc:mga08y16_913_c1
1057 nmdc:mga0n895_1057083_c1
1058 nmdc:mga0n895_121623_c1
1059 nmdc:mga0n895_142512_c1
1060 nmdc:mga0n895_177_c1
1061 nmdc:mga0n895_31547_c1
1062 nmdc:mga0n895_380258_c1
1063 nmdc:mga0n895_661111_c1
1064 nmdc:mga0n895_9966_c1
1065 nmdc:mga0rr50_117207_c1
1066 nmdc:mga0rr50_33814_c1
1067 nmdc:mga0rr50_36_c1
1068 nmdc:mga0rr50_396807_c1
1069 nmdc:mga0rr50_693_c1
1070 nmdc:mga0rr50_773189_c1
1071 nmdc:mga08x19_172479_c1
1072 nmdc:mga08x19_22564_c1
1073 nmdc:mga08x19_31403_c1
1074 nmdc:mga08x19_32555_c1
1075 nmdc:mga08x19_32781_c1
1076 nmdc:mga08x19_567_c1
1077 nmdc:mga08x19_80767_c1
1078 nmdc:mga0a205_199363_c1
1079 nmdc:mga0a205_25598_c1
1080 nmdc:mga0a205_5434_c1
1081 Ga0495601_0124138
1082 Ga0495595_0082861
1083 Ga0495619_0046097
1084 Ga0495619_0182290
1085 Ga0495619_0196904
1086 Ga0530510_0359098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09835

DUF2062

Uncharacterized protein conserved in bacteria (DUF2062)

6

161

0.93

Map