F461579

General Info

Members Datasets Scaffolds Average Seq Length
543 251 1086 183

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100406814|Ga0070683_1004068142
Length 187
Sequence MKRFLLWAAAFVAVIGLVAAYAIETEPDWYVRVRYPLHYETIVKSHAKNYDLDPAMVAAVIYAESKFDPGTTSAAGAVGLMQLLPQTAQGIADRTGGAHYTEADLADPEINVRYGCWYLEHLRAKYRKTGDATRLALAAYNAGQANVDRWVDETPPGRRVAIPYPETRAYIARVMHLRDLYRRAYHL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.21
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100406814 3300005329 Bacteria 1298
2 Ga0070676_10066051 3300005328 Bacteria 2161
3 Ga0070683_100069809 3300005329 Bacteria 3276
4 Ga0070683_100252866 3300005329 Bacteria 1676
5 Ga0070690_101121102 3300005330 Bacteria 625
6 Ga0070677_10105234 3300005333 Bacteria 1251
7 Ga0070666_10093123 3300005335 Bacteria 2072
8 Ga0070680_100017126 3300005336 Bacteria 5708
9 Ga0070680_100162155 3300005336 Unclassified 1879
10 Ga0070682_100083184 3300005337 Bacteria 2076
11 Ga0068868_100603620 3300005338 Bacteria 973
12 Ga0070660_100796758 3300005339 Bacteria 794
13 Ga0070687_100283986 3300005343 Bacteria 1043
14 Ga0070692_10306921 3300005345 Bacteria 971
15 Ga0070671_100085693 3300005355 Bacteria 2636
16 Ga0070671_100332129 3300005355 Unclassified 1296
17 Ga0070671_100345687 3300005355 Bacteria 1269
18 Ga0070671_100779010 3300005355 Bacteria 832
19 Ga0070673_100646648 3300005364 Bacteria 968
20 Ga0070659_100165477 3300005366 Bacteria 1809
21 Ga0070667_100199153 3300005367 Bacteria 1777
22 Ga0070667_101015474 3300005367 Bacteria 774
23 Ga0070703_10001137 3300005406 Bacteria 8225
24 Ga0070703_10027342 3300005406 Bacteria 1700
25 Ga0070709_10220101 3300005434 Bacteria 1353
26 Ga0070709_10249715 3300005434 Bacteria 1277
27 Ga0070714_100018222 3300005435 Bacteria 5699
28 Ga0070714_100101082 3300005435 Bacteria 2540
29 Ga0070713_100269515 3300005436 Bacteria 1559
30 Ga0070713_100384793 3300005436 Unclassified 1308
31 Ga0070713_100725948 3300005436 Bacteria 949
32 Ga0070710_10023210 3300005437 Bacteria 3257
33 Ga0070701_10027325 3300005438 Bacteria 2794
34 Ga0070711_100132763 3300005439 Bacteria 1857
35 Ga0070711_100144646 3300005439 Bacteria 1786
36 Ga0070711_100334934 3300005439 Bacteria 1212
37 Ga0070711_100450277 3300005439 Bacteria 1054
38 Ga0070705_100037545 3300005440 Bacteria 2733
39 Ga0070705_100048694 3300005440 Bacteria 2456
40 Ga0070700_100127389 3300005441 Bacteria 1713
41 Ga0070700_100305886 3300005441 Unclassified 1162
42 Ga0070694_100083654 3300005444 Bacteria 2224
43 Ga0070708_100038966 3300005445 Bacteria 4155
44 Ga0070708_100119050 3300005445 Bacteria 2434
45 Ga0070708_101071363 3300005445 Bacteria 755
46 Ga0070663_100143994 3300005455 Bacteria 1822
47 Ga0070678_100057103 3300005456 Bacteria 2858
48 Ga0070678_100249979 3300005456 Bacteria 1486
49 Ga0070678_100744586 3300005456 Bacteria 886
50 Ga0070662_100015962 3300005457 Bacteria 5038
51 Ga0070681_10144149 3300005458 Bacteria 2311
52 Ga0070681_11124464 3300005458 Bacteria 707
53 Ga0068867_100096099 3300005459 Bacteria 2255
54 Ga0070685_10131295 3300005466 Bacteria 1566
55 Ga0070706_100063956 3300005467 Bacteria 3400
56 Ga0070706_100149118 3300005467 Unclassified 2183
57 Ga0070706_100552781 3300005467 Bacteria 1071
58 Ga0070707_100012019 3300005468 Bacteria 8081
59 Ga0070707_100174850 3300005468 Unclassified 2093
60 Ga0070698_100075442 3300005471 Bacteria 3376
61 Ga0070698_100098828 3300005471 Unclassified 2892
62 Ga0070699_100047662 3300005518 Bacteria 3708
63 Ga0070699_100597840 3300005518 Unclassified 1006
64 Ga0070679_100398882 3300005530 Bacteria 1321
65 Ga0070684_100297379 3300005535 Bacteria 1481
66 Ga0070697_100094509 3300005536 Bacteria 2477
67 Ga0070697_100986350 3300005536 Bacteria 749
68 Ga0068853_100533325 3300005539 Bacteria 1111
69 Ga0070686_100194549 3300005544 Unclassified 1449
70 Ga0070686_101226466 3300005544 Bacteria 624
71 Ga0070695_100257025 3300005545 Bacteria 1274
72 Ga0070696_100023520 3300005546 Bacteria 4189
73 Ga0070696_100034536 3300005546 Bacteria 3479
74 Ga0070696_100097945 3300005546 Bacteria 2097
75 Ga0070696_100207658 3300005546 Unclassified 1465
76 Ga0070696_100376313 3300005546 Bacteria 1106
77 Ga0070693_100012458 3300005547 Bacteria 4303
78 Ga0070693_100016284 3300005547 Bacteria 3845
79 Ga0070693_100095982 3300005547 Bacteria 1796
80 Ga0070665_101140741 3300005548 Unclassified 791
81 Ga0070704_100077084 3300005549 Bacteria 2441
82 Ga0070704_100195100 3300005549 Bacteria 1630
83 Ga0070664_100223241 3300005564 Bacteria 1686
84 Ga0068857_100066913 3300005577 Bacteria 3197
85 Ga0068857_100253197 3300005577 Unclassified 1615
86 Ga0068854_100127075 3300005578 Bacteria 1943
87 Ga0068854_100147071 3300005578 Unclassified 1814
88 Ga0068854_100958135 3300005578 Bacteria 755
89 Ga0068856_100163023 3300005614 Bacteria 2240
90 Ga0068856_100507870 3300005614 Bacteria 1226
91 Ga0068856_100919440 3300005614 Bacteria 894
92 Ga0070702_100084634 3300005615 Bacteria 1908
93 Ga0070702_100436301 3300005615 Bacteria 946
94 Ga0068852_100743505 3300005616 Bacteria 993
95 Ga0068864_100675625 3300005618 Unclassified 1007
96 Ga0068866_10035607 3300005718 Bacteria 2433
97 Ga0068866_10504986 3300005718 Bacteria 801
98 Ga0068861_100048746 3300005719 Bacteria 3203
99 Ga0068861_100056781 3300005719 Bacteria 2989
100 Ga0068861_100080597 3300005719 Bacteria 2547
101 Ga0068861_100090018 3300005719 Bacteria 2419
102 Ga0068861_100617905 3300005719 Bacteria 997
103 Ga0068863_100679816 3300005841 Bacteria 1022
104 Ga0068858_100235575 3300005842 Unclassified 1736
105 Ga0068860_100097047 3300005843 Bacteria 2810
106 Ga0068860_100427607 3300005843 Bacteria 1313
107 Ga0068862_100101506 3300005844 Bacteria 2517
108 Ga0068862_100408473 3300005844 Bacteria 1271
109 Ga0081455_10016996 3300005937 Bacteria 6994
110 Ga0081540_1005495 3300005983 Bacteria 9454
111 Ga0081540_1014615 3300005983 Bacteria 5018
112 Ga0070717_10033596 3300006028 Bacteria 4139
113 Ga0075432_10026611 3300006058 Bacteria 1987
114 Ga0075432_10091468 3300006058 Unclassified 1114
115 Ga0075432_10126453 3300006058 Bacteria 964
116 Ga0070715_10013621 3300006163 Bacteria 2991
117 Ga0070715_10032829 3300006163 Bacteria 2117
118 Ga0070715_10149496 3300006163 Bacteria 1143
119 Ga0070716_100074205 3300006173 Bacteria 2009
120 Ga0070716_100098147 3300006173 Bacteria 1789
121 Ga0070716_100184305 3300006173 Bacteria 1373
122 Ga0070716_100248287 3300006173 Bacteria 1211
123 Ga0070712_100019260 3300006175 Bacteria 4448
124 Ga0070712_100070530 3300006175 Bacteria 2497
125 Ga0070712_100240679 3300006175 Bacteria 1441
126 Ga0070712_100584182 3300006175 Unclassified 944
127 Ga0097621_100568064 3300006237 Bacteria 1034
128 Ga0075431_100010672 3300006847 Bacteria 9231
129 Ga0075431_100034077 3300006847 Bacteria 5247
130 Ga0075433_10055874 3300006852 Bacteria 3447
131 Ga0075433_10215362 3300006852 Unclassified 1707
132 Ga0075434_100021745 3300006871 Bacteria 6238
133 Ga0075434_100066773 3300006871 Bacteria 3583
134 Ga0075429_100271310 3300006880 Bacteria 1486
135 Ga0068865_100123328 3300006881 Bacteria 1930
136 Ga0068865_100164601 3300006881 Bacteria 1695
137 Ga0075436_100016368 3300006914 Bacteria 5074
138 Ga0075436_100031530 3300006914 Bacteria 3650
139 Ga0075436_100065410 3300006914 Bacteria 2513
140 Ga0075436_100259135 3300006914 Bacteria 1240
141 Ga0075435_100011974 3300007076 Bacteria 6407
142 Ga0075435_100337269 3300007076 Bacteria 1292
143 Ga0105250_10080298 3300009092 Bacteria 1322
144 Ga0111539_10010767 3300009094 Bacteria 11513
145 Ga0111539_10104386 3300009094 Bacteria 3325
146 Ga0111539_10444553 3300009094 Unclassified 1510
147 Ga0111539_10786452 3300009094 Bacteria 1107
148 Ga0105245_10010346 3300009098 Bacteria 8125
149 Ga0105245_10020781 3300009098 Bacteria 5755
150 Ga0105245_10129615 3300009098 Bacteria 2365
151 Ga0105245_10145672 3300009098 Bacteria 2235
152 Ga0105245_10170144 3300009098 Bacteria 2074
153 Ga0105245_10321649 3300009098 Bacteria 1524
154 Ga0105245_11288925 3300009098 Bacteria 779
155 Ga0105245_11523387 3300009098 Bacteria 720
156 Ga0105247_10306456 3300009101 Unclassified 1103
157 Ga0114129_10047208 3300009147 Bacteria 6052
158 Ga0114129_10201950 3300009147 Bacteria 2692
159 Ga0114129_10283632 3300009147 Bacteria 2212
160 Ga0114129_10479125 3300009147 Bacteria 1628
161 Ga0114129_10677271 3300009147 Bacteria 1328
162 Ga0105243_10028720 3300009148 Bacteria 4271
163 Ga0105243_10142609 3300009148 Bacteria 2046
164 Ga0105243_10254247 3300009148 Bacteria 1570
165 Ga0105243_10267487 3300009148 Bacteria 1533
166 Ga0105241_10029995 3300009174 Bacteria 4062
167 Ga0105241_10135492 3300009174 Bacteria 1999
168 Ga0105242_10087733 3300009176 Bacteria 2612
169 Ga0105242_10247400 3300009176 Bacteria 1605
170 Ga0105242_10395200 3300009176 Unclassified 1289
171 Ga0105242_10403104 3300009176 Bacteria 1277
172 Ga0105248_10184073 3300009177 Bacteria 2354
173 Ga0105248_10273657 3300009177 Bacteria 1901
174 Ga0105248_11246430 3300009177 Unclassified 841
175 Ga0105238_10693441 3300009551 Bacteria 1030
176 Ga0105249_10429156 3300009553 Bacteria 1357
177 Ga0105249_10840374 3300009553 Bacteria 983
178 Ga0105239_10030349 3300010375 Bacteria 5943
179 Ga0105239_10485520 3300010375 Bacteria 1404
180 Ga0105239_10515632 3300010375 Bacteria 1360
181 Ga0105239_10814480 3300010375 Bacteria 1070
182 Ga0105239_11108235 3300010375 Unclassified 911
183 Ga0157373_10121909 3300013100 Unclassified 1832
184 Ga0157373_10363597 3300013100 Unclassified 1033
185 Ga0157371_10337601 3300013102 Bacteria 1095
186 Ga0157369_11446399 3300013105 Bacteria 699
187 Ga0157374_10230711 3300013296 Unclassified 1818
188 Ga0157374_10767627 3300013296 Bacteria 979
189 Ga0157374_11288128 3300013296 Bacteria 753
190 Ga0157378_10166072 3300013297 Bacteria 2068
191 Ga0157378_11134005 3300013297 Unclassified 820
192 Ga0163162_10302021 3300013306 Bacteria 1733
193 Ga0163162_10624087 3300013306 Bacteria 1203
194 Ga0163162_11357889 3300013306 Bacteria 808
195 Ga0157372_10222465 3300013307 Bacteria 2188
196 Ga0157372_10225187 3300013307 Bacteria 2174
197 Ga0157375_10073824 3300013308 Bacteria 3431
198 Ga0157375_10194500 3300013308 Bacteria 2183
199 Ga0157375_11067268 3300013308 Unclassified 945
200 Ga0157375_11880035 3300013308 Unclassified 710
201 Ga0163163_10179330 3300014325 Bacteria 2165
202 Ga0157380_10159290 3300014326 Bacteria 1960
203 Ga0182008_10238425 3300014497 Bacteria 935
204 Ga0157377_10108249 3300014745 Bacteria 1667
205 Ga0157376_10182951 3300014969 Bacteria 1917
206 Ga0157376_10433649 3300014969 Bacteria 1278
207 Ga0163161_10119846 3300017792 Bacteria 1976
208 Ga0207653_10002274 3300025885 Bacteria 6122
209 Ga0207653_10013257 3300025885 Bacteria 2580
210 Ga0207692_10030137 3300025898 Bacteria 2584
211 Ga0207688_10049219 3300025901 Bacteria 2355
212 Ga0207680_10233227 3300025903 Bacteria 1265
213 Ga0207685_10006227 3300025905 Bacteria 3231
214 Ga0207685_10066144 3300025905 Bacteria 1449
215 Ga0207685_10108790 3300025905 Bacteria 1198
216 Ga0207699_10022585 3300025906 Bacteria 3412
217 Ga0207699_10122172 3300025906 Bacteria 1686
218 Ga0207684_10011819 3300025910 Bacteria 7611
219 Ga0207684_10174444 3300025910 Bacteria 1853
220 Ga0207684_11061139 3300025910 Bacteria 676
221 Ga0207654_10036515 3300025911 Bacteria 2746
222 Ga0207654_10140244 3300025911 Bacteria 1541
223 Ga0207707_10202148 3300025912 Bacteria 1732
224 Ga0207707_10409800 3300025912 Bacteria 1163
225 Ga0207693_10002624 3300025915 Bacteria 15613
226 Ga0207693_10006384 3300025915 Bacteria 9770
227 Ga0207693_10007749 3300025915 Bacteria 8812
228 Ga0207693_10016371 3300025915 Bacteria 5926
229 Ga0207693_10018429 3300025915 Bacteria 5561
230 Ga0207693_10455118 3300025915 Unclassified 1000
231 Ga0207663_10018798 3300025916 Bacteria 3881
232 Ga0207663_10039527 3300025916 Bacteria 2859
233 Ga0207663_10220313 3300025916 Bacteria 1380
234 Ga0207660_10136659 3300025917 Bacteria 1871
235 Ga0207660_10315996 3300025917 Bacteria 1246
236 Ga0207662_10014706 3300025918 Bacteria 4393
237 Ga0207657_10023362 3300025919 Bacteria 5758
238 Ga0207657_10283488 3300025919 Bacteria 1315
239 Ga0207652_11040369 3300025921 Bacteria 718
240 Ga0207646_10011788 3300025922 Bacteria 8443
241 Ga0207646_10236783 3300025922 Bacteria 1649
242 Ga0207694_11000139 3300025924 Unclassified 708
243 Ga0207659_10207484 3300025926 Bacteria 1568
244 Ga0207687_10039012 3300025927 Bacteria 3250
245 Ga0207687_10160067 3300025927 Bacteria 1727
246 Ga0207687_10181104 3300025927 Bacteria 1633
247 Ga0207687_10232096 3300025927 Bacteria 1458
248 Ga0207687_11127997 3300025927 Bacteria 674
249 Ga0207700_10041254 3300025928 Bacteria 3375
250 Ga0207700_10275820 3300025928 Bacteria 1445
251 Ga0207664_10256397 3300025929 Bacteria 1528
252 Ga0207664_10314045 3300025929 Bacteria 1381
253 Ga0207664_10478887 3300025929 Bacteria 1113
254 Ga0207644_10058330 3300025931 Bacteria 2790
255 Ga0207644_10410865 3300025931 Bacteria 1108
256 Ga0207690_10028991 3300025932 Bacteria 3514
257 Ga0207690_10279046 3300025932 Bacteria 1301
258 Ga0207706_10032825 3300025933 Bacteria 4620
259 Ga0207706_10038598 3300025933 Bacteria 4236
260 Ga0207686_10201077 3300025934 Bacteria 1427
261 Ga0207686_10245476 3300025934 Bacteria 1305
262 Ga0207686_10632612 3300025934 Bacteria 845
263 Ga0207709_10356704 3300025935 Bacteria 1106
264 Ga0207709_10461666 3300025935 Bacteria 984
265 Ga0207669_10305550 3300025937 Bacteria 1211
266 Ga0207704_10143499 3300025938 Bacteria 1674
267 Ga0207704_10739072 3300025938 Bacteria 817
268 Ga0207665_10004115 3300025939 Bacteria 9701
269 Ga0207665_10042220 3300025939 Bacteria 3048
270 Ga0207665_10082109 3300025939 Bacteria 2220
271 Ga0207665_10220741 3300025939 Bacteria 1389
272 Ga0207665_10501241 3300025939 Bacteria 938
273 Ga0207711_10182963 3300025941 Bacteria 1907
274 Ga0207711_10865043 3300025941 Unclassified 841
275 Ga0207661_10051051 3300025944 Bacteria 3299
276 Ga0207661_10224816 3300025944 Bacteria 1660
277 Ga0207679_10428952 3300025945 Bacteria 1168
278 Ga0207667_10248634 3300025949 Bacteria 1819
279 Ga0207667_10378498 3300025949 Bacteria 1442
280 Ga0207651_10606655 3300025960 Unclassified 957
281 Ga0207712_10112541 3300025961 Bacteria 2044
282 Ga0207668_10094119 3300025972 Bacteria 2209
283 Ga0207668_10119530 3300025972 Bacteria 1993
284 Ga0207668_10256255 3300025972 Unclassified 1424
285 Ga0207640_10545818 3300025981 Bacteria 973
286 Ga0207677_10067519 3300026023 Bacteria 2505
287 Ga0207677_10071114 3300026023 Unclassified 2454
288 Ga0207677_10157974 3300026023 Bacteria 1758
289 Ga0207639_10054633 3300026041 Bacteria 3053
290 Ga0207678_10147747 3300026067 Bacteria 2006
291 Ga0207678_10213908 3300026067 Bacteria 1649
292 Ga0207708_10009793 3300026075 Bacteria 7110
293 Ga0207708_10425290 3300026075 Bacteria 1102
294 Ga0207702_10418517 3300026078 Bacteria 1295
295 Ga0207648_10011542 3300026089 Bacteria 8318
296 Ga0207676_10103894 3300026095 Unclassified 2362
297 Ga0207674_10016976 3300026116 Bacteria 7949
298 Ga0207674_10176819 3300026116 Bacteria 2087
299 Ga0207675_100004110 3300026118 Bacteria 14084
300 Ga0207675_100008413 3300026118 Bacteria 9724
301 Ga0207675_100011574 3300026118 Bacteria 8250
302 Ga0207675_100102368 3300026118 Bacteria 2699
303 Ga0207675_100273849 3300026118 Bacteria 1639
304 Ga0207683_10004490 3300026121 Bacteria 12043
305 Ga0207683_10023685 3300026121 Bacteria 5281
306 Ga0207683_10075723 3300026121 Bacteria 2979
307 Ga0207683_10122444 3300026121 Bacteria 2336
308 Ga0207698_10178190 3300026142 Bacteria 1879
309 Ga0207428_10012563 3300027907 Bacteria 7431
310 Ga0207428_10020098 3300027907 Bacteria 5681
311 Ga0268265_10083560 3300028380 Bacteria 2529
312 Ga0268265_10132848 3300028380 Bacteria 2072
313 Ga0268264_10308413 3300028381 Bacteria 1492
314 Ga0307405_10234027 3300031731 Unclassified 1356
315 Ga0307413_10024481 3300031824 Bacteria 3292
316 Ga0307406_10011666 3300031901 Bacteria 4988
317 Ga0307407_10375787 3300031903 Bacteria 1013
318 Ga0307409_100012380 3300031995 Bacteria 5435
319 Ga0307409_100013846 3300031995 Bacteria 5215
320 Ga0307416_100000650 3300032002 Bacteria 17947
321 Ga0307416_100978687 3300032002 Bacteria 949
322 Ga0307415_100000143 3300032126 Bacteria 31696
323 Ga0307415_100100109 3300032126 Bacteria 2123
324 Ga0373948_0009344 3300034817 Bacteria 1689
325 Ga0373948_0014242 3300034817 Bacteria 1446
326 Ga0373950_0015483 3300034818 Bacteria 1294
327 Ga0373940_0000716 3300035088 Bacteria 5378
328 Ga0373949_0061580 3300035090 Bacteria 966
329 Ga0373932_0001414 3300035112 Bacteria 6724
330 Ga0373939_0012961 3300035114 Bacteria 2135
331 Ga0373941_0000637 3300035115 Bacteria 7090
332 Ga0373941_0060679 3300035115 Bacteria 1230
333 Ga0373945_0293892 3300035116 Bacteria 695
334 Ga0373960_0000254 3300035121 Bacteria 10071
335 Ga0373960_0083662 3300035121 Bacteria 1009
336 Ga0373960_0209944 3300035121 Bacteria 692
337 Ga0373943_0007042 3300035170 Bacteria 5045
338 Ga0373946_0072369 3300035171 Bacteria 1492
339 Ga0373942_0001189 3300035207 Bacteria 6871
340 Ga0373942_0014431 3300035207 Bacteria 1913
341 Ga0373961_0011270 3300035241 Bacteria 2216
342 Ga0373962_0001093 3300035242 Bacteria 6302
343 Ga0373931_0003520 3300035691 Bacteria 7054
344 Ga0373927_0313951 3300035695 Unclassified 1032
345 Ga0373947_0083798 3300035725 Bacteria 1977
346 Ga0373925_0238770 3300037068 Bacteria 1455
347 Ga0395899_0002426 3300037312 Bacteria 15159
348 Ga0395899_0012747 3300037312 Bacteria 6441
349 Ga0395899_0143835 3300037312 Unclassified 1695
350 Ga0395900_0005251 3300037418 Bacteria 13588
351 Ga0395900_0005325 3300037418 Bacteria 13486
352 Ga0395900_0011662 3300037418 Bacteria 8990
353 Ga0395900_0033279 3300037418 Bacteria 5306
354 Ga0395900_0157196 3300037418 Bacteria 2321
355 Ga0395898_0004932 3300037466 Bacteria 14484
356 Ga0395898_0010725 3300037466 Bacteria 9572
357 Ga0395898_0026369 3300037466 Bacteria 5848
358 Ga0395898_0071992 3300037466 Bacteria 3340
359 Ga0395898_0095180 3300037466 Bacteria 2861
360 Ga0395898_0775744 3300037466 Bacteria 899
361 Ga0395898_1243611 3300037466 Bacteria 675
362 Ga0395905_0005130 3300037471 Bacteria 13449
363 Ga0395905_0009604 3300037471 Bacteria 9446
364 Ga0395905_0036433 3300037471 Bacteria 4620
365 Ga0395905_0067836 3300037471 Bacteria 3341
366 Ga0395905_0114735 3300037471 Bacteria 2531
367 Ga0395901_0001479 3300038443 Bacteria 24446
368 Ga0395901_0015041 3300038443 Bacteria 7868
369 Ga0395901_0025769 3300038443 Bacteria 6037
370 Ga0395901_0031599 3300038443 Bacteria 5458
371 Ga0395901_0219167 3300038443 Bacteria 1989
372 Ga0395901_0242757 3300038443 Unclassified 1878
373 Ga0395901_0973116 3300038443 Unclassified 826
374 Ga0451793_1068102 3300041452 Bacteria 930
375 Ga0451807_2030857 3300041486 Bacteria 919
376 Ga0451853_1566837 3300041512 Bacteria 722
377 Ga0466972_0143670 3300044658 Bacteria 1123
378 Ga0466965_0070071 3300044683 Bacteria 1762
379 Ga0466963_0284439 3300044694 Bacteria 1162
380 Ga0466964_0000152 3300044706 Bacteria 18754
381 Ga0466964_0035328 3300044706 Bacteria 1998
382 Ga0466960_0011298 3300044901 Bacteria 3731
383 Ga0466960_0058271 3300044901 Bacteria 1886
384 Ga0466960_0074722 3300044901 Unclassified 1694
385 Ga0451576_0139442 3300045051 Bacteria 2529
386 Ga0451576_0594016 3300045051 Unclassified 1163
387 Ga0466958_0247411 3300045836 Bacteria 1140
388 Ga0466967_0003163 3300045976 Bacteria 10615
389 Ga0466967_0063135 3300045976 Bacteria 3290
390 Ga0466967_0209966 3300045976 Unclassified 1846
391 Ga0466967_0468133 3300045976 Bacteria 1233
392 Ga0495603_0003954 3300046455 Bacteria 8828
393 Ga0495641_0002229 3300046461 Bacteria 15458
394 Ga0495641_0243463 3300046461 Unclassified 808
395 Ga0495582_0007052 3300046473 Bacteria 6245
396 Ga0495582_0683838 3300046473 Bacteria 594
397 Ga0495639_0263387 3300046475 Bacteria 854
398 Ga0495664_0261566 3300046477 Bacteria 1046
399 Ga0495664_0299545 3300046477 Unclassified 971
400 Ga0495584_0290445 3300046491 Unclassified 831
401 Ga0495584_0311652 3300046491 Unclassified 799
402 Ga0495584_0419496 3300046491 Bacteria 680
403 Ga0495594_0000937 3300046499 Bacteria 15113
404 Ga0495594_0260210 3300046499 Unclassified 988
405 Ga0495594_0452646 3300046499 Bacteria 730
406 Ga0495596_0176579 3300046500 Bacteria 830
407 Ga0495628_0106626 3300046516 Bacteria 2158
408 Ga0495630_0072198 3300046517 Bacteria 2598
409 Ga0495630_0359946 3300046517 Bacteria 1114
410 Ga0495631_0331446 3300046518 Bacteria 648
411 Ga0495637_0130603 3300046520 Bacteria 960
412 Ga0495644_0066322 3300046523 Bacteria 1356
413 Ga0495644_0212324 3300046523 Bacteria 747
414 Ga0495666_0171265 3300046526 Unclassified 1004
415 Ga0495642_0281604 3300046528 Bacteria 728
416 Ga0495652_0341893 3300046529 Unclassified 1075
417 Ga0495640_0167407 3300046533 Bacteria 1406
418 Ga0495609_0354268 3300046538 Unclassified 592
419 Ga0495621_0338949 3300046539 Bacteria 629
420 Ga0495645_0365281 3300046543 Bacteria 927
421 Ga0495622_0181950 3300046557 Unclassified 942
422 Ga0495661_0324147 3300046665 Bacteria 765
423 Ga0495588_0000535 3300046674 Bacteria 18325
424 Ga0495599_0163434 3300046678 Bacteria 1376
425 Ga0495658_0013990 3300046683 Bacteria 4091
426 Ga0495600_0345208 3300046809 Bacteria 933
427 Ga0495581_0120645 3300047315 Bacteria 1526
428 Ga0495604_0192587 3300047317 Bacteria 1420
429 Ga0495674_0088525 3300047319 Bacteria 2648
430 Ga0495676_0010664 3300047321 Bacteria 8323
431 Ga0495676_0092040 3300047321 Bacteria 2264
432 Ga0495676_0130263 3300047321 Bacteria 1817
433 Ga0495676_0562585 3300047321 Bacteria 744
434 Ga0495680_0109734 3300047322 Bacteria 2045
435 Ga0495680_0281546 3300047322 Bacteria 1172
436 Ga0495677_0278637 3300047445 Bacteria 656
437 Ga0496100_0074992 3300048903 Bacteria 2267
438 Ga0496100_0106790 3300048903 Bacteria 1938
439 Ga0496100_0198844 3300048903 Bacteria 1459
440 Ga0496101_0022517 3300048904 Bacteria 4338
441 Ga0496101_0103246 3300048904 Bacteria 2136
442 Ga0496101_0126757 3300048904 Bacteria 1935
443 Ga0496102_0040077 3300048905 Bacteria 4236
444 Ga0496102_0053587 3300048905 Bacteria 3676
445 Ga0496102_0063974 3300048905 Bacteria 3368
446 Ga0496102_0102824 3300048905 Bacteria 2656
447 Ga0496102_0242769 3300048905 Bacteria 1698
448 Ga0496102_0623273 3300048905 Bacteria 1002
449 Ga0496103_0006564 3300048906 Bacteria 6937
450 Ga0496103_0021761 3300048906 Bacteria 3859
451 Ga0496103_0026698 3300048906 Bacteria 3495
452 Ga0496103_0047735 3300048906 Bacteria 2646
453 Ga0496103_0190073 3300048906 Bacteria 1320
454 Ga0496103_0362208 3300048906 Bacteria 932
455 Ga0496103_0382456 3300048906 Bacteria 904
456 Ga0496104_0000274 3300048907 Bacteria 45916
457 Ga0496104_0005799 3300048907 Bacteria 10814
458 Ga0496104_0011865 3300048907 Bacteria 7821
459 Ga0496104_0015223 3300048907 Bacteria 6964
460 Ga0496104_0049591 3300048907 Bacteria 3958
461 Ga0496104_0091305 3300048907 Bacteria 2911
462 Ga0496104_0111607 3300048907 Bacteria 2622
463 Ga0496105_0000353 3300048908 Bacteria 30311
464 Ga0496105_0002803 3300048908 Bacteria 12747
465 Ga0496105_0016840 3300048908 Bacteria 5845
466 Ga0496105_0027261 3300048908 Bacteria 4664
467 Ga0496105_0050556 3300048908 Bacteria 3433
468 Ga0496106_0011545 3300048909 Bacteria 6529
469 Ga0496106_0027014 3300048909 Bacteria 4273
470 Ga0496106_0051738 3300048909 Bacteria 3097
471 Ga0496106_1007144 3300048909 Unclassified 655
472 Ga0496107_0020449 3300048910 Bacteria 4675
473 Ga0496107_0020836 3300048910 Bacteria 4633
474 Ga0496107_0053211 3300048910 Bacteria 2921
475 Ga0496107_0085693 3300048910 Bacteria 2299
476 Ga0496107_0265523 3300048910 Bacteria 1277
477 Ga0496107_0320441 3300048910 Bacteria 1153
478 Ga0496108_0001987 3300048911 Bacteria 16369
479 Ga0496108_0017821 3300048911 Bacteria 5808
480 Ga0496108_0019883 3300048911 Bacteria 5516
481 Ga0496108_0551830 3300048911 Bacteria 1005
482 Ga0496108_0920632 3300048911 Bacteria 750
483 Ga0496109_0003101 3300048912 Bacteria 13861
484 Ga0496109_0048808 3300048912 Bacteria 3851
485 Ga0496109_0082361 3300048912 Bacteria 2965
486 Ga0496109_0097095 3300048912 Bacteria 2730
487 Ga0496109_0179836 3300048912 Bacteria 1986
488 Ga0496109_0281521 3300048912 Bacteria 1567
489 Ga0496109_0323292 3300048912 Unclassified 1456
490 Ga0496109_0678461 3300048912 Bacteria 968
491 Ga0496110_0000168 3300048913 Bacteria 40052
492 Ga0496110_0001565 3300048913 Bacteria 16678
493 Ga0496110_0013397 3300048913 Bacteria 6778
494 Ga0496110_0037260 3300048913 Bacteria 4227
495 Ga0496110_0102028 3300048913 Bacteria 2573
496 Ga0496110_0108813 3300048913 Bacteria 2489
497 Ga0496110_0675154 3300048913 Bacteria 934
498 Ga0496111_0001900 3300048914 Bacteria 12365
499 Ga0496111_0028041 3300048914 Bacteria 3989
500 Ga0496111_0050996 3300048914 Bacteria 2987
501 Ga0496112_0001216 3300048915 Bacteria 19358
502 Ga0496112_0047452 3300048915 Bacteria 4213
503 Ga0496113_0000631 3300048916 Bacteria 17715
504 Ga0496113_0001615 3300048916 Bacteria 12684
505 Ga0496113_0007999 3300048916 Bacteria 6853
506 Ga0496113_0017132 3300048916 Bacteria 5023
507 Ga0496113_0209294 3300048916 Bacteria 1552
508 Ga0496113_1072492 3300048916 Bacteria 633
509 Ga0496114_0012572 3300048917 Bacteria 6781
510 Ga0496114_0025123 3300048917 Bacteria 4867
511 Ga0496114_0027677 3300048917 Bacteria 4646
512 Ga0496114_0050829 3300048917 Bacteria 3451
513 Ga0496114_0056591 3300048917 Bacteria 3273
514 Ga0496114_0154977 3300048917 Bacteria 1989
515 Ga0496114_0180346 3300048917 Unclassified 1844
516 Ga0496114_0214056 3300048917 Bacteria 1690
517 Ga0496114_0432662 3300048917 Bacteria 1165
518 Ga0496115_0012131 3300048918 Bacteria 6481
519 Ga0496115_0023494 3300048918 Bacteria 4784
520 Ga0496115_0027925 3300048918 Bacteria 4417
521 Ga0496115_0062689 3300048918 Bacteria 2999
522 Ga0496115_0115828 3300048918 Bacteria 2204
523 Ga0501067_0074466 3300049583 Bacteria 1881
524 Ga0501067_0146700 3300049583 Bacteria 1315
525 nmdc:mga05p37_1498140_c1 3300050507 Bacteria 672
526 nmdc:mga05p37_233106_c1 3300050507 Bacteria 2217
527 nmdc:mga05p37_29935_c1 3300050507 Bacteria 6645
528 nmdc:mga05p37_435796_c1 3300050507 Unclassified 1521
529 nmdc:mga06r32_18700_c1 3300050510 Bacteria 6348
530 nmdc:mga08y16_28641_c1 3300050511 Bacteria 5872
531 nmdc:mga08y16_40458_c1 3300050511 Bacteria 4887
532 nmdc:mga0n895_41637_c1 3300050512 Bacteria 4467
533 nmdc:mga0rr50_23087_c1 3300050513 Bacteria 4283
534 nmdc:mga0rr50_304270_c1 3300050513 Bacteria 1334
535 nmdc:mga08x19_10240_c1 3300050514 Bacteria 5625
536 nmdc:mga08x19_156781_c1 3300050514 Bacteria 1544
537 nmdc:mga08x19_38828_c1 3300050514 Bacteria 3025
538 nmdc:mga0a205_126829_c1 3300050515 Unclassified 2452
539 nmdc:mga0a205_38274_c1 3300050515 Bacteria 4614
540 Ga0495595_0111486 3300053084 Bacteria 1327
541 Ga0495619_0068630 3300053085 Bacteria 2369
542 Ga0495619_0373777 3300053085 Unclassified 985
543 Ga0501084_0266843 3300054114 Unclassified 1445
544 Ga0070683_100406814
545 Ga0070676_10066051
546 Ga0070683_100069809
547 Ga0070683_100252866
548 Ga0070690_101121102
549 Ga0070677_10105234
550 Ga0070666_10093123
551 Ga0070680_100017126
552 Ga0070680_100162155
553 Ga0070682_100083184
554 Ga0068868_100603620
555 Ga0070660_100796758
556 Ga0070687_100283986
557 Ga0070692_10306921
558 Ga0070671_100085693
559 Ga0070671_100332129
560 Ga0070671_100345687
561 Ga0070671_100779010
562 Ga0070673_100646648
563 Ga0070659_100165477
564 Ga0070667_100199153
565 Ga0070667_101015474
566 Ga0070703_10001137
567 Ga0070703_10027342
568 Ga0070709_10220101
569 Ga0070709_10249715
570 Ga0070714_100018222
571 Ga0070714_100101082
572 Ga0070713_100269515
573 Ga0070713_100384793
574 Ga0070713_100725948
575 Ga0070710_10023210
576 Ga0070701_10027325
577 Ga0070711_100132763
578 Ga0070711_100144646
579 Ga0070711_100334934
580 Ga0070711_100450277
581 Ga0070705_100037545
582 Ga0070705_100048694
583 Ga0070700_100127389
584 Ga0070700_100305886
585 Ga0070694_100083654
586 Ga0070708_100038966
587 Ga0070708_100119050
588 Ga0070708_101071363
589 Ga0070663_100143994
590 Ga0070678_100057103
591 Ga0070678_100249979
592 Ga0070678_100744586
593 Ga0070662_100015962
594 Ga0070681_10144149
595 Ga0070681_11124464
596 Ga0068867_100096099
597 Ga0070685_10131295
598 Ga0070706_100063956
599 Ga0070706_100149118
600 Ga0070706_100552781
601 Ga0070707_100012019
602 Ga0070707_100174850
603 Ga0070698_100075442
604 Ga0070698_100098828
605 Ga0070699_100047662
606 Ga0070699_100597840
607 Ga0070679_100398882
608 Ga0070684_100297379
609 Ga0070697_100094509
610 Ga0070697_100986350
611 Ga0068853_100533325
612 Ga0070686_100194549
613 Ga0070686_101226466
614 Ga0070695_100257025
615 Ga0070696_100023520
616 Ga0070696_100034536
617 Ga0070696_100097945
618 Ga0070696_100207658
619 Ga0070696_100376313
620 Ga0070693_100012458
621 Ga0070693_100016284
622 Ga0070693_100095982
623 Ga0070665_101140741
624 Ga0070704_100077084
625 Ga0070704_100195100
626 Ga0070664_100223241
627 Ga0068857_100066913
628 Ga0068857_100253197
629 Ga0068854_100127075
630 Ga0068854_100147071
631 Ga0068854_100958135
632 Ga0068856_100163023
633 Ga0068856_100507870
634 Ga0068856_100919440
635 Ga0070702_100084634
636 Ga0070702_100436301
637 Ga0068852_100743505
638 Ga0068864_100675625
639 Ga0068866_10035607
640 Ga0068866_10504986
641 Ga0068861_100048746
642 Ga0068861_100056781
643 Ga0068861_100080597
644 Ga0068861_100090018
645 Ga0068861_100617905
646 Ga0068863_100679816
647 Ga0068858_100235575
648 Ga0068860_100097047
649 Ga0068860_100427607
650 Ga0068862_100101506
651 Ga0068862_100408473
652 Ga0081455_10016996
653 Ga0081540_1005495
654 Ga0081540_1014615
655 Ga0070717_10033596
656 Ga0075432_10026611
657 Ga0075432_10091468
658 Ga0075432_10126453
659 Ga0070715_10013621
660 Ga0070715_10032829
661 Ga0070715_10149496
662 Ga0070716_100074205
663 Ga0070716_100098147
664 Ga0070716_100184305
665 Ga0070716_100248287
666 Ga0070712_100019260
667 Ga0070712_100070530
668 Ga0070712_100240679
669 Ga0070712_100584182
670 Ga0097621_100568064
671 Ga0075431_100010672
672 Ga0075431_100034077
673 Ga0075433_10055874
674 Ga0075433_10215362
675 Ga0075434_100021745
676 Ga0075434_100066773
677 Ga0075429_100271310
678 Ga0068865_100123328
679 Ga0068865_100164601
680 Ga0075436_100016368
681 Ga0075436_100031530
682 Ga0075436_100065410
683 Ga0075436_100259135
684 Ga0075435_100011974
685 Ga0075435_100337269
686 Ga0105250_10080298
687 Ga0111539_10010767
688 Ga0111539_10104386
689 Ga0111539_10444553
690 Ga0111539_10786452
691 Ga0105245_10010346
692 Ga0105245_10020781
693 Ga0105245_10129615
694 Ga0105245_10145672
695 Ga0105245_10170144
696 Ga0105245_10321649
697 Ga0105245_11288925
698 Ga0105245_11523387
699 Ga0105247_10306456
700 Ga0114129_10047208
701 Ga0114129_10201950
702 Ga0114129_10283632
703 Ga0114129_10479125
704 Ga0114129_10677271
705 Ga0105243_10028720
706 Ga0105243_10142609
707 Ga0105243_10254247
708 Ga0105243_10267487
709 Ga0105241_10029995
710 Ga0105241_10135492
711 Ga0105242_10087733
712 Ga0105242_10247400
713 Ga0105242_10395200
714 Ga0105242_10403104
715 Ga0105248_10184073
716 Ga0105248_10273657
717 Ga0105248_11246430
718 Ga0105238_10693441
719 Ga0105249_10429156
720 Ga0105249_10840374
721 Ga0105239_10030349
722 Ga0105239_10485520
723 Ga0105239_10515632
724 Ga0105239_10814480
725 Ga0105239_11108235
726 Ga0157373_10121909
727 Ga0157373_10363597
728 Ga0157371_10337601
729 Ga0157369_11446399
730 Ga0157374_10230711
731 Ga0157374_10767627
732 Ga0157374_11288128
733 Ga0157378_10166072
734 Ga0157378_11134005
735 Ga0163162_10302021
736 Ga0163162_10624087
737 Ga0163162_11357889
738 Ga0157372_10222465
739 Ga0157372_10225187
740 Ga0157375_10073824
741 Ga0157375_10194500
742 Ga0157375_11067268
743 Ga0157375_11880035
744 Ga0163163_10179330
745 Ga0157380_10159290
746 Ga0182008_10238425
747 Ga0157377_10108249
748 Ga0157376_10182951
749 Ga0157376_10433649
750 Ga0163161_10119846
751 Ga0207653_10002274
752 Ga0207653_10013257
753 Ga0207692_10030137
754 Ga0207688_10049219
755 Ga0207680_10233227
756 Ga0207685_10006227
757 Ga0207685_10066144
758 Ga0207685_10108790
759 Ga0207699_10022585
760 Ga0207699_10122172
761 Ga0207684_10011819
762 Ga0207684_10174444
763 Ga0207684_11061139
764 Ga0207654_10036515
765 Ga0207654_10140244
766 Ga0207707_10202148
767 Ga0207707_10409800
768 Ga0207693_10002624
769 Ga0207693_10006384
770 Ga0207693_10007749
771 Ga0207693_10016371
772 Ga0207693_10018429
773 Ga0207693_10455118
774 Ga0207663_10018798
775 Ga0207663_10039527
776 Ga0207663_10220313
777 Ga0207660_10136659
778 Ga0207660_10315996
779 Ga0207662_10014706
780 Ga0207657_10023362
781 Ga0207657_10283488
782 Ga0207652_11040369
783 Ga0207646_10011788
784 Ga0207646_10236783
785 Ga0207694_11000139
786 Ga0207659_10207484
787 Ga0207687_10039012
788 Ga0207687_10160067
789 Ga0207687_10181104
790 Ga0207687_10232096
791 Ga0207687_11127997
792 Ga0207700_10041254
793 Ga0207700_10275820
794 Ga0207664_10256397
795 Ga0207664_10314045
796 Ga0207664_10478887
797 Ga0207644_10058330
798 Ga0207644_10410865
799 Ga0207690_10028991
800 Ga0207690_10279046
801 Ga0207706_10032825
802 Ga0207706_10038598
803 Ga0207686_10201077
804 Ga0207686_10245476
805 Ga0207686_10632612
806 Ga0207709_10356704
807 Ga0207709_10461666
808 Ga0207669_10305550
809 Ga0207704_10143499
810 Ga0207704_10739072
811 Ga0207665_10004115
812 Ga0207665_10042220
813 Ga0207665_10082109
814 Ga0207665_10220741
815 Ga0207665_10501241
816 Ga0207711_10182963
817 Ga0207711_10865043
818 Ga0207661_10051051
819 Ga0207661_10224816
820 Ga0207679_10428952
821 Ga0207667_10248634
822 Ga0207667_10378498
823 Ga0207651_10606655
824 Ga0207712_10112541
825 Ga0207668_10094119
826 Ga0207668_10119530
827 Ga0207668_10256255
828 Ga0207640_10545818
829 Ga0207677_10067519
830 Ga0207677_10071114
831 Ga0207677_10157974
832 Ga0207639_10054633
833 Ga0207678_10147747
834 Ga0207678_10213908
835 Ga0207708_10009793
836 Ga0207708_10425290
837 Ga0207702_10418517
838 Ga0207648_10011542
839 Ga0207676_10103894
840 Ga0207674_10016976
841 Ga0207674_10176819
842 Ga0207675_100004110
843 Ga0207675_100008413
844 Ga0207675_100011574
845 Ga0207675_100102368
846 Ga0207675_100273849
847 Ga0207683_10004490
848 Ga0207683_10023685
849 Ga0207683_10075723
850 Ga0207683_10122444
851 Ga0207698_10178190
852 Ga0207428_10012563
853 Ga0207428_10020098
854 Ga0268265_10083560
855 Ga0268265_10132848
856 Ga0268264_10308413
857 Ga0307405_10234027
858 Ga0307413_10024481
859 Ga0307406_10011666
860 Ga0307407_10375787
861 Ga0307409_100012380
862 Ga0307409_100013846
863 Ga0307416_100000650
864 Ga0307416_100978687
865 Ga0307415_100000143
866 Ga0307415_100100109
867 Ga0373948_0009344
868 Ga0373948_0014242
869 Ga0373950_0015483
870 Ga0373940_0000716
871 Ga0373949_0061580
872 Ga0373932_0001414
873 Ga0373939_0012961
874 Ga0373941_0000637
875 Ga0373941_0060679
876 Ga0373945_0293892
877 Ga0373960_0000254
878 Ga0373960_0083662
879 Ga0373960_0209944
880 Ga0373943_0007042
881 Ga0373946_0072369
882 Ga0373942_0001189
883 Ga0373942_0014431
884 Ga0373961_0011270
885 Ga0373962_0001093
886 Ga0373931_0003520
887 Ga0373927_0313951
888 Ga0373947_0083798
889 Ga0373925_0238770
890 Ga0395899_0002426
891 Ga0395899_0012747
892 Ga0395899_0143835
893 Ga0395900_0005251
894 Ga0395900_0005325
895 Ga0395900_0011662
896 Ga0395900_0033279
897 Ga0395900_0157196
898 Ga0395898_0004932
899 Ga0395898_0010725
900 Ga0395898_0026369
901 Ga0395898_0071992
902 Ga0395898_0095180
903 Ga0395898_0775744
904 Ga0395898_1243611
905 Ga0395905_0005130
906 Ga0395905_0009604
907 Ga0395905_0036433
908 Ga0395905_0067836
909 Ga0395905_0114735
910 Ga0395901_0001479
911 Ga0395901_0015041
912 Ga0395901_0025769
913 Ga0395901_0031599
914 Ga0395901_0219167
915 Ga0395901_0242757
916 Ga0395901_0973116
917 Ga0451793_1068102
918 Ga0451807_2030857
919 Ga0451853_1566837
920 Ga0466972_0143670
921 Ga0466965_0070071
922 Ga0466963_0284439
923 Ga0466964_0000152
924 Ga0466964_0035328
925 Ga0466960_0011298
926 Ga0466960_0058271
927 Ga0466960_0074722
928 Ga0451576_0139442
929 Ga0451576_0594016
930 Ga0466958_0247411
931 Ga0466967_0003163
932 Ga0466967_0063135
933 Ga0466967_0209966
934 Ga0466967_0468133
935 Ga0495603_0003954
936 Ga0495641_0002229
937 Ga0495641_0243463
938 Ga0495582_0007052
939 Ga0495582_0683838
940 Ga0495639_0263387
941 Ga0495664_0261566
942 Ga0495664_0299545
943 Ga0495584_0290445
944 Ga0495584_0311652
945 Ga0495584_0419496
946 Ga0495594_0000937
947 Ga0495594_0260210
948 Ga0495594_0452646
949 Ga0495596_0176579
950 Ga0495628_0106626
951 Ga0495630_0072198
952 Ga0495630_0359946
953 Ga0495631_0331446
954 Ga0495637_0130603
955 Ga0495644_0066322
956 Ga0495644_0212324
957 Ga0495666_0171265
958 Ga0495642_0281604
959 Ga0495652_0341893
960 Ga0495640_0167407
961 Ga0495609_0354268
962 Ga0495621_0338949
963 Ga0495645_0365281
964 Ga0495622_0181950
965 Ga0495661_0324147
966 Ga0495588_0000535
967 Ga0495599_0163434
968 Ga0495658_0013990
969 Ga0495600_0345208
970 Ga0495581_0120645
971 Ga0495604_0192587
972 Ga0495674_0088525
973 Ga0495676_0010664
974 Ga0495676_0092040
975 Ga0495676_0130263
976 Ga0495676_0562585
977 Ga0495680_0109734
978 Ga0495680_0281546
979 Ga0495677_0278637
980 Ga0496100_0074992
981 Ga0496100_0106790
982 Ga0496100_0198844
983 Ga0496101_0022517
984 Ga0496101_0103246
985 Ga0496101_0126757
986 Ga0496102_0040077
987 Ga0496102_0053587
988 Ga0496102_0063974
989 Ga0496102_0102824
990 Ga0496102_0242769
991 Ga0496102_0623273
992 Ga0496103_0006564
993 Ga0496103_0021761
994 Ga0496103_0026698
995 Ga0496103_0047735
996 Ga0496103_0190073
997 Ga0496103_0362208
998 Ga0496103_0382456
999 Ga0496104_0000274
1000 Ga0496104_0005799
1001 Ga0496104_0011865
1002 Ga0496104_0015223
1003 Ga0496104_0049591
1004 Ga0496104_0091305
1005 Ga0496104_0111607
1006 Ga0496105_0000353
1007 Ga0496105_0002803
1008 Ga0496105_0016840
1009 Ga0496105_0027261
1010 Ga0496105_0050556
1011 Ga0496106_0011545
1012 Ga0496106_0027014
1013 Ga0496106_0051738
1014 Ga0496106_1007144
1015 Ga0496107_0020449
1016 Ga0496107_0020836
1017 Ga0496107_0053211
1018 Ga0496107_0085693
1019 Ga0496107_0265523
1020 Ga0496107_0320441
1021 Ga0496108_0001987
1022 Ga0496108_0017821
1023 Ga0496108_0019883
1024 Ga0496108_0551830
1025 Ga0496108_0920632
1026 Ga0496109_0003101
1027 Ga0496109_0048808
1028 Ga0496109_0082361
1029 Ga0496109_0097095
1030 Ga0496109_0179836
1031 Ga0496109_0281521
1032 Ga0496109_0323292
1033 Ga0496109_0678461
1034 Ga0496110_0000168
1035 Ga0496110_0001565
1036 Ga0496110_0013397
1037 Ga0496110_0037260
1038 Ga0496110_0102028
1039 Ga0496110_0108813
1040 Ga0496110_0675154
1041 Ga0496111_0001900
1042 Ga0496111_0028041
1043 Ga0496111_0050996
1044 Ga0496112_0001216
1045 Ga0496112_0047452
1046 Ga0496113_0000631
1047 Ga0496113_0001615
1048 Ga0496113_0007999
1049 Ga0496113_0017132
1050 Ga0496113_0209294
1051 Ga0496113_1072492
1052 Ga0496114_0012572
1053 Ga0496114_0025123
1054 Ga0496114_0027677
1055 Ga0496114_0050829
1056 Ga0496114_0056591
1057 Ga0496114_0154977
1058 Ga0496114_0180346
1059 Ga0496114_0214056
1060 Ga0496114_0432662
1061 Ga0496115_0012131
1062 Ga0496115_0023494
1063 Ga0496115_0027925
1064 Ga0496115_0062689
1065 Ga0496115_0115828
1066 Ga0501067_0074466
1067 Ga0501067_0146700
1068 nmdc:mga05p37_1498140_c1
1069 nmdc:mga05p37_233106_c1
1070 nmdc:mga05p37_29935_c1
1071 nmdc:mga05p37_435796_c1
1072 nmdc:mga06r32_18700_c1
1073 nmdc:mga08y16_28641_c1
1074 nmdc:mga08y16_40458_c1
1075 nmdc:mga0n895_41637_c1
1076 nmdc:mga0rr50_23087_c1
1077 nmdc:mga0rr50_304270_c1
1078 nmdc:mga08x19_10240_c1
1079 nmdc:mga08x19_156781_c1
1080 nmdc:mga08x19_38828_c1
1081 nmdc:mga0a205_126829_c1
1082 nmdc:mga0a205_38274_c1
1083 Ga0495595_0111486
1084 Ga0495619_0068630
1085 Ga0495619_0373777
1086 Ga0501084_0266843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01464

SLT

Transglycosylase SLT domain

41

159

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fpn-assembly1.cif.gz_B lytic transglycosylase in action 0.8889 29 173
1qte-assembly1.cif.gz_A crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6-anhydromurotripeptide 0.8829 29 183
1sly-assembly1.cif.gz_A complex of the 70-kda soluble lytic transglycosylase with bulgecin a 0.8702 29 183
5o1j-assembly1.cif.gz_A lytic transglycosylase in action 0.8684 29 180
6fc4-assembly1.cif.gz_A the x-ray structure of lytic transglycosylase slt inactive mutant e503q from pseudomonas aeruginosa 0.8609 28 183
ID Description Score Start End Superfamily
1slyA03 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.9092 33 172 1.10.530.10
4cfoB02 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8311 37 173 1.10.530.10
af_P0C960_18_203_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8199 38 170 1.10.530.10
af_A0A1D6QSC1_388_533_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8004 41 171 1.10.530.10
af_A0A178WGK2_281_420_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7827 39 175 1.10.530.10
ID Description Score Start End GO Terms
AF-A0A538AMA2-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9939 36 176 GO:0000270
GO:0008933
GO:0016020
AF-A0A7V9FYH0-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9927 2 180 GO:0000270
GO:0008933
GO:0016020
AF-A0A7V9EHN8-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9911 26 181 GO:0000270
GO:0008933
GO:0016020
AF-A0A538AMA2-F1-model_v4 Lytic transglycosylase domain-containing protein 0.98 36 176 GO:0000270
GO:0008933
GO:0016020
AF-A0A538ID58-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9789 2 180 GO:0000270
GO:0008933
GO:0016020

Map