F461103

General Info

Members Datasets Scaffolds Average Seq Length
539 200 1078 132

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10023186|Ga0070666_100231862
Length 150
Sequence MFVNRSARRPDVMKRLVTALLLLMGLLSAFAVYGHHSAAGIDRSKSVTVEGTVKQFKWGNPHAWLDIEVPNNKGGVDVWSLEMTSPTFLVKAGWKATTVKAGDKVKAVARPFKNGDPGGLFVSVTLPDGRTLTEQALPAPAASAATPAKD

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
153 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.11
Rhizosphere 98.52
Stem 0
Stem Tuber 0
Unclassified 30.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10023186 3300005335 Bacteria 4038
2 JGI24749J21850_1025791 3300002076 Bacteria 838
3 JGI24751J29686_10071367 3300002459 Unclassified 716
4 Ga0058863_11394728 3300004799 Unclassified 889
5 Ga0065712_10068287 3300005290 Bacteria 12172
6 Ga0065712_10076614 3300005290 Unclassified 3632
7 Ga0065712_10223323 3300005290 Bacteria 1034
8 Ga0065715_10143480 3300005293 Bacteria 1820
9 Ga0070676_10781850 3300005328 Bacteria 703
10 Ga0070676_10937699 3300005328 Bacteria 647
11 Ga0070676_11301459 3300005328 Bacteria 555
12 Ga0070683_100389158 3300005329 Bacteria 1329
13 Ga0070690_100143734 3300005330 Bacteria 1621
14 Ga0070690_100205021 3300005330 Unclassified 1374
15 Ga0070670_100040168 3300005331 Unclassified 4023
16 Ga0070670_100237342 3300005331 Bacteria 1587
17 Ga0070670_101407643 3300005331 Unclassified 639
18 Ga0070677_10276438 3300005333 Unclassified 844
19 Ga0068869_100041907 3300005334 Bacteria 3280
20 Ga0068869_100256170 3300005334 Bacteria 1399
21 Ga0068869_100359690 3300005334 Unclassified 1188
22 Ga0070666_10231993 3300005335 Unclassified 1304
23 Ga0070680_100318911 3300005336 Bacteria 1319
24 Ga0068868_100093866 3300005338 Bacteria 2420
25 Ga0068868_100127252 3300005338 Bacteria 2082
26 Ga0070689_100018080 3300005340 Bacteria 5186
27 Ga0070689_100137068 3300005340 Bacteria 1966
28 Ga0070689_100158166 3300005340 Bacteria 1830
29 Ga0070689_100164819 3300005340 Bacteria 1793
30 Ga0070689_101138834 3300005340 Bacteria 698
31 Ga0070687_100874724 3300005343 Unclassified 642
32 Ga0070687_101019908 3300005343 Unclassified 601
33 Ga0070661_100159254 3300005344 Bacteria 1709
34 Ga0070669_100069939 3300005353 Bacteria 2593
35 Ga0070669_100070057 3300005353 Bacteria 2591
36 Ga0070669_100263189 3300005353 Bacteria 1377
37 Ga0070669_100270927 3300005353 Bacteria 1357
38 Ga0070669_100285692 3300005353 Bacteria 1323
39 Ga0070669_100318985 3300005353 Unclassified 1254
40 Ga0070669_100483529 3300005353 Bacteria 1025
41 Ga0070675_100000185 3300005354 Bacteria 38683
42 Ga0070675_100000567 3300005354 Bacteria 25438
43 Ga0070675_100002136 3300005354 Bacteria 14618
44 Ga0070675_100010245 3300005354 Bacteria 7313
45 Ga0070675_100101377 3300005354 Bacteria 2425
46 Ga0070675_100148882 3300005354 Unclassified 2006
47 Ga0070675_100307467 3300005354 Bacteria 1398
48 Ga0070675_100309408 3300005354 Bacteria 1394
49 Ga0070675_100365031 3300005354 Unclassified 1283
50 Ga0070675_100472170 3300005354 Unclassified 1127
51 Ga0070671_100288197 3300005355 Bacteria 1397
52 Ga0070674_100001662 3300005356 Bacteria 12006
53 Ga0070674_100081462 3300005356 Bacteria 2313
54 Ga0070674_100104417 3300005356 Unclassified 2070
55 Ga0070674_100909950 3300005356 Bacteria 767
56 Ga0070673_100002822 3300005364 Bacteria 10684
57 Ga0070673_100045852 3300005364 Unclassified 3393
58 Ga0070673_100087772 3300005364 Bacteria 2536
59 Ga0070673_100099636 3300005364 Bacteria 2391
60 Ga0070673_100111279 3300005364 Bacteria 2271
61 Ga0070673_100501703 3300005364 Unclassified 1098
62 Ga0070688_100128019 3300005365 Unclassified 1709
63 Ga0070688_100134625 3300005365 Bacteria 1671
64 Ga0070688_100140337 3300005365 Bacteria 1641
65 Ga0070688_100337746 3300005365 Unclassified 1099
66 Ga0070688_100681461 3300005365 Bacteria 794
67 Ga0070659_100492894 3300005366 Archaea 1044
68 Ga0070667_100017889 3300005367 Bacteria 5874
69 Ga0070667_100907715 3300005367 Bacteria 820
70 Ga0070703_10043935 3300005406 Bacteria 1403
71 Ga0070713_100720887 3300005436 Bacteria 953
72 Ga0070701_10104128 3300005438 Unclassified 1576
73 Ga0070701_10305160 3300005438 Bacteria 980
74 Ga0070701_10676263 3300005438 Bacteria 692
75 Ga0070711_100767690 3300005439 Bacteria 816
76 Ga0070705_100310898 3300005440 Bacteria 1133
77 Ga0070700_100488585 3300005441 Unclassified 945
78 Ga0070708_100236423 3300005445 Bacteria 1715
79 Ga0070678_100041311 3300005456 Bacteria 3268
80 Ga0070678_100112580 3300005456 Bacteria 2131
81 Ga0070678_101106507 3300005456 Bacteria 732
82 Ga0070678_101114733 3300005456 Unclassified 729
83 Ga0070662_100065896 3300005457 Bacteria 2656
84 Ga0070662_100243896 3300005457 Bacteria 1442
85 Ga0068867_100122327 3300005459 Unclassified 2013
86 Ga0068867_100329644 3300005459 Unclassified 1267
87 Ga0068867_100666694 3300005459 Unclassified 914
88 Ga0068867_100981475 3300005459 Bacteria 765
89 Ga0068867_101190676 3300005459 Unclassified 699
90 Ga0070685_10054554 3300005466 Bacteria 2319
91 Ga0070707_101350643 3300005468 Unclassified 679
92 Ga0070698_100403806 3300005471 Bacteria 1300
93 Ga0070699_100502380 3300005518 Bacteria 1102
94 Ga0070684_100187743 3300005535 Bacteria 1880
95 Ga0070672_100031877 3300005543 Bacteria 3972
96 Ga0070672_100044230 3300005543 Bacteria 3438
97 Ga0070672_100136252 3300005543 Bacteria 2022
98 Ga0070686_100013336 3300005544 Bacteria 4702
99 Ga0070686_100098575 3300005544 Bacteria 1970
100 Ga0070686_100115722 3300005544 Bacteria 1834
101 Ga0070695_100421524 3300005545 Bacteria 1016
102 Ga0070695_101038551 3300005545 Unclassified 668
103 Ga0070696_100865137 3300005546 Bacteria 748
104 Ga0070665_100320236 3300005548 Bacteria 1555
105 Ga0070665_101665247 3300005548 Bacteria 645
106 Ga0070704_100052318 3300005549 Bacteria 2881
107 Ga0070704_100671203 3300005549 Bacteria 917
108 Ga0070704_101144741 3300005549 Unclassified 708
109 Ga0070664_100008098 3300005564 Bacteria 8494
110 Ga0070664_100122624 3300005564 Bacteria 2277
111 Ga0070664_100985428 3300005564 Bacteria 792
112 Ga0070664_101329722 3300005564 Unclassified 679
113 Ga0068857_100351491 3300005577 Unclassified 1365
114 Ga0068857_100568109 3300005577 Bacteria 1070
115 Ga0068857_101004630 3300005577 Unclassified 803
116 Ga0068857_101942466 3300005577 Unclassified 577
117 Ga0068854_100614699 3300005578 Bacteria 929
118 Ga0068854_100619318 3300005578 Unclassified 926
119 Ga0068859_100000877 3300005617 Bacteria 30669
120 Ga0068859_100005572 3300005617 Bacteria 12827
121 Ga0068859_100056815 3300005617 Bacteria 3941
122 Ga0068859_100238952 3300005617 Bacteria 1905
123 Ga0068859_100382068 3300005617 Bacteria 1504
124 Ga0068859_100761132 3300005617 Bacteria 1057
125 Ga0068859_100904722 3300005617 Bacteria 967
126 Ga0068859_101299564 3300005617 Unclassified 802
127 Ga0068859_101624762 3300005617 Bacteria 714
128 Ga0068864_100034370 3300005618 Bacteria 4312
129 Ga0068864_100085131 3300005618 Bacteria 2779
130 Ga0068866_10337560 3300005718 Bacteria 953
131 Ga0068866_10390025 3300005718 Bacteria 895
132 Ga0068866_10823428 3300005718 Bacteria 647
133 Ga0068866_10905546 3300005718 Unclassified 621
134 Ga0068861_100142652 3300005719 Bacteria 1957
135 Ga0068861_100368600 3300005719 Bacteria 1265
136 Ga0068861_100506818 3300005719 Bacteria 1092
137 Ga0068861_101277623 3300005719 Unclassified 713
138 Ga0068870_10001148 3300005840 Bacteria 10592
139 Ga0068870_10176522 3300005840 Bacteria 1279
140 Ga0068870_10320605 3300005840 Bacteria 984
141 Ga0068870_11280824 3300005840 Unclassified 533
142 Ga0068863_100002689 3300005841 Bacteria 17573
143 Ga0068863_100414292 3300005841 Archaea 1319
144 Ga0068863_100618569 3300005841 Bacteria 1073
145 Ga0068863_101019451 3300005841 Bacteria 831
146 Ga0068858_100002453 3300005842 Bacteria 18721
147 Ga0068858_100467832 3300005842 Bacteria 1216
148 Ga0068860_100001451 3300005843 Bacteria 25672
149 Ga0068860_100048875 3300005843 Bacteria 4031
150 Ga0068860_100071791 3300005843 Bacteria 3289
151 Ga0068860_100538206 3300005843 Bacteria 1169
152 Ga0068862_100509314 3300005844 Bacteria 1144
153 Ga0068862_101005572 3300005844 Unclassified 825
154 Ga0068862_101023912 3300005844 Bacteria 818
155 Ga0068862_102174490 3300005844 Unclassified 566
156 Ga0070717_10052628 3300006028 Bacteria 3355
157 Ga0097621_100012686 3300006237 Bacteria 6258
158 Ga0097621_100027046 3300006237 Bacteria 4507
159 Ga0097621_100329333 3300006237 Bacteria 1354
160 Ga0097621_100981088 3300006237 Unclassified 790
161 Ga0068871_100008155 3300006358 Bacteria 7523
162 Ga0068871_100034017 3300006358 Bacteria 4040
163 Ga0068871_100128316 3300006358 Bacteria 2148
164 Ga0068871_100661203 3300006358 Bacteria 955
165 Ga0075428_100000733 3300006844 Bacteria 34088
166 Ga0075428_100074983 3300006844 Bacteria 3695
167 Ga0075428_100222170 3300006844 Bacteria 2039
168 Ga0075428_101726836 3300006844 Unclassified 653
169 Ga0075428_102302541 3300006844 Unclassified 554
170 Ga0075430_100004557 3300006846 Bacteria 11670
171 Ga0075430_100074367 3300006846 Bacteria 2849
172 Ga0075430_100924317 3300006846 Bacteria 719
173 Ga0075431_100010392 3300006847 Bacteria 9356
174 Ga0075431_100045365 3300006847 Bacteria 4532
175 Ga0075431_100088981 3300006847 Bacteria 3187
176 Ga0075433_10007562 3300006852 Bacteria 8619
177 Ga0075433_10070681 3300006852 Unclassified 3068
178 Ga0075433_10123029 3300006852 Unclassified 2304
179 Ga0075433_10915871 3300006852 Bacteria 764
180 Ga0075434_100037454 3300006871 Bacteria 4802
181 Ga0075434_100090758 3300006871 Unclassified 3056
182 Ga0075434_100094977 3300006871 Bacteria 2987
183 Ga0075434_100237777 3300006871 Unclassified 1841
184 Ga0075434_100366696 3300006871 Unclassified 1461
185 Ga0075434_101203276 3300006871 Bacteria 770
186 Ga0075429_100003680 3300006880 Bacteria 13063
187 Ga0075429_100097017 3300006880 Bacteria 2572
188 Ga0075429_100240499 3300006880 Unclassified 1586
189 Ga0075429_100256068 3300006880 Unclassified 1532
190 Ga0075429_100452007 3300006880 Unclassified 1126
191 Ga0075429_100932704 3300006880 Bacteria 759
192 Ga0075429_101026247 3300006880 Unclassified 721
193 Ga0068865_100058234 3300006881 Bacteria 2698
194 Ga0068865_100283063 3300006881 Unclassified 1321
195 Ga0068865_100318249 3300006881 Bacteria 1250
196 Ga0068865_100646467 3300006881 Unclassified 898
197 Ga0068865_100648089 3300006881 Unclassified 897
198 Ga0068865_101172622 3300006881 Unclassified 679
199 Ga0075436_101479955 3300006914 Bacteria 515
200 Ga0097620_100000877 3300006931 Bacteria 30669
201 Ga0097620_100005572 3300006931 Bacteria 12827
202 Ga0097620_100056813 3300006931 Bacteria 3941
203 Ga0097620_100238951 3300006931 Bacteria 1905
204 Ga0097620_100382067 3300006931 Bacteria 1504
205 Ga0097620_100761129 3300006931 Bacteria 1057
206 Ga0097620_100904835 3300006931 Bacteria 967
207 Ga0097620_101299588 3300006931 Unclassified 802
208 Ga0097620_101624499 3300006931 Bacteria 714
209 Ga0075435_100009337 3300007076 Bacteria 7095
210 Ga0075435_100285223 3300007076 Bacteria 1410
211 Ga0075435_101190447 3300007076 Bacteria 667
212 Ga0075435_101949299 3300007076 Bacteria 516
213 Ga0111539_10001651 3300009094 Bacteria 29787
214 Ga0111539_10001874 3300009094 Bacteria 27921
215 Ga0111539_10009352 3300009094 Bacteria 12376
216 Ga0111539_10011947 3300009094 Bacteria 10887
217 Ga0111539_10021789 3300009094 Bacteria 7878
218 Ga0111539_10423670 3300009094 Bacteria 1550
219 Ga0105245_13036566 3300009098 Unclassified 520
220 Ga0114129_10001641 3300009147 Bacteria 30388
221 Ga0114129_10065628 3300009147 Bacteria 5065
222 Ga0114129_10065880 3300009147 Bacteria 5053
223 Ga0114129_10126169 3300009147 Bacteria 3518
224 Ga0114129_10150160 3300009147 Bacteria 3189
225 Ga0114129_10217138 3300009147 Unclassified 2582
226 Ga0114129_10339739 3300009147 Bacteria 1992
227 Ga0114129_10357859 3300009147 Bacteria 1932
228 Ga0114129_10493969 3300009147 Bacteria 1599
229 Ga0114129_10655253 3300009147 Unclassified 1355
230 Ga0114129_10854202 3300009147 Unclassified 1157
231 Ga0114129_11340185 3300009147 Bacteria 885
232 Ga0114129_11426911 3300009147 Bacteria 853
233 Ga0114129_11576245 3300009147 Unclassified 805
234 Ga0105243_10264375 3300009148 Bacteria 1542
235 Ga0105248_10000625 3300009177 Bacteria 40199
236 Ga0105248_10043908 3300009177 Bacteria 5013
237 Ga0105248_10129026 3300009177 Bacteria 2852
238 Ga0105248_10147737 3300009177 Bacteria 2652
239 Ga0105248_10231248 3300009177 Bacteria 2081
240 Ga0105248_11031078 3300009177 Bacteria 929
241 Ga0105238_10932514 3300009551 Bacteria 887
242 Ga0105249_10171152 3300009553 Bacteria 2106
243 Ga0105249_10754859 3300009553 Bacteria 1035
244 Ga0105249_12664633 3300009553 Unclassified 572
245 Ga0105249_13220091 3300009553 Unclassified 525
246 Ga0105246_10089694 3300011119 Bacteria 2212
247 Ga0157374_10062616 3300013296 Bacteria 3487
248 Ga0157374_10379199 3300013296 Bacteria 1408
249 Ga0157374_11077958 3300013296 Bacteria 823
250 Ga0163162_10134018 3300013306 Bacteria 2587
251 Ga0163162_11750675 3300013306 Archaea 710
252 Ga0157372_13175112 3300013307 Unclassified 524
253 Ga0157375_10000384 3300013308 Bacteria 40355
254 Ga0157375_10160072 3300013308 Bacteria 2392
255 Ga0157375_10227589 3300013308 Bacteria 2023
256 Ga0157375_12779648 3300013308 Unclassified 585
257 Ga0163163_10032552 3300014325 Bacteria 5036
258 Ga0163163_10118236 3300014325 Bacteria 2683
259 Ga0163163_10348456 3300014325 Unclassified 1537
260 Ga0163163_10450404 3300014325 Bacteria 1347
261 Ga0157380_10011526 3300014326 Bacteria 6390
262 Ga0157380_10015843 3300014326 Bacteria 5546
263 Ga0157380_10125976 3300014326 Bacteria 2177
264 Ga0157380_10221997 3300014326 Bacteria 1691
265 Ga0157380_10376801 3300014326 Bacteria 1338
266 Ga0157377_10025463 3300014745 Bacteria 3156
267 Ga0157377_10314601 3300014745 Bacteria 1038
268 Ga0157379_10000674 3300014968 Bacteria 27648
269 Ga0157376_10008999 3300014969 Bacteria 7231
270 Ga0157376_10057576 3300014969 Bacteria 3252
271 Ga0157376_10113094 3300014969 Bacteria 2393
272 Ga0157376_10211467 3300014969 Bacteria 1791
273 Ga0157376_10666842 3300014969 Unclassified 1042
274 Ga0163161_10215690 3300017792 Bacteria 1484
275 Ga0213876_10194683 3300021384 Unclassified 1078
276 Ga0207697_10128572 3300025315 Bacteria 1094
277 Ga0207697_10216115 3300025315 Unclassified 845
278 Ga0207653_10240150 3300025885 Unclassified 692
279 Ga0207682_10047919 3300025893 Bacteria 1761
280 Ga0207682_10054336 3300025893 Bacteria 1664
281 Ga0207642_10219511 3300025899 Unclassified 1062
282 Ga0207642_10868145 3300025899 Unclassified 577
283 Ga0207688_10460656 3300025901 Unclassified 793
284 Ga0207680_10016463 3300025903 Bacteria 3882
285 Ga0207680_10020396 3300025903 Unclassified 3567
286 Ga0207680_10045110 3300025903 Bacteria 2597
287 Ga0207647_10686600 3300025904 Unclassified 559
288 Ga0207645_10037786 3300025907 Bacteria 3098
289 Ga0207643_10008027 3300025908 Bacteria 5664
290 Ga0207643_10034427 3300025908 Unclassified 2838
291 Ga0207643_10281385 3300025908 Bacteria 1031
292 Ga0207663_10038322 3300025916 Bacteria 2896
293 Ga0207660_10291353 3300025917 Bacteria 1298
294 Ga0207662_10184229 3300025918 Bacteria 1345
295 Ga0207662_10355370 3300025918 Unclassified 985
296 Ga0207662_10406648 3300025918 Bacteria 924
297 Ga0207662_10499030 3300025918 Unclassified 838
298 Ga0207649_10120046 3300025920 Bacteria 1771
299 Ga0207681_10138868 3300025923 Unclassified 1807
300 Ga0207681_10144948 3300025923 Bacteria 1773
301 Ga0207681_10157555 3300025923 Bacteria 1708
302 Ga0207681_10229811 3300025923 Bacteria 1439
303 Ga0207681_10682919 3300025923 Unclassified 853
304 Ga0207650_10338567 3300025925 Bacteria 1235
305 Ga0207650_10410848 3300025925 Bacteria 1122
306 Ga0207650_10646251 3300025925 Bacteria 891
307 Ga0207659_10000944 3300025926 Bacteria 17370
308 Ga0207659_10007423 3300025926 Bacteria 6740
309 Ga0207659_10019194 3300025926 Bacteria 4495
310 Ga0207659_10044031 3300025926 Bacteria 3138
311 Ga0207659_10085464 3300025926 Bacteria 2344
312 Ga0207659_10171641 3300025926 Unclassified 1711
313 Ga0207659_10194824 3300025926 Bacteria 1614
314 Ga0207659_10307170 3300025926 Unclassified 1305
315 Ga0207659_10367968 3300025926 Unclassified 1196
316 Ga0207659_10548634 3300025926 Bacteria 982
317 Ga0207644_10360182 3300025931 Bacteria 1183
318 Ga0207644_10756462 3300025931 Bacteria 812
319 Ga0207706_10074911 3300025933 Bacteria 2976
320 Ga0207706_10132242 3300025933 Bacteria 2195
321 Ga0207706_10235687 3300025933 Bacteria 1600
322 Ga0207706_10312812 3300025933 Bacteria 1367
323 Ga0207670_10049446 3300025936 Bacteria 2813
324 Ga0207670_10060897 3300025936 Bacteria 2573
325 Ga0207670_10429585 3300025936 Unclassified 1061
326 Ga0207670_10603417 3300025936 Unclassified 901
327 Ga0207670_10818745 3300025936 Bacteria 776
328 Ga0207669_10001894 3300025937 Bacteria 8869
329 Ga0207669_10028105 3300025937 Bacteria 3090
330 Ga0207669_10276314 3300025937 Unclassified 1264
331 Ga0207669_11059859 3300025937 Unclassified 683
332 Ga0207704_10340965 3300025938 Unclassified 1163
333 Ga0207704_10447491 3300025938 Unclassified 1030
334 Ga0207704_11067135 3300025938 Unclassified 685
335 Ga0207691_10016466 3300025940 Bacteria 7018
336 Ga0207691_10060346 3300025940 Bacteria 3446
337 Ga0207691_10226819 3300025940 Bacteria 1618
338 Ga0207691_10753230 3300025940 Bacteria 820
339 Ga0207691_11047029 3300025940 Unclassified 680
340 Ga0207711_10004923 3300025941 Bacteria 11341
341 Ga0207711_10021544 3300025941 Bacteria 5384
342 Ga0207711_10069948 3300025941 Bacteria 3043
343 Ga0207711_10146124 3300025941 Bacteria 2130
344 Ga0207711_10160392 3300025941 Unclassified 2035
345 Ga0207689_10028431 3300025942 Bacteria 4678
346 Ga0207689_10470258 3300025942 Unclassified 1052
347 Ga0207689_10557455 3300025942 Bacteria 963
348 Ga0207689_11317036 3300025942 Unclassified 607
349 Ga0207661_10221917 3300025944 Bacteria 1671
350 Ga0207679_10066263 3300025945 Bacteria 2705
351 Ga0207679_10133483 3300025945 Bacteria 1995
352 Ga0207679_10174484 3300025945 Bacteria 1773
353 Ga0207679_10411211 3300025945 Bacteria 1192
354 Ga0207679_10522451 3300025945 Bacteria 1062
355 Ga0207679_11650536 3300025945 Bacteria 587
356 Ga0207679_12199461 3300025945 Unclassified 500
357 Ga0207651_10009551 3300025960 Bacteria 5321
358 Ga0207651_10040388 3300025960 Bacteria 3086
359 Ga0207651_10055320 3300025960 Bacteria 2725
360 Ga0207651_10152786 3300025960 Bacteria 1799
361 Ga0207651_11293810 3300025960 Unclassified 655
362 Ga0207668_11019974 3300025972 Unclassified 740
363 Ga0207640_11039148 3300025981 Bacteria 722
364 Ga0207658_10058367 3300025986 Bacteria 2871
365 Ga0207658_10694683 3300025986 Bacteria 919
366 Ga0207677_11127024 3300026023 Unclassified 716
367 Ga0207703_10108143 3300026035 Bacteria 2368
368 Ga0207703_10245502 3300026035 Bacteria 1611
369 Ga0207708_10085296 3300026075 Bacteria 2429
370 Ga0207708_10114559 3300026075 Bacteria 2095
371 Ga0207708_10596860 3300026075 Unclassified 935
372 Ga0207708_10757248 3300026075 Unclassified 834
373 Ga0207641_10001922 3300026088 Bacteria 19931
374 Ga0207641_10199263 3300026088 Bacteria 1845
375 Ga0207641_10820338 3300026088 Unclassified 921
376 Ga0207641_11986423 3300026088 Unclassified 583
377 Ga0207648_10061177 3300026089 Bacteria 3283
378 Ga0207648_10156037 3300026089 Unclassified 2015
379 Ga0207648_10182070 3300026089 Bacteria 1860
380 Ga0207648_10309747 3300026089 Bacteria 1417
381 Ga0207648_10322196 3300026089 Bacteria 1389
382 Ga0207648_10402481 3300026089 Unclassified 1240
383 Ga0207648_10407172 3300026089 Bacteria 1233
384 Ga0207648_10478412 3300026089 Bacteria 1137
385 Ga0207648_10797824 3300026089 Unclassified 879
386 Ga0207648_11618007 3300026089 Bacteria 609
387 Ga0207648_11667116 3300026089 Unclassified 599
388 Ga0207676_10275140 3300026095 Bacteria 1526
389 Ga0207676_10612653 3300026095 Unclassified 1047
390 Ga0207674_10176123 3300026116 Unclassified 2091
391 Ga0207674_10520139 3300026116 Bacteria 1149
392 Ga0207674_10997580 3300026116 Unclassified 806
393 Ga0207674_11134134 3300026116 Unclassified 751
394 Ga0207674_12194333 3300026116 Unclassified 515
395 Ga0207675_100016872 3300026118 Bacteria 6822
396 Ga0207675_100603848 3300026118 Unclassified 1100
397 Ga0207675_100796791 3300026118 Unclassified 958
398 Ga0207683_10026840 3300026121 Bacteria 4974
399 Ga0207683_10064817 3300026121 Unclassified 3220
400 Ga0207683_10066652 3300026121 Bacteria 3175
401 Ga0207683_10337837 3300026121 Bacteria 1381
402 Ga0207683_10341673 3300026121 Bacteria 1373
403 Ga0207428_10001498 3300027907 Bacteria 24419
404 Ga0207428_10004216 3300027907 Bacteria 13765
405 Ga0207428_10012491 3300027907 Bacteria 7460
406 Ga0207428_10013499 3300027907 Bacteria 7133
407 Ga0207428_10063745 3300027907 Unclassified 2911
408 Ga0207428_10120369 3300027907 Bacteria 2013
409 Ga0268266_10224507 3300028379 Unclassified 1728
410 Ga0268266_10238065 3300028379 Bacteria 1679
411 Ga0268266_10666642 3300028379 Bacteria 1002
412 Ga0268265_10037295 3300028380 Bacteria 3567
413 Ga0268265_10535602 3300028380 Unclassified 1109
414 Ga0268265_11301396 3300028380 Unclassified 727
415 Ga0268265_11406884 3300028380 Unclassified 700
416 Ga0268264_10001920 3300028381 Bacteria 18759
417 Ga0268264_10075454 3300028381 Bacteria 2867
418 Ga0268264_10508975 3300028381 Unclassified 1175
419 Ga0268264_11809310 3300028381 Unclassified 621
420 Ga0265320_10083044 3300031240 Unclassified 1493
421 Ga0307405_11952853 3300031731 Bacteria 524
422 Ga0307409_101158169 3300031995 Bacteria 796
423 Ga0307416_101057586 3300032002 Bacteria 916
424 Ga0373923_0690709 3300035111 Bacteria 506
425 Ga0373932_0118017 3300035112 Bacteria 882
426 Ga0373936_0533542 3300035113 Bacteria 548
427 Ga0373956_0489987 3300035119 Unclassified 587
428 Ga0373943_0063446 3300035170 Bacteria 1852
429 Ga0373955_0084304 3300035172 Bacteria 1802
430 Ga0373924_0008399 3300035410 Bacteria 3751
431 Ga0373935_0026658 3300035692 Bacteria 3570
432 Ga0373927_0077014 3300035695 Unclassified 2160
433 Ga0373933_0318162 3300035724 Unclassified 1009
434 Ga0373925_0032601 3300037068 Bacteria 3836
435 Ga0439436_0134311 3300041404 Bacteria 694
436 Ga0439453_0003453 3300041408 Bacteria 2275
437 Ga0451853_0198449 3300041512 Unclassified 1915
438 Ga0439450_174545 3300042008 Bacteria 569
439 Ga0450923_019165 3300042125 Bacteria 1316
440 Ga0450908_015153 3300042184 Bacteria 1382
441 Ga0439435_0003031 3300042436 Unclassified 3436
442 Ga0439435_0325234 3300042436 Unclassified 530
443 Ga0439460_0092890 3300042461 Unclassified 961
444 Ga0450916_002592 3300042530 Bacteria 1935
445 Ga0495592_0043241 3300046454 Unclassified 3371
446 Ga0495629_0034611 3300046459 Unclassified 3571
447 Ga0495580_0186171 3300046472 Bacteria 1433
448 Ga0495580_0920038 3300046472 Unclassified 561
449 Ga0495582_0113590 3300046473 Unclassified 1522
450 Ga0495639_0049449 3300046475 Unclassified 1908
451 Ga0495639_0116281 3300046475 Unclassified 1273
452 Ga0495664_0082877 3300046477 Unclassified 1924
453 Ga0495664_0448004 3300046477 Unclassified 773
454 Ga0495608_0002133 3300046511 Bacteria 14269
455 Ga0495608_0356954 3300046511 Bacteria 899
456 Ga0495628_0105379 3300046516 Unclassified 2172
457 Ga0495628_0161563 3300046516 Unclassified 1702
458 Ga0495630_0014084 3300046517 Bacteria 5820
459 Ga0495586_0094841 3300046535 Unclassified 1651
460 Ga0495587_0031341 3300046536 Unclassified 3220
461 Ga0495621_0493726 3300046539 Bacteria 528
462 Ga0495645_0233621 3300046543 Unclassified 1230
463 Ga0495645_0329807 3300046543 Unclassified 988
464 Ga0495667_0040491 3300046559 Unclassified 3094
465 Ga0495656_0034511 3300046615 Unclassified 2072
466 Ga0495656_0149402 3300046615 Bacteria 1127
467 Ga0495599_0092932 3300046678 Bacteria 1882
468 Ga0495658_0010820 3300046683 Bacteria 4571
469 Ga0495658_0164478 3300046683 Bacteria 1370
470 Ga0495658_0539928 3300046683 Bacteria 746
471 Ga0495669_0014829 3300046684 Bacteria 3333
472 Ga0495669_0078475 3300046684 Bacteria 1513
473 Ga0495613_0000442 3300046689 Bacteria 35338
474 Ga0495613_0008374 3300046689 Bacteria 7679
475 Ga0495613_0354442 3300046689 Bacteria 1007
476 Ga0495600_0166378 3300046809 Unclassified 1424
477 Ga0495600_0689039 3300046809 Unclassified 615
478 Ga0495581_0258839 3300047315 Unclassified 1018
479 Ga0495674_0090378 3300047319 Unclassified 2617
480 Ga0495674_0896351 3300047319 Bacteria 685
481 Ga0495684_0000142 3300047471 Bacteria 53015
482 Ga0496108_0606793 3300048911 Bacteria 953
483 Ga0496110_0884556 3300048913 Bacteria 799
484 Ga0496112_0803927 3300048915 Bacteria 865
485 Ga0496113_0028860 3300048916 Bacteria 3996
486 Ga0496114_0131968 3300048917 Bacteria 2158
487 Ga0496114_1220266 3300048917 Bacteria 638
488 Ga0501072_0601703 3300049588 Unclassified 867
489 Ga0501075_0028031 3300049591 Bacteria 4154
490 nmdc:mga05p37_118936_c2 3300050507 Bacteria 2844
491 nmdc:mga05p37_365194_c1 3300050507 Bacteria 1696
492 nmdc:mga05p37_391647_c1 3300050507 Unclassified 1625
493 nmdc:mga05p37_609501_c1 3300050507 Unclassified 1231
494 nmdc:mga05p37_689028_c1 3300050507 Unclassified 1137
495 nmdc:mga05p37_743160_c1 3300050507 Bacteria 1083
496 nmdc:mga05p37_77630_c1 3300050507 Bacteria 4089
497 nmdc:mga05p37_7838_c1 3300050507 Bacteria 12606
498 nmdc:mga05p37_8330_c1 3300050507 Bacteria 12263
499 nmdc:mga09592_1086303_c1 3300050508 Bacteria 666
500 nmdc:mga09592_1249607_c1 3300050508 Bacteria 612
501 nmdc:mga09592_138985_c1 3300050508 Unclassified 2093
502 nmdc:mga09592_47453_c1 3300050508 Unclassified 3619
503 nmdc:mga09592_81149_c1 3300050508 Bacteria 2763
504 nmdc:mga09592_926_c1 3300050508 Bacteria 16455
505 nmdc:mga0qj67_362815_c1 3300050509 Unclassified 1171
506 nmdc:mga0qj67_467187_c1 3300050509 Bacteria 1016
507 nmdc:mga0qj67_7420_c1 3300050509 Bacteria 8106
508 nmdc:mga0qj67_851242_c1 3300050509 Bacteria 720
509 nmdc:mga06r32_1355_c1 3300050510 Bacteria 22096
510 nmdc:mga06r32_19575_c1 3300050510 Bacteria 6215
511 nmdc:mga06r32_27528_c1 3300050510 Bacteria 5312
512 nmdc:mga06r32_349223_c1 3300050510 Unclassified 1464
513 nmdc:mga06r32_359773_c1 3300050510 Unclassified 1439
514 nmdc:mga06r32_727651_c1 3300050510 Bacteria 957
515 nmdc:mga08y16_106964_c1 3300050511 Bacteria 2911
516 nmdc:mga08y16_15860_c1 3300050511 Bacteria 7920
517 nmdc:mga08y16_1935239_c1 3300050511 Unclassified 540
518 nmdc:mga08y16_24069_c1 3300050511 Bacteria 6430
519 nmdc:mga08y16_61631_c1 3300050511 Bacteria 3917
520 nmdc:mga08y16_669_c1 3300050511 Bacteria 32385
521 nmdc:mga08y16_96526_c1 3300050511 Bacteria 3078
522 nmdc:mga0n895_191552_c1 3300050512 Unclassified 2076
523 nmdc:mga0n895_39345_c1 3300050512 Bacteria 4588
524 nmdc:mga0n895_404235_c1 3300050512 Unclassified 1381
525 nmdc:mga0n895_61800_c1 3300050512 Unclassified 3699
526 nmdc:mga0n895_94601_c1 3300050512 Bacteria 2992
527 nmdc:mga0rr50_12536_c1 3300050513 Bacteria 5485
528 nmdc:mga0rr50_310158_c1 3300050513 Bacteria 1321
529 nmdc:mga0rr50_462824_c1 3300050513 Bacteria 1076
530 nmdc:mga08x19_236476_c1 3300050514 Bacteria 1258
531 nmdc:mga08x19_324882_c1 3300050514 Bacteria 1071
532 nmdc:mga0a205_28397_c1 3300050515 Bacteria 5350
533 nmdc:mga0a205_425405_c1 3300050515 Bacteria 1190
534 nmdc:mga0a205_4696_c1 3300050515 Bacteria 12265
535 nmdc:mga0a205_70905_c1 3300050515 Unclassified 3365
536 Ga0495601_0002369 3300053077 Bacteria 10680
537 Ga0495619_0005292 3300053085 Bacteria 8180
538 Ga0501084_1241836 3300054114 Bacteria 625
539 Ga0501082_1697419 3300060353 Unclassified 551
540 Ga0070666_10023186
541 JGI24749J21850_1025791
542 JGI24751J29686_10071367
543 Ga0058863_11394728
544 Ga0065712_10068287
545 Ga0065712_10076614
546 Ga0065712_10223323
547 Ga0065715_10143480
548 Ga0070676_10781850
549 Ga0070676_10937699
550 Ga0070676_11301459
551 Ga0070683_100389158
552 Ga0070690_100143734
553 Ga0070690_100205021
554 Ga0070670_100040168
555 Ga0070670_100237342
556 Ga0070670_101407643
557 Ga0070677_10276438
558 Ga0068869_100041907
559 Ga0068869_100256170
560 Ga0068869_100359690
561 Ga0070666_10231993
562 Ga0070680_100318911
563 Ga0068868_100093866
564 Ga0068868_100127252
565 Ga0070689_100018080
566 Ga0070689_100137068
567 Ga0070689_100158166
568 Ga0070689_100164819
569 Ga0070689_101138834
570 Ga0070687_100874724
571 Ga0070687_101019908
572 Ga0070661_100159254
573 Ga0070669_100069939
574 Ga0070669_100070057
575 Ga0070669_100263189
576 Ga0070669_100270927
577 Ga0070669_100285692
578 Ga0070669_100318985
579 Ga0070669_100483529
580 Ga0070675_100000185
581 Ga0070675_100000567
582 Ga0070675_100002136
583 Ga0070675_100010245
584 Ga0070675_100101377
585 Ga0070675_100148882
586 Ga0070675_100307467
587 Ga0070675_100309408
588 Ga0070675_100365031
589 Ga0070675_100472170
590 Ga0070671_100288197
591 Ga0070674_100001662
592 Ga0070674_100081462
593 Ga0070674_100104417
594 Ga0070674_100909950
595 Ga0070673_100002822
596 Ga0070673_100045852
597 Ga0070673_100087772
598 Ga0070673_100099636
599 Ga0070673_100111279
600 Ga0070673_100501703
601 Ga0070688_100128019
602 Ga0070688_100134625
603 Ga0070688_100140337
604 Ga0070688_100337746
605 Ga0070688_100681461
606 Ga0070659_100492894
607 Ga0070667_100017889
608 Ga0070667_100907715
609 Ga0070703_10043935
610 Ga0070713_100720887
611 Ga0070701_10104128
612 Ga0070701_10305160
613 Ga0070701_10676263
614 Ga0070711_100767690
615 Ga0070705_100310898
616 Ga0070700_100488585
617 Ga0070708_100236423
618 Ga0070678_100041311
619 Ga0070678_100112580
620 Ga0070678_101106507
621 Ga0070678_101114733
622 Ga0070662_100065896
623 Ga0070662_100243896
624 Ga0068867_100122327
625 Ga0068867_100329644
626 Ga0068867_100666694
627 Ga0068867_100981475
628 Ga0068867_101190676
629 Ga0070685_10054554
630 Ga0070707_101350643
631 Ga0070698_100403806
632 Ga0070699_100502380
633 Ga0070684_100187743
634 Ga0070672_100031877
635 Ga0070672_100044230
636 Ga0070672_100136252
637 Ga0070686_100013336
638 Ga0070686_100098575
639 Ga0070686_100115722
640 Ga0070695_100421524
641 Ga0070695_101038551
642 Ga0070696_100865137
643 Ga0070665_100320236
644 Ga0070665_101665247
645 Ga0070704_100052318
646 Ga0070704_100671203
647 Ga0070704_101144741
648 Ga0070664_100008098
649 Ga0070664_100122624
650 Ga0070664_100985428
651 Ga0070664_101329722
652 Ga0068857_100351491
653 Ga0068857_100568109
654 Ga0068857_101004630
655 Ga0068857_101942466
656 Ga0068854_100614699
657 Ga0068854_100619318
658 Ga0068859_100000877
659 Ga0068859_100005572
660 Ga0068859_100056815
661 Ga0068859_100238952
662 Ga0068859_100382068
663 Ga0068859_100761132
664 Ga0068859_100904722
665 Ga0068859_101299564
666 Ga0068859_101624762
667 Ga0068864_100034370
668 Ga0068864_100085131
669 Ga0068866_10337560
670 Ga0068866_10390025
671 Ga0068866_10823428
672 Ga0068866_10905546
673 Ga0068861_100142652
674 Ga0068861_100368600
675 Ga0068861_100506818
676 Ga0068861_101277623
677 Ga0068870_10001148
678 Ga0068870_10176522
679 Ga0068870_10320605
680 Ga0068870_11280824
681 Ga0068863_100002689
682 Ga0068863_100414292
683 Ga0068863_100618569
684 Ga0068863_101019451
685 Ga0068858_100002453
686 Ga0068858_100467832
687 Ga0068860_100001451
688 Ga0068860_100048875
689 Ga0068860_100071791
690 Ga0068860_100538206
691 Ga0068862_100509314
692 Ga0068862_101005572
693 Ga0068862_101023912
694 Ga0068862_102174490
695 Ga0070717_10052628
696 Ga0097621_100012686
697 Ga0097621_100027046
698 Ga0097621_100329333
699 Ga0097621_100981088
700 Ga0068871_100008155
701 Ga0068871_100034017
702 Ga0068871_100128316
703 Ga0068871_100661203
704 Ga0075428_100000733
705 Ga0075428_100074983
706 Ga0075428_100222170
707 Ga0075428_101726836
708 Ga0075428_102302541
709 Ga0075430_100004557
710 Ga0075430_100074367
711 Ga0075430_100924317
712 Ga0075431_100010392
713 Ga0075431_100045365
714 Ga0075431_100088981
715 Ga0075433_10007562
716 Ga0075433_10070681
717 Ga0075433_10123029
718 Ga0075433_10915871
719 Ga0075434_100037454
720 Ga0075434_100090758
721 Ga0075434_100094977
722 Ga0075434_100237777
723 Ga0075434_100366696
724 Ga0075434_101203276
725 Ga0075429_100003680
726 Ga0075429_100097017
727 Ga0075429_100240499
728 Ga0075429_100256068
729 Ga0075429_100452007
730 Ga0075429_100932704
731 Ga0075429_101026247
732 Ga0068865_100058234
733 Ga0068865_100283063
734 Ga0068865_100318249
735 Ga0068865_100646467
736 Ga0068865_100648089
737 Ga0068865_101172622
738 Ga0075436_101479955
739 Ga0097620_100000877
740 Ga0097620_100005572
741 Ga0097620_100056813
742 Ga0097620_100238951
743 Ga0097620_100382067
744 Ga0097620_100761129
745 Ga0097620_100904835
746 Ga0097620_101299588
747 Ga0097620_101624499
748 Ga0075435_100009337
749 Ga0075435_100285223
750 Ga0075435_101190447
751 Ga0075435_101949299
752 Ga0111539_10001651
753 Ga0111539_10001874
754 Ga0111539_10009352
755 Ga0111539_10011947
756 Ga0111539_10021789
757 Ga0111539_10423670
758 Ga0105245_13036566
759 Ga0114129_10001641
760 Ga0114129_10065628
761 Ga0114129_10065880
762 Ga0114129_10126169
763 Ga0114129_10150160
764 Ga0114129_10217138
765 Ga0114129_10339739
766 Ga0114129_10357859
767 Ga0114129_10493969
768 Ga0114129_10655253
769 Ga0114129_10854202
770 Ga0114129_11340185
771 Ga0114129_11426911
772 Ga0114129_11576245
773 Ga0105243_10264375
774 Ga0105248_10000625
775 Ga0105248_10043908
776 Ga0105248_10129026
777 Ga0105248_10147737
778 Ga0105248_10231248
779 Ga0105248_11031078
780 Ga0105238_10932514
781 Ga0105249_10171152
782 Ga0105249_10754859
783 Ga0105249_12664633
784 Ga0105249_13220091
785 Ga0105246_10089694
786 Ga0157374_10062616
787 Ga0157374_10379199
788 Ga0157374_11077958
789 Ga0163162_10134018
790 Ga0163162_11750675
791 Ga0157372_13175112
792 Ga0157375_10000384
793 Ga0157375_10160072
794 Ga0157375_10227589
795 Ga0157375_12779648
796 Ga0163163_10032552
797 Ga0163163_10118236
798 Ga0163163_10348456
799 Ga0163163_10450404
800 Ga0157380_10011526
801 Ga0157380_10015843
802 Ga0157380_10125976
803 Ga0157380_10221997
804 Ga0157380_10376801
805 Ga0157377_10025463
806 Ga0157377_10314601
807 Ga0157379_10000674
808 Ga0157376_10008999
809 Ga0157376_10057576
810 Ga0157376_10113094
811 Ga0157376_10211467
812 Ga0157376_10666842
813 Ga0163161_10215690
814 Ga0213876_10194683
815 Ga0207697_10128572
816 Ga0207697_10216115
817 Ga0207653_10240150
818 Ga0207682_10047919
819 Ga0207682_10054336
820 Ga0207642_10219511
821 Ga0207642_10868145
822 Ga0207688_10460656
823 Ga0207680_10016463
824 Ga0207680_10020396
825 Ga0207680_10045110
826 Ga0207647_10686600
827 Ga0207645_10037786
828 Ga0207643_10008027
829 Ga0207643_10034427
830 Ga0207643_10281385
831 Ga0207663_10038322
832 Ga0207660_10291353
833 Ga0207662_10184229
834 Ga0207662_10355370
835 Ga0207662_10406648
836 Ga0207662_10499030
837 Ga0207649_10120046
838 Ga0207681_10138868
839 Ga0207681_10144948
840 Ga0207681_10157555
841 Ga0207681_10229811
842 Ga0207681_10682919
843 Ga0207650_10338567
844 Ga0207650_10410848
845 Ga0207650_10646251
846 Ga0207659_10000944
847 Ga0207659_10007423
848 Ga0207659_10019194
849 Ga0207659_10044031
850 Ga0207659_10085464
851 Ga0207659_10171641
852 Ga0207659_10194824
853 Ga0207659_10307170
854 Ga0207659_10367968
855 Ga0207659_10548634
856 Ga0207644_10360182
857 Ga0207644_10756462
858 Ga0207706_10074911
859 Ga0207706_10132242
860 Ga0207706_10235687
861 Ga0207706_10312812
862 Ga0207670_10049446
863 Ga0207670_10060897
864 Ga0207670_10429585
865 Ga0207670_10603417
866 Ga0207670_10818745
867 Ga0207669_10001894
868 Ga0207669_10028105
869 Ga0207669_10276314
870 Ga0207669_11059859
871 Ga0207704_10340965
872 Ga0207704_10447491
873 Ga0207704_11067135
874 Ga0207691_10016466
875 Ga0207691_10060346
876 Ga0207691_10226819
877 Ga0207691_10753230
878 Ga0207691_11047029
879 Ga0207711_10004923
880 Ga0207711_10021544
881 Ga0207711_10069948
882 Ga0207711_10146124
883 Ga0207711_10160392
884 Ga0207689_10028431
885 Ga0207689_10470258
886 Ga0207689_10557455
887 Ga0207689_11317036
888 Ga0207661_10221917
889 Ga0207679_10066263
890 Ga0207679_10133483
891 Ga0207679_10174484
892 Ga0207679_10411211
893 Ga0207679_10522451
894 Ga0207679_11650536
895 Ga0207679_12199461
896 Ga0207651_10009551
897 Ga0207651_10040388
898 Ga0207651_10055320
899 Ga0207651_10152786
900 Ga0207651_11293810
901 Ga0207668_11019974
902 Ga0207640_11039148
903 Ga0207658_10058367
904 Ga0207658_10694683
905 Ga0207677_11127024
906 Ga0207703_10108143
907 Ga0207703_10245502
908 Ga0207708_10085296
909 Ga0207708_10114559
910 Ga0207708_10596860
911 Ga0207708_10757248
912 Ga0207641_10001922
913 Ga0207641_10199263
914 Ga0207641_10820338
915 Ga0207641_11986423
916 Ga0207648_10061177
917 Ga0207648_10156037
918 Ga0207648_10182070
919 Ga0207648_10309747
920 Ga0207648_10322196
921 Ga0207648_10402481
922 Ga0207648_10407172
923 Ga0207648_10478412
924 Ga0207648_10797824
925 Ga0207648_11618007
926 Ga0207648_11667116
927 Ga0207676_10275140
928 Ga0207676_10612653
929 Ga0207674_10176123
930 Ga0207674_10520139
931 Ga0207674_10997580
932 Ga0207674_11134134
933 Ga0207674_12194333
934 Ga0207675_100016872
935 Ga0207675_100603848
936 Ga0207675_100796791
937 Ga0207683_10026840
938 Ga0207683_10064817
939 Ga0207683_10066652
940 Ga0207683_10337837
941 Ga0207683_10341673
942 Ga0207428_10001498
943 Ga0207428_10004216
944 Ga0207428_10012491
945 Ga0207428_10013499
946 Ga0207428_10063745
947 Ga0207428_10120369
948 Ga0268266_10224507
949 Ga0268266_10238065
950 Ga0268266_10666642
951 Ga0268265_10037295
952 Ga0268265_10535602
953 Ga0268265_11301396
954 Ga0268265_11406884
955 Ga0268264_10001920
956 Ga0268264_10075454
957 Ga0268264_10508975
958 Ga0268264_11809310
959 Ga0265320_10083044
960 Ga0307405_11952853
961 Ga0307409_101158169
962 Ga0307416_101057586
963 Ga0373923_0690709
964 Ga0373932_0118017
965 Ga0373936_0533542
966 Ga0373956_0489987
967 Ga0373943_0063446
968 Ga0373955_0084304
969 Ga0373924_0008399
970 Ga0373935_0026658
971 Ga0373927_0077014
972 Ga0373933_0318162
973 Ga0373925_0032601
974 Ga0439436_0134311
975 Ga0439453_0003453
976 Ga0451853_0198449
977 Ga0439450_174545
978 Ga0450923_019165
979 Ga0450908_015153
980 Ga0439435_0003031
981 Ga0439435_0325234
982 Ga0439460_0092890
983 Ga0450916_002592
984 Ga0495592_0043241
985 Ga0495629_0034611
986 Ga0495580_0186171
987 Ga0495580_0920038
988 Ga0495582_0113590
989 Ga0495639_0049449
990 Ga0495639_0116281
991 Ga0495664_0082877
992 Ga0495664_0448004
993 Ga0495608_0002133
994 Ga0495608_0356954
995 Ga0495628_0105379
996 Ga0495628_0161563
997 Ga0495630_0014084
998 Ga0495586_0094841
999 Ga0495587_0031341
1000 Ga0495621_0493726
1001 Ga0495645_0233621
1002 Ga0495645_0329807
1003 Ga0495667_0040491
1004 Ga0495656_0034511
1005 Ga0495656_0149402
1006 Ga0495599_0092932
1007 Ga0495658_0010820
1008 Ga0495658_0164478
1009 Ga0495658_0539928
1010 Ga0495669_0014829
1011 Ga0495669_0078475
1012 Ga0495613_0000442
1013 Ga0495613_0008374
1014 Ga0495613_0354442
1015 Ga0495600_0166378
1016 Ga0495600_0689039
1017 Ga0495581_0258839
1018 Ga0495674_0090378
1019 Ga0495674_0896351
1020 Ga0495684_0000142
1021 Ga0496108_0606793
1022 Ga0496110_0884556
1023 Ga0496112_0803927
1024 Ga0496113_0028860
1025 Ga0496114_0131968
1026 Ga0496114_1220266
1027 Ga0501072_0601703
1028 Ga0501075_0028031
1029 nmdc:mga05p37_118936_c2
1030 nmdc:mga05p37_365194_c1
1031 nmdc:mga05p37_391647_c1
1032 nmdc:mga05p37_609501_c1
1033 nmdc:mga05p37_689028_c1
1034 nmdc:mga05p37_743160_c1
1035 nmdc:mga05p37_77630_c1
1036 nmdc:mga05p37_7838_c1
1037 nmdc:mga05p37_8330_c1
1038 nmdc:mga09592_1086303_c1
1039 nmdc:mga09592_1249607_c1
1040 nmdc:mga09592_138985_c1
1041 nmdc:mga09592_47453_c1
1042 nmdc:mga09592_81149_c1
1043 nmdc:mga09592_926_c1
1044 nmdc:mga0qj67_362815_c1
1045 nmdc:mga0qj67_467187_c1
1046 nmdc:mga0qj67_7420_c1
1047 nmdc:mga0qj67_851242_c1
1048 nmdc:mga06r32_1355_c1
1049 nmdc:mga06r32_19575_c1
1050 nmdc:mga06r32_27528_c1
1051 nmdc:mga06r32_349223_c1
1052 nmdc:mga06r32_359773_c1
1053 nmdc:mga06r32_727651_c1
1054 nmdc:mga08y16_106964_c1
1055 nmdc:mga08y16_15860_c1
1056 nmdc:mga08y16_1935239_c1
1057 nmdc:mga08y16_24069_c1
1058 nmdc:mga08y16_61631_c1
1059 nmdc:mga08y16_669_c1
1060 nmdc:mga08y16_96526_c1
1061 nmdc:mga0n895_191552_c1
1062 nmdc:mga0n895_39345_c1
1063 nmdc:mga0n895_404235_c1
1064 nmdc:mga0n895_61800_c1
1065 nmdc:mga0n895_94601_c1
1066 nmdc:mga0rr50_12536_c1
1067 nmdc:mga0rr50_310158_c1
1068 nmdc:mga0rr50_462824_c1
1069 nmdc:mga08x19_236476_c1
1070 nmdc:mga08x19_324882_c1
1071 nmdc:mga0a205_28397_c1
1072 nmdc:mga0a205_425405_c1
1073 nmdc:mga0a205_4696_c1
1074 nmdc:mga0a205_70905_c1
1075 Ga0495601_0002369
1076 Ga0495619_0005292
1077 Ga0501084_1241836
1078 Ga0501082_1697419

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

24

122

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ywk-assembly3.cif.gz_B pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted 0.7622 30 95
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.7482 32 95
2dud-assembly1.cif.gz_A crystal structure of human mitochondrial single-stranded dna-binding protein(hmtssb) 0.7421 31 95
3q6c-assembly15.cif.gz_P x-ray crystal structure of duf2500 (pf10694) from klebsiella pneumoniae, northeast structural genomics consortium target kpr96 0.7337 32 111
3kf6-assembly1.cif.gz_A crystal structure of s. pombe stn1-ten1 complex 0.7329 31 111
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8343 37 65 2.30.29.30
4ywkA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7952 30 95 2.40.50.140
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7812 37 71 2.30.29.30
af_Q2FWQ1_1_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7542 46 71 1.10.10.10
1z47B03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7457 36 89 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9896 25 118
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9793 25 118
AF-A0A524HRQ9-F1-model_v4 Uncharacterized protein 0.9788 25 118
AF-A0A2V9DA64-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9578 30 118 GO:0016020
AF-A0A7W6EUK5-F1-model_v4 Uncharacterized protein 0.9559 25 119

Map