F460670

General Info

Members Datasets Scaffolds Average Seq Length
535 239 535 512

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10113546|Ga0207663_101135461
Length 555
Sequence MWHGCGSFRVSCRSGVVAVWVRLPFRRVLSCEFGTAEGKPQVEAYGLDELAASAEAVVAGLGPEAGGAVTLDAMEALVAERGRELLRGVVQLGLDAQAAAEVRLAGVAGADGVRRGRAERGHARAVVTTLGEVVVRRIGYRSGIKGAVSLFPRDAVLNLPPGGYSWAMQRLAVMFCLAVSYAQGHEFVLAATGVSIGKRQLEEIVAAAAADAERFCQDPGRARDEPVLPVTGEEGNLPPLGLSGDGKGVAMLPEARRRSARSPEQRVRTFSKRAGTGEKKGHKRMAETGCVFDVIPPDEPRTPEQVMRPAPGTAGNAPRAVNRWYACDITAGRDVTIGKVFDEAERRDPDHRRAWIALADGDNCQLGLIRAQAAARDVTVVIIIDFIHVLGYLWKAAWCFHPPRDPAMEDWVITQGTDILHGRAAEVITRIARLAGQHPPRPGSEHAKIIRTTLHYLDAKQPYMDYPRALAEGWPIATGVIEGACRHLIQDRMGITGARWGLAGAQAMLWLRAITASGDTEAYWDWHIQQEHRRNHLSRYKDGPGPRRDGLGLAA

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.36
Rhizosphere 92.9
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10013805 3300003659 Bacteria 1752
2 Ga0070658_10157086 3300005327 Bacteria 1907
3 Ga0070683_100105722 3300005329 Bacteria 2654
4 Ga0070683_100119995 3300005329 Bacteria 2483
5 Ga0070670_100121033 3300005331 Bacteria 2258
6 Ga0070682_100004693 3300005337 Bacteria 7592
7 Ga0070689_100157582 3300005340 Bacteria 1834
8 Ga0070661_100015087 3300005344 Bacteria 5451
9 Ga0070661_100119366 3300005344 Bacteria 1974
10 Ga0070692_10051937 3300005345 Bacteria 2134
11 Ga0070668_100117151 3300005347 Bacteria 2125
12 Ga0070669_100088809 3300005353 Bacteria 2314
13 Ga0070675_100144094 3300005354 Bacteria 2038
14 Ga0070671_100142515 3300005355 Bacteria 2022
15 Ga0070673_100016657 3300005364 Bacteria 5204
16 Ga0070659_100015663 3300005366 Bacteria 5679
17 Ga0070667_100216233 3300005367 Bacteria 1705
18 Ga0070703_10007010 3300005406 Bacteria 3159
19 Ga0070709_10017626 3300005434 Bacteria 4099
20 Ga0070709_10070019 3300005434 Bacteria 2260
21 Ga0070709_10082082 3300005434 Bacteria 2105
22 Ga0070709_10100639 3300005434 Bacteria 1925
23 Ga0070709_10127544 3300005434 Bacteria 1733
24 Ga0070714_100043344 3300005435 Bacteria 3805
25 Ga0070714_100179203 3300005435 Bacteria 1927
26 Ga0070714_100182083 3300005435 Bacteria 1912
27 Ga0070714_100182602 3300005435 Bacteria 1909
28 Ga0070714_100185032 3300005435 Bacteria 1898
29 Ga0070714_100208004 3300005435 Bacteria 1792
30 Ga0070713_100116027 3300005436 Bacteria 2341
31 Ga0070713_100153373 3300005436 Bacteria 2051
32 Ga0070713_100182478 3300005436 Bacteria 1886
33 Ga0070713_100218202 3300005436 Bacteria 1729
34 Ga0070710_10049247 3300005437 Bacteria 2356
35 Ga0070710_10059946 3300005437 Bacteria 2163
36 Ga0070710_10063015 3300005437 Bacteria 2117
37 Ga0070710_10078295 3300005437 Bacteria 1923
38 Ga0070710_10100647 3300005437 Bacteria 1720
39 Ga0070701_10056823 3300005438 Bacteria 2049
40 Ga0070711_100035811 3300005439 Bacteria 3321
41 Ga0070711_100084214 3300005439 Bacteria 2274
42 Ga0070711_100122748 3300005439 Bacteria 1924
43 Ga0070705_100021993 3300005440 Bacteria 3400
44 Ga0070694_100126720 3300005444 Bacteria 1839
45 Ga0070708_100101530 3300005445 Bacteria 2634
46 Ga0070663_100155542 3300005455 Bacteria 1756
47 Ga0070678_100069852 3300005456 Bacteria 2624
48 Ga0070678_100154265 3300005456 Bacteria 1854
49 Ga0070662_100138812 3300005457 Bacteria 1881
50 Ga0070685_10097537 3300005466 Bacteria 1789
51 Ga0070706_100224512 3300005467 Bacteria 1753
52 Ga0070698_100173333 3300005471 Bacteria 2097
53 Ga0070698_100219434 3300005471 Bacteria 1835
54 Ga0070699_100209347 3300005518 Bacteria 1735
55 Ga0070679_100121408 3300005530 Bacteria 2598
56 Ga0070679_100153980 3300005530 Bacteria 2274
57 Ga0070684_100105821 3300005535 Bacteria 2518
58 Ga0070697_100163065 3300005536 Bacteria 1884
59 Ga0070697_100187802 3300005536 Bacteria 1753
60 Ga0068853_100226629 3300005539 Bacteria 1708
61 Ga0070672_100042424 3300005543 Bacteria 3503
62 Ga0070686_100106767 3300005544 Bacteria 1901
63 Ga0070693_100029303 3300005547 Bacteria 3001
64 Ga0070693_100070664 3300005547 Bacteria 2054
65 Ga0070665_100019813 3300005548 Bacteria 6752
66 Ga0070704_100028363 3300005549 Bacteria 3723
67 Ga0068855_100266737 3300005563 Bacteria 1905
68 Ga0070664_100088615 3300005564 Bacteria 2676
69 Ga0070664_100126234 3300005564 Bacteria 2245
70 Ga0070664_100155248 3300005564 Bacteria 2022
71 Ga0068857_100074597 3300005577 Bacteria 3023
72 Ga0068857_100124283 3300005577 Bacteria 2325
73 Ga0068856_100222624 3300005614 Bacteria 1902
74 Ga0068856_100240832 3300005614 Bacteria 1824
75 Ga0070702_100048801 3300005615 Bacteria 2411
76 Ga0068864_100164047 3300005618 Bacteria 2021
77 Ga0068861_100133506 3300005719 Bacteria 2018
78 Ga0068851_10064147 3300005834 Bacteria 1888
79 Ga0068863_100063758 3300005841 Bacteria 3485
80 Ga0068863_100118930 3300005841 Bacteria 2518
81 Ga0068858_100077346 3300005842 Bacteria 3091
82 Ga0068860_100065438 3300005843 Bacteria 3452
83 Ga0068862_100151913 3300005844 Bacteria 2061
84 Ga0081455_10090085 3300005937 Bacteria 2488
85 Ga0081540_1000999 3300005983 Bacteria 25418
86 Ga0081540_1029438 3300005983 Bacteria 3059
87 Ga0081540_1046336 3300005983 Bacteria 2196
88 Ga0070717_10132505 3300006028 Bacteria 2145
89 Ga0070717_10147730 3300006028 Bacteria 2032
90 Ga0070717_10177387 3300006028 Bacteria 1855
91 Ga0070717_10178424 3300006028 Bacteria 1850
92 Ga0070716_100089035 3300006173 Bacteria 1863
93 Ga0070716_100106763 3300006173 Bacteria 1727
94 Ga0070712_100077610 3300006175 Bacteria 2394
95 Ga0070712_100087501 3300006175 Bacteria 2273
96 Ga0070712_100090221 3300006175 Bacteria 2243
97 Ga0070712_100112463 3300006175 Bacteria 2034
98 Ga0070712_100160958 3300006175 Bacteria 1733
99 Ga0097621_100023678 3300006237 Bacteria 4783
100 Ga0075434_100227666 3300006871 Bacteria 1884
101 Ga0068865_100049640 3300006881 Bacteria 2894
102 Ga0075436_100130705 3300006914 Bacteria 1761
103 Ga0075435_100160082 3300007076 Bacteria 1896
104 Ga0099794_10022796 3300007265 Bacteria 2858
105 Ga0099795_10002225 3300007788 Bacteria 4498
106 Ga0099795_10019668 3300007788 Bacteria 2188
107 Ga0105251_10036495 3300009011 Bacteria 2418
108 Ga0105240_10261642 3300009093 Bacteria 1995
109 Ga0105243_10070154 3300009148 Bacteria 2829
110 Ga0105242_10156098 3300009176 Bacteria 1993
111 Ga0105248_10198310 3300009177 Bacteria 2261
112 Ga0105248_10281820 3300009177 Bacteria 1871
113 Ga0105237_10181343 3300009545 Bacteria 2106
114 Ga0105237_10208985 3300009545 Bacteria 1952
115 Ga0105238_10084396 3300009551 Bacteria 3166
116 Ga0105238_10211052 3300009551 Bacteria 1917
117 Ga0105249_10071169 3300009553 Bacteria 3212
118 Ga0099796_10013799 3300010159 Bacteria 2317
119 Ga0099796_10025196 3300010159 Bacteria 1875
120 Ga0105246_10024117 3300011119 Bacteria 3947
121 Ga0105246_10062971 3300011119 Bacteria 2585
122 Ga0157373_10046053 3300013100 Bacteria 3113
123 Ga0157370_10104784 3300013104 Bacteria 2647
124 Ga0157369_10266269 3300013105 Bacteria 1787
125 Ga0157374_10165507 3300013296 Bacteria 2155
126 Ga0157378_10199802 3300013297 Bacteria 1890
127 Ga0163162_10180592 3300013306 Bacteria 2236
128 Ga0157372_10056525 3300013307 Bacteria 4384
129 Ga0157372_10313445 3300013307 Bacteria 1826
130 Ga0157375_10212930 3300013308 Bacteria 2090
131 Ga0157375_10235823 3300013308 Bacteria 1989
132 Ga0163163_10107526 3300014325 Bacteria 2816
133 Ga0163163_10148313 3300014325 Bacteria 2390
134 Ga0157379_10047464 3300014968 Bacteria 3831
135 Ga0206356_10114388 3300020070 Bacteria 2043
136 Ga0206354_10651989 3300020081 Bacteria 1972
137 Ga0206353_10149819 3300020082 Bacteria 2573
138 Ga0213873_10012627 3300021358 Bacteria 1835
139 Ga0228598_1007956 3300024227 Bacteria 2148
140 Ga0207692_10008863 3300025898 Bacteria 4181
141 Ga0207692_10010452 3300025898 Bacteria 3911
142 Ga0207692_10033275 3300025898 Bacteria 2485
143 Ga0207692_10047707 3300025898 Bacteria 2152
144 Ga0207692_10053680 3300025898 Bacteria 2054
145 Ga0207692_10066352 3300025898 Bacteria 1886
146 Ga0207692_10073546 3300025898 Bacteria 1808
147 Ga0207692_10078255 3300025898 Bacteria 1761
148 Ga0207692_10078606 3300025898 Bacteria 1758
149 Ga0207692_10079042 3300025898 Bacteria 1754
150 Ga0207692_10080984 3300025898 Bacteria 1736
151 Ga0207688_10008454 3300025901 Bacteria 5599
152 Ga0207685_10024452 3300025905 Bacteria 2071
153 Ga0207699_10101491 3300025906 Bacteria 1826
154 Ga0207699_10104056 3300025906 Bacteria 1807
155 Ga0207699_10110147 3300025906 Bacteria 1763
156 Ga0207699_10111477 3300025906 Bacteria 1754
157 Ga0207699_10111902 3300025906 Bacteria 1751
158 Ga0207699_10114514 3300025906 Bacteria 1734
159 Ga0207705_10111402 3300025909 Bacteria 2022
160 Ga0207684_10068842 3300025910 Bacteria 3008
161 Ga0207684_10196339 3300025910 Bacteria 1741
162 Ga0207707_10155037 3300025912 Bacteria 2003
163 Ga0207695_10199833 3300025913 Bacteria 1914
164 Ga0207671_10139403 3300025914 Bacteria 1867
165 Ga0207671_10163895 3300025914 Bacteria 1723
166 Ga0207693_10050159 3300025915 Bacteria 3278
167 Ga0207693_10059297 3300025915 Bacteria 2998
168 Ga0207693_10065552 3300025915 Bacteria 2844
169 Ga0207693_10101185 3300025915 Bacteria 2260
170 Ga0207693_10104813 3300025915 Bacteria 2218
171 Ga0207693_10142428 3300025915 Bacteria 1885
172 Ga0207693_10147533 3300025915 Bacteria 1850
173 Ga0207663_10026465 3300025916 Bacteria 3367
174 Ga0207663_10061772 3300025916 Bacteria 2378
175 Ga0207663_10085014 3300025916 Bacteria 2082
176 Ga0207663_10094592 3300025916 Bacteria 1991
177 Ga0207663_10103093 3300025916 Bacteria 1921
178 Ga0207663_10113546 3300025916 Bacteria 1842
179 Ga0207663_10127243 3300025916 Bacteria 1754
180 Ga0207662_10004077 3300025918 Bacteria 7629
181 Ga0207657_10007429 3300025919 Bacteria 11240
182 Ga0207649_10130032 3300025920 Bacteria 1709
183 Ga0207646_10143357 3300025922 Bacteria 2152
184 Ga0207681_10122196 3300025923 Bacteria 1911
185 Ga0207694_10171815 3300025924 Bacteria 1755
186 Ga0207687_10016169 3300025927 Bacteria 4899
187 Ga0207700_10028804 3300025928 Bacteria 3912
188 Ga0207700_10040114 3300025928 Bacteria 3414
189 Ga0207700_10051606 3300025928 Bacteria 3070
190 Ga0207700_10137505 3300025928 Bacteria 2003
191 Ga0207700_10176395 3300025928 Bacteria 1786
192 Ga0207700_10180499 3300025928 Bacteria 1767
193 Ga0207700_10187970 3300025928 Bacteria 1734
194 Ga0207664_10099361 3300025929 Bacteria 2401
195 Ga0207664_10105717 3300025929 Bacteria 2333
196 Ga0207664_10153470 3300025929 Bacteria 1958
197 Ga0207664_10169746 3300025929 Bacteria 1866
198 Ga0207664_10179051 3300025929 Bacteria 1819
199 Ga0207664_10190229 3300025929 Bacteria 1766
200 Ga0207664_10191888 3300025929 Bacteria 1759
201 Ga0207664_10195034 3300025929 Bacteria 1745
202 Ga0207664_10196000 3300025929 Bacteria 1741
203 Ga0207644_10023410 3300025931 Bacteria 4230
204 Ga0207690_10146170 3300025932 Bacteria 1748
205 Ga0207706_10118789 3300025933 Bacteria 2325
206 Ga0207686_10107434 3300025934 Bacteria 1875
207 Ga0207709_10107221 3300025935 Bacteria 1860
208 Ga0207670_10086727 3300025936 Bacteria 2203
209 Ga0207665_10015361 3300025939 Bacteria 5028
210 Ga0207665_10053360 3300025939 Bacteria 2725
211 Ga0207665_10085556 3300025939 Bacteria 2177
212 Ga0207665_10118369 3300025939 Bacteria 1869
213 Ga0207691_10184419 3300025940 Bacteria 1822
214 Ga0207689_10170374 3300025942 Bacteria 1794
215 Ga0207661_10152815 3300025944 Bacteria 1996
216 Ga0207661_10189417 3300025944 Bacteria 1802
217 Ga0207661_10198731 3300025944 Bacteria 1761
218 Ga0207679_10068574 3300025945 Bacteria 2665
219 Ga0207679_10113442 3300025945 Bacteria 2144
220 Ga0207679_10186474 3300025945 Bacteria 1720
221 Ga0207667_10255035 3300025949 Bacteria 1794
222 Ga0207712_10156544 3300025961 Bacteria 1766
223 Ga0207668_10166358 3300025972 Bacteria 1724
224 Ga0207640_10133129 3300025981 Bacteria 1800
225 Ga0207658_10106334 3300025986 Bacteria 2209
226 Ga0207677_10106877 3300026023 Bacteria 2074
227 Ga0207703_10183411 3300026035 Bacteria 1848
228 Ga0207639_10156641 3300026041 Bacteria 1914
229 Ga0207678_10000836 3300026067 Bacteria 28232
230 Ga0207702_10174292 3300026078 Bacteria 1975
231 Ga0207702_10176600 3300026078 Bacteria 1963
232 Ga0207702_10228659 3300026078 Bacteria 1737
233 Ga0207641_10183005 3300026088 Bacteria 1920
234 Ga0207641_10187318 3300026088 Bacteria 1899
235 Ga0207676_10182115 3300026095 Bacteria 1840
236 Ga0207676_10186261 3300026095 Bacteria 1822
237 Ga0207676_10205400 3300026095 Bacteria 1743
238 Ga0207674_10008446 3300026116 Bacteria 11892
239 Ga0207674_10218708 3300026116 Bacteria 1853
240 Ga0207675_100108848 3300026118 Bacteria 2614
241 Ga0207683_10012892 3300026121 Bacteria 7136
242 Ga0207683_10220171 3300026121 Bacteria 1729
243 Ga0207698_10209299 3300026142 Bacteria 1753
244 Ga0209179_1005936 3300027512 Bacteria 1940
245 Ga0268266_10220145 3300028379 Bacteria 1744
246 Ga0268266_10236267 3300028379 Bacteria 1685
247 Ga0268264_10186009 3300028381 Bacteria 1890
248 Ga0268264_10209547 3300028381 Bacteria 1788
249 Ga0307508_10154293 3300031616 Bacteria 1900
250 Ga0373930_0008162 3300034816 Bacteria 1827
251 Ga0373926_0010757 3300035083 Bacteria 3071
252 Ga0373926_0027272 3300035083 Bacteria 2000
253 Ga0373926_0033082 3300035083 Bacteria 1826
254 Ga0373926_0033469 3300035083 Bacteria 1816
255 Ga0373929_0008882 3300035085 Bacteria 1856
256 Ga0373934_0024195 3300035086 Bacteria 2348
257 Ga0373934_0024651 3300035086 Bacteria 2326
258 Ga0373944_0020952 3300035089 Bacteria 1888
259 Ga0373944_0022438 3300035089 Bacteria 1834
260 Ga0373923_0013079 3300035111 Bacteria 3085
261 Ga0373923_0039206 3300035111 Bacteria 1944
262 Ga0373923_0044348 3300035111 Bacteria 1843
263 Ga0373932_0012393 3300035112 Bacteria 2099
264 Ga0373936_0011709 3300035113 Bacteria 3327
265 Ga0373936_0029454 3300035113 Bacteria 2161
266 Ga0373936_0042367 3300035113 Bacteria 1827
267 Ga0373939_0021509 3300035114 Bacteria 1766
268 Ga0373945_0017987 3300035116 Bacteria 2400
269 Ga0373945_0030432 3300035116 Bacteria 1903
270 Ga0373945_0035881 3300035116 Bacteria 1774
271 Ga0373953_0026148 3300035117 Bacteria 2234
272 Ga0373953_0026761 3300035117 Bacteria 2211
273 Ga0373954_0037981 3300035118 Bacteria 2238
274 Ga0373954_0042038 3300035118 Bacteria 2131
275 Ga0373954_0045698 3300035118 Bacteria 2046
276 Ga0373956_0023944 3300035119 Bacteria 2625
277 Ga0373956_0031899 3300035119 Bacteria 2310
278 Ga0373956_0057423 3300035119 Bacteria 1758
279 Ga0373956_0057631 3300035119 Bacteria 1755
280 Ga0373957_0020105 3300035120 Bacteria 2356
281 Ga0373957_0027840 3300035120 Bacteria 2055
282 Ga0373960_0018542 3300035121 Bacteria 1816
283 Ga0373943_0024211 3300035170 Bacteria 2829
284 Ga0373943_0034446 3300035170 Bacteria 2415
285 Ga0373943_0063998 3300035170 Bacteria 1845
286 Ga0373943_0124420 3300035170 Bacteria 1373
287 Ga0373946_0015927 3300035171 Bacteria 2858
288 Ga0373946_0032099 3300035171 Bacteria 2107
289 Ga0373946_0042964 3300035171 Bacteria 1860
290 Ga0373946_0058106 3300035171 Bacteria 1637
291 Ga0373955_0016758 3300035172 Bacteria 3611
292 Ga0373955_0049802 3300035172 Bacteria 2275
293 Ga0373961_0014643 3300035241 Bacteria 1994
294 Ga0373962_0015499 3300035242 Bacteria 1955
295 Ga0373924_0022969 3300035410 Bacteria 2441
296 Ga0373924_0035225 3300035410 Bacteria 2029
297 Ga0373924_0048693 3300035410 Bacteria 1751
298 Ga0373924_0078622 3300035410 Bacteria 1400
299 Ga0373931_0081446 3300035691 Bacteria 1787
300 Ga0373931_0144901 3300035691 Bacteria 1379
301 Ga0373935_0050731 3300035692 Bacteria 2634
302 Ga0373935_0064580 3300035692 Bacteria 2347
303 Ga0373935_0079983 3300035692 Bacteria 2122
304 Ga0373935_0097195 3300035692 Bacteria 1936
305 Ga0373935_0120618 3300035692 Bacteria 1751
306 Ga0373935_0123455 3300035692 Bacteria 1732
307 Ga0373927_0043339 3300035695 Bacteria 2913
308 Ga0373927_0105106 3300035695 Bacteria 1838
309 Ga0373927_0118643 3300035695 Bacteria 1726
310 Ga0373927_0159364 3300035695 Bacteria 1478
311 Ga0373933_0054797 3300035724 Bacteria 2390
312 Ga0373933_0071955 3300035724 Bacteria 2105
313 Ga0373933_0110645 3300035724 Bacteria 1713
314 Ga0373947_0011150 3300035725 Bacteria 5161
315 Ga0373947_0046800 3300035725 Bacteria 2591
316 Ga0373947_0059541 3300035725 Bacteria 2315
317 Ga0373947_0062167 3300035725 Bacteria 2271
318 Ga0373947_0077318 3300035725 Bacteria 2052
319 Ga0373947_0109008 3300035725 Bacteria 1747
320 Ga0373937_0095823 3300036401 Bacteria 2751
321 Ga0373937_0140717 3300036401 Bacteria 2257
322 Ga0373937_0192900 3300036401 Bacteria 1914
323 Ga0373937_0200362 3300036401 Bacteria 1876
324 Ga0373937_0232931 3300036401 Bacteria 1734
325 Ga0373937_0262040 3300036401 Bacteria 1630
326 Ga0373925_0029089 3300037068 Bacteria 4053
327 Ga0373925_0058538 3300037068 Bacteria 2889
328 Ga0373925_0071015 3300037068 Bacteria 2632
329 Ga0373925_0109995 3300037068 Bacteria 2127
330 Ga0373925_0142241 3300037068 Bacteria 1878
331 Ga0373925_0147240 3300037068 Bacteria 1846
332 Ga0373925_0153547 3300037068 Bacteria 1809
333 Ga0373925_0163852 3300037068 Bacteria 1752
334 Ga0436364_0202490 3300037853 Bacteria 2081
335 Ga0436364_0206840 3300037853 Bacteria 3862
336 Ga0436364_0448425 3300037853 Bacteria 2293
337 Ga0436362_0587610 3300039453 Bacteria 2038
338 Ga0466959_0101895 3300045049 Bacteria 2055
339 Ga0466967_0289022 3300045976 Bacteria 1574
340 Ga0495592_0006679 3300046454 Bacteria 8598
341 Ga0495592_0100540 3300046454 Bacteria 2061
342 Ga0495592_0111400 3300046454 Bacteria 1936
343 Ga0495592_0120691 3300046454 Bacteria 1844
344 Ga0495592_0126164 3300046454 Bacteria 1795
345 Ga0495603_0086375 3300046455 Bacteria 1836
346 Ga0495603_0088627 3300046455 Bacteria 1810
347 Ga0495629_0032964 3300046459 Bacteria 3665
348 Ga0495629_0108260 3300046459 Bacteria 1938
349 Ga0495641_0054044 3300046461 Bacteria 1825
350 Ga0495641_0055501 3300046461 Bacteria 1798
351 Ga0495651_0068655 3300046462 Bacteria 2701
352 Ga0495651_0079054 3300046462 Bacteria 2486
353 Ga0495651_0118957 3300046462 Bacteria 1943
354 Ga0495651_0141192 3300046462 Bacteria 1746
355 Ga0495653_0023632 3300046463 Bacteria 4961
356 Ga0495653_0094331 3300046463 Bacteria 2180
357 Ga0495653_0132152 3300046463 Bacteria 1765
358 Ga0495653_0148180 3300046463 Bacteria 1642
359 Ga0495580_0130892 3300046472 Bacteria 1740
360 Ga0495582_0030227 3300046473 Bacteria 2973
361 Ga0495582_0081651 3300046473 Bacteria 1795
362 Ga0495582_0116744 3300046473 Bacteria 1501
363 Ga0495639_0064848 3300046475 Bacteria 1679
364 Ga0495639_0084863 3300046475 Bacteria 1479
365 Ga0495662_0004516 3300046476 Bacteria 6979
366 Ga0495662_0052003 3300046476 Bacteria 1977
367 Ga0495662_0052955 3300046476 Bacteria 1960
368 Ga0495664_0022173 3300046477 Bacteria 3677
369 Ga0495664_0048412 3300046477 Bacteria 2523
370 Ga0495664_0048872 3300046477 Bacteria 2511
371 Ga0495664_0087170 3300046477 Bacteria 1875
372 Ga0495664_0087647 3300046477 Bacteria 1870
373 Ga0495664_0099167 3300046477 Bacteria 1754
374 Ga0495594_0007576 3300046499 Bacteria 5586
375 Ga0495594_0061932 3300046499 Bacteria 2071
376 Ga0495608_0019288 3300046511 Bacteria 4694
377 Ga0495608_0046626 3300046511 Bacteria 2883
378 Ga0495608_0078271 3300046511 Bacteria 2152
379 Ga0495608_0115125 3300046511 Bacteria 1726
380 Ga0495618_0062742 3300046514 Bacteria 2358
381 Ga0495618_0076244 3300046514 Bacteria 2136
382 Ga0495618_0096240 3300046514 Bacteria 1893
383 Ga0495618_0098015 3300046514 Bacteria 1876
384 Ga0495618_0116006 3300046514 Bacteria 1714
385 Ga0495628_0088123 3300046516 Bacteria 2405
386 Ga0495628_0092081 3300046516 Bacteria 2345
387 Ga0495628_0115594 3300046516 Bacteria 2060
388 Ga0495628_0141854 3300046516 Bacteria 1833
389 Ga0495628_0145421 3300046516 Bacteria 1807
390 Ga0495628_0146155 3300046516 Bacteria 1802
391 Ga0495630_0066393 3300046517 Bacteria 2711
392 Ga0495630_0098267 3300046517 Bacteria 2214
393 Ga0495630_0143781 3300046517 Bacteria 1813
394 Ga0495630_0159551 3300046517 Bacteria 1717
395 Ga0495666_0010409 3300046526 Bacteria 4637
396 Ga0495666_0041013 3300046526 Bacteria 2243
397 Ga0495652_0091355 3300046529 Bacteria 2489
398 Ga0495652_0093019 3300046529 Bacteria 2462
399 Ga0495652_0097157 3300046529 Bacteria 2396
400 Ga0495652_0141507 3300046529 Bacteria 1891
401 Ga0495652_0151347 3300046529 Bacteria 1812
402 Ga0495665_0053053 3300046531 Bacteria 2145
403 Ga0495640_0020799 3300046533 Bacteria 4822
404 Ga0495640_0074040 3300046533 Bacteria 2278
405 Ga0495640_0090967 3300046533 Bacteria 2013
406 Ga0495640_0118069 3300046533 Bacteria 1726
407 Ga0495586_0086134 3300046535 Bacteria 1731
408 Ga0495587_0013329 3300046536 Bacteria 5167
409 Ga0495587_0043104 3300046536 Bacteria 2688
410 Ga0495587_0072944 3300046536 Bacteria 1994
411 Ga0495645_0046319 3300046543 Bacteria 3169
412 Ga0495645_0074176 3300046543 Bacteria 2450
413 Ga0495645_0119530 3300046543 Bacteria 1856
414 Ga0495645_0127359 3300046543 Bacteria 1788
415 Ga0495645_0134084 3300046543 Bacteria 1733
416 Ga0495667_0047116 3300046559 Bacteria 2848
417 Ga0495667_0075080 3300046559 Bacteria 2200
418 Ga0495667_0086117 3300046559 Bacteria 2038
419 Ga0495667_0192278 3300046559 Bacteria 1307
420 Ga0495634_0040597 3300046642 Bacteria 3163
421 Ga0495634_0042561 3300046642 Bacteria 3080
422 Ga0495634_0095526 3300046642 Bacteria 1925
423 Ga0495634_0106463 3300046642 Bacteria 1807
424 Ga0495634_0107326 3300046642 Bacteria 1798
425 Ga0495635_0074803 3300046663 Bacteria 2320
426 Ga0495635_0109979 3300046663 Bacteria 1882
427 Ga0495588_0052569 3300046674 Bacteria 2100
428 Ga0495657_0008418 3300046675 Bacteria 7890
429 Ga0495657_0019925 3300046675 Bacteria 4832
430 Ga0495657_0027338 3300046675 Bacteria 4028
431 Ga0495657_0063654 3300046675 Bacteria 2432
432 Ga0495657_0081556 3300046675 Bacteria 2091
433 Ga0495599_0032381 3300046678 Bacteria 3282
434 Ga0495599_0041508 3300046678 Bacteria 2888
435 Ga0495599_0057646 3300046678 Bacteria 2430
436 Ga0495599_0064877 3300046678 Bacteria 2281
437 Ga0495599_0097920 3300046678 Bacteria 1828
438 Ga0495599_0101792 3300046678 Bacteria 1790
439 Ga0495599_0170910 3300046678 Bacteria 1341
440 Ga0495623_0071232 3300046679 Bacteria 2163
441 Ga0495623_0098947 3300046679 Bacteria 1779
442 Ga0495646_0057813 3300046680 Bacteria 2319
443 Ga0495646_0069431 3300046680 Bacteria 2078
444 Ga0495646_0078482 3300046680 Bacteria 1929
445 Ga0495646_0083937 3300046680 Bacteria 1850
446 Ga0495646_0084653 3300046680 Bacteria 1841
447 Ga0495647_0028397 3300046681 Bacteria 2062
448 Ga0495658_0018404 3300046683 Bacteria 3632
449 Ga0495658_0079330 3300046683 Bacteria 1923
450 Ga0495613_0077679 3300046689 Bacteria 2415
451 Ga0495624_0093188 3300046690 Bacteria 1857
452 Ga0495624_0120769 3300046690 Bacteria 1609
453 Ga0495600_0005570 3300046809 Bacteria 7603
454 Ga0495600_0038608 3300046809 Bacteria 3107
455 Ga0495600_0079706 3300046809 Bacteria 2137
456 Ga0495600_0103884 3300046809 Bacteria 1851
457 Ga0495581_0057220 3300047315 Bacteria 2250
458 Ga0495581_0084844 3300047315 Bacteria 1835
459 Ga0495604_0111933 3300047317 Bacteria 1989
460 Ga0495604_0122213 3300047317 Bacteria 1883
461 Ga0495604_0126884 3300047317 Bacteria 1838
462 Ga0495604_0134847 3300047317 Bacteria 1770
463 Ga0495674_0024334 3300047319 Bacteria 5565
464 Ga0495674_0054617 3300047319 Bacteria 3507
465 Ga0495674_0093255 3300047319 Bacteria 2569
466 Ga0495674_0110962 3300047319 Bacteria 2325
467 Ga0495674_0111780 3300047319 Bacteria 2315
468 Ga0495674_0116207 3300047319 Bacteria 2263
469 Ga0495674_0168864 3300047319 Bacteria 1826
470 Ga0495674_0169216 3300047319 Bacteria 1824
471 Ga0495676_0105608 3300047321 Bacteria 2076
472 Ga0495676_0131795 3300047321 Bacteria 1803
473 Ga0495680_0018697 3300047322 Bacteria 5872
474 Ga0495680_0075550 3300047322 Bacteria 2556
475 Ga0495680_0126624 3300047322 Bacteria 1880
476 Ga0495680_0129061 3300047322 Bacteria 1859
477 Ga0495675_0086415 3300047444 Bacteria 1971
478 Ga0495675_0093137 3300047444 Bacteria 1890
479 Ga0495684_0046850 3300047471 Bacteria 3307
480 Ga0495684_0098192 3300047471 Bacteria 2214
481 Ga0495684_0134401 3300047471 Bacteria 1856
482 Ga0495684_0138089 3300047471 Bacteria 1828
483 Ga0495684_0142517 3300047471 Bacteria 1796
484 Ga0495593_0057207 3300047673 Bacteria 2048
485 Ga0495602_0095884 3300048088 Bacteria 2447
486 Ga0495602_0130713 3300048088 Bacteria 2003
487 Ga0495602_0133407 3300048088 Bacteria 1976
488 Ga0495602_0149971 3300048088 Bacteria 1834
489 Ga0495602_0184385 3300048088 Bacteria 1606
490 Ga0495614_0047978 3300048089 Bacteria 1831
491 Ga0496100_0125572 3300048903 Bacteria 1800
492 Ga0496100_0132995 3300048903 Bacteria 1754
493 Ga0496101_0126415 3300048904 Bacteria 1937
494 Ga0496102_0171942 3300048905 Bacteria 2039
495 Ga0496102_0178433 3300048905 Bacteria 2000
496 Ga0496103_0045100 3300048906 Bacteria 2719
497 Ga0496103_0105111 3300048906 Bacteria 1790
498 Ga0496104_0136211 3300048907 Bacteria 2359
499 Ga0496105_0046463 3300048908 Bacteria 3583
500 Ga0496105_0066021 3300048908 Bacteria 2986
501 Ga0496106_0158599 3300048909 Bacteria 1788
502 Ga0496106_0161810 3300048909 Bacteria 1770
503 Ga0496107_0146277 3300048910 Bacteria 1747
504 Ga0496108_0142321 3300048911 Bacteria 2066
505 Ga0496108_0184985 3300048911 Bacteria 1804
506 Ga0496108_0200107 3300048911 Bacteria 1733
507 Ga0496109_0204295 3300048912 Bacteria 1857
508 Ga0496109_0212306 3300048912 Bacteria 1820
509 Ga0496109_0222643 3300048912 Bacteria 1774
510 Ga0496110_0117341 3300048913 Bacteria 2396
511 Ga0496110_0177038 3300048913 Bacteria 1936
512 Ga0496111_0104895 3300048914 Bacteria 2079
513 Ga0496111_0199256 3300048914 Bacteria 1488
514 Ga0496112_0150742 3300048915 Bacteria 2292
515 Ga0496112_0174667 3300048915 Bacteria 2113
516 Ga0496112_0183925 3300048915 Bacteria 2053
517 Ga0496112_0213935 3300048915 Bacteria 1884
518 Ga0496112_0221047 3300048915 Bacteria 1850
519 Ga0496113_0076860 3300048916 Bacteria 2551
520 Ga0496113_0150856 3300048916 Bacteria 1833
521 Ga0496113_0171456 3300048916 Bacteria 1718
522 Ga0496114_0171833 3300048917 Bacteria 1889
523 Ga0496115_0167204 3300048918 Bacteria 1819
524 Ga0496115_0188231 3300048918 Bacteria 1705
525 nmdc:mga08x19_34303_c1 3300050514 Bacteria 3206
526 Ga0495601_0007098 3300053077 Bacteria 6563
527 Ga0495601_0087616 3300053077 Bacteria 2001
528 Ga0495601_0101515 3300053077 Bacteria 1858
529 Ga0495601_0103802 3300053077 Bacteria 1837
530 Ga0495612_0042011 3300053078 Bacteria 1865
531 Ga0495612_0046402 3300053078 Bacteria 1779
532 Ga0495619_0072250 3300053085 Bacteria 2310
533 Ga0495619_0113362 3300053085 Bacteria 1854
534 Ga0495619_0120012 3300053085 Bacteria 1802
535 Ga0495619_0139572 3300053085 Bacteria 1668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0116744 Ga0495582_0116744_242_1486 390
2 3300046559 Ga0495667_0192278 Ga0495667_0192278_49_1290 396
3 3300035410 Ga0373924_0078622 Ga0373924_0078622_89_1351 403
4 3300035691 Ga0373931_0144901 Ga0373931_0144901_80_1351 404
5 3300035695 Ga0373927_0159364 Ga0373927_0159364_37_1305 405
6 3300046475 Ga0495639_0084863 Ga0495639_0084863_59_1333 405
7 3300035170 Ga0373943_0124420 Ga0373943_0124420_56_1333 406
8 3300046678 Ga0495599_0170910 Ga0495599_0170910_33_1310 406
9 3300046455 Ga0495603_0086375 Ga0495603_0086375_141_1526 437
10 3300046462 Ga0495651_0118957 Ga0495651_0118957_187_1572 437
11 3300046642 Ga0495634_0042561 Ga0495634_0042561_1069_2454 437
12 3300035725 Ga0373947_0011150 Ga0373947_0011150_1228_2856 449
13 3300037068 Ga0373925_0058538 Ga0373925_0058538_27_1655 449
14 3300035089 Ga0373944_0022438 Ga0373944_0022438_385_1800 452
15 3300046690 Ga0495624_0120769 Ga0495624_0120769_120_1535 452
16 3300048914 Ga0496111_0199256 Ga0496111_0199256_15_1442 456
17 3300035170 Ga0373943_0034446 Ga0373943_0034446_576_2021 457
18 3300035171 Ga0373946_0015927 Ga0373946_0015927_297_1742 457
19 3300035410 Ga0373924_0022969 Ga0373924_0022969_111_1556 457
20 3300025928 Ga0207700_10051606 Ga0207700_100516063 459
21 3300025898 Ga0207692_10079042 Ga0207692_100790421 460
22 3300013296 Ga0157374_10165507 Ga0157374_101655073 461
23 3300046529 Ga0495652_0141507 Ga0495652_0141507_247_1830 461
24 3300046678 Ga0495599_0032381 Ga0495599_0032381_1824_3269 461
25 3300045976 Ga0466967_0289022 Ga0466967_0289022_100_1557 468
26 3300035083 Ga0373926_0027272 Ga0373926_0027272_178_1719 470
27 3300035170 Ga0373943_0024211 Ga0373943_0024211_317_1858 470
28 3300035692 Ga0373935_0064580 Ga0373935_0064580_124_1665 470
29 3300035695 Ga0373927_0105106 Ga0373927_0105106_241_1782 470
30 3300035725 Ga0373947_0109008 Ga0373947_0109008_43_1584 470
31 3300037068 Ga0373925_0071015 Ga0373925_0071015_645_2186 470
32 3300005471 Ga0070698_100173333 Ga0070698_1001733331 472
33 3300005983 Ga0081540_1046336 Ga0081540_10463362 472
34 3300046543 Ga0495645_0127359 Ga0495645_0127359_66_1616 473
35 3300035692 Ga0373935_0050731 Ga0373935_0050731_282_1835 476
36 3300025916 Ga0207663_10127243 Ga0207663_101272431 477
37 3300035724 Ga0373933_0110645 Ga0373933_0110645_125_1684 477
38 3300025898 Ga0207692_10010452 Ga0207692_100104524 478
39 3300025916 Ga0207663_10026465 Ga0207663_100264651 478
40 3300025929 Ga0207664_10153470 Ga0207664_101534701 478
41 3300037853 Ga0436364_0202490 Ga0436364_0202490_340_1899 478
42 3300005435 Ga0070714_100043344 Ga0070714_1000433444 480
43 3300007788 Ga0099795_10019668 Ga0099795_100196681 480
44 3300010159 Ga0099796_10013799 Ga0099796_100137992 480
45 3300027512 Ga0209179_1005936 Ga0209179_10059361 480
46 3300047319 Ga0495674_0110962 Ga0495674_0110962_166_1686 480
47 3300035089 Ga0373944_0020952 Ga0373944_0020952_151_1680 481
48 3300035111 Ga0373923_0013079 Ga0373923_0013079_93_1622 481
49 3300035113 Ga0373936_0011709 Ga0373936_0011709_1449_2978 481
50 3300035116 Ga0373945_0017987 Ga0373945_0017987_348_1877 481
51 3300035119 Ga0373956_0057423 Ga0373956_0057423_85_1614 481
52 3300035172 Ga0373955_0016758 Ga0373955_0016758_779_2308 481
53 3300035724 Ga0373933_0054797 Ga0373933_0054797_339_1868 481
54 3300036401 Ga0373937_0095823 Ga0373937_0095823_828_2357 481
55 3300037068 Ga0373925_0147240 Ga0373925_0147240_92_1621 481
56 3300046454 Ga0495592_0006679 Ga0495592_0006679_4199_5728 481
57 3300046459 Ga0495629_0032964 Ga0495629_0032964_232_1761 481
58 3300046461 Ga0495641_0054044 Ga0495641_0054044_131_1660 481
59 3300046463 Ga0495653_0023632 Ga0495653_0023632_2707_4236 481
60 3300046476 Ga0495662_0052003 Ga0495662_0052003_103_1632 481
61 3300046499 Ga0495594_0007576 Ga0495594_0007576_155_1684 481
62 3300046511 Ga0495608_0046626 Ga0495608_0046626_71_1600 481
63 3300046514 Ga0495618_0116006 Ga0495618_0116006_149_1678 481
64 3300046516 Ga0495628_0088123 Ga0495628_0088123_774_2303 481
65 3300046517 Ga0495630_0143781 Ga0495630_0143781_117_1646 481
66 3300046529 Ga0495652_0097157 Ga0495652_0097157_473_2002 481
67 3300046533 Ga0495640_0090967 Ga0495640_0090967_135_1664 481
68 3300046536 Ga0495587_0013329 Ga0495587_0013329_70_1599 481
69 3300046543 Ga0495645_0074176 Ga0495645_0074176_548_2077 481
70 3300046559 Ga0495667_0075080 Ga0495667_0075080_124_1653 481
71 3300046675 Ga0495657_0081556 Ga0495657_0081556_104_1633 481
72 3300046678 Ga0495599_0041508 Ga0495599_0041508_618_2147 481
73 3300046680 Ga0495646_0069431 Ga0495646_0069431_104_1633 481
74 3300046683 Ga0495658_0018404 Ga0495658_0018404_164_1693 481
75 3300046809 Ga0495600_0038608 Ga0495600_0038608_114_1643 481
76 3300047315 Ga0495581_0084844 Ga0495581_0084844_172_1701 481
77 3300047317 Ga0495604_0134847 Ga0495604_0134847_202_1731 481
78 3300047319 Ga0495674_0093255 Ga0495674_0093255_395_1924 481
79 3300047321 Ga0495676_0105608 Ga0495676_0105608_506_2035 481
80 3300047322 Ga0495680_0075550 Ga0495680_0075550_488_2017 481
81 3300047471 Ga0495684_0142517 Ga0495684_0142517_135_1664 481
82 3300047673 Ga0495593_0057207 Ga0495593_0057207_494_2023 481
83 3300048088 Ga0495602_0130713 Ga0495602_0130713_120_1649 481
84 3300053077 Ga0495601_0007098 Ga0495601_0007098_529_2058 481
85 3300053078 Ga0495612_0042011 Ga0495612_0042011_246_1775 481
86 3300053085 Ga0495619_0072250 Ga0495619_0072250_136_1665 481
87 3300036401 Ga0373937_0192900 Ga0373937_0192900_230_1777 482
88 3300036401 Ga0373937_0262040 Ga0373937_0262040_24_1523 482
89 3300006175 Ga0070712_100087501 Ga0070712_1000875011 483
90 3300010159 Ga0099796_10025196 Ga0099796_100251961 484
91 3300005536 Ga0070697_100163065 Ga0070697_1001630651 485
92 3300035171 Ga0373946_0058106 Ga0373946_0058106_103_1617 485
93 3300037853 Ga0436364_0448425 Ga0436364_0448425_455_2044 485
94 3300005436 Ga0070713_100116027 Ga0070713_1001160272 488
95 3300005471 Ga0070698_100219434 Ga0070698_1002194341 488
96 3300035695 Ga0373927_0043339 Ga0373927_0043339_333_1880 488
97 3300037068 Ga0373925_0029089 Ga0373925_0029089_1151_2698 488
98 3300005435 Ga0070714_100208004 Ga0070714_1002080041 489
99 3300025898 Ga0207692_10078255 Ga0207692_100782551 489
100 3300035086 Ga0373934_0024651 Ga0373934_0024651_647_2197 490
101 3300035111 Ga0373923_0039206 Ga0373923_0039206_99_1649 490
102 3300035116 Ga0373945_0030432 Ga0373945_0030432_226_1776 490
103 3300035118 Ga0373954_0037981 Ga0373954_0037981_514_2064 490
104 3300035119 Ga0373956_0057631 Ga0373956_0057631_64_1614 490
105 3300035120 Ga0373957_0027840 Ga0373957_0027840_456_2006 490
106 3300035410 Ga0373924_0035225 Ga0373924_0035225_86_1636 490
107 3300035692 Ga0373935_0120618 Ga0373935_0120618_134_1684 490
108 3300035725 Ga0373947_0062167 Ga0373947_0062167_290_1840 490
109 3300036401 Ga0373937_0232931 Ga0373937_0232931_28_1578 490
110 3300037068 Ga0373925_0163852 Ga0373925_0163852_145_1695 490
111 3300046454 Ga0495592_0120691 Ga0495592_0120691_139_1689 490
112 3300046459 Ga0495629_0108260 Ga0495629_0108260_358_1908 490
113 3300046462 Ga0495651_0068655 Ga0495651_0068655_768_2318 490
114 3300046473 Ga0495582_0030227 Ga0495582_0030227_774_2324 490
115 3300046477 Ga0495664_0048872 Ga0495664_0048872_845_2395 490
116 3300046511 Ga0495608_0019288 Ga0495608_0019288_147_1697 490
117 3300046514 Ga0495618_0062742 Ga0495618_0062742_209_1759 490
118 3300046516 Ga0495628_0092081 Ga0495628_0092081_152_1702 490
119 3300046517 Ga0495630_0066393 Ga0495630_0066393_1031_2581 490
120 3300046526 Ga0495666_0041013 Ga0495666_0041013_537_2087 490
121 3300046531 Ga0495665_0053053 Ga0495665_0053053_126_1676 490
122 3300046533 Ga0495640_0020799 Ga0495640_0020799_400_1950 490
123 3300046536 Ga0495587_0072944 Ga0495587_0072944_287_1837 490
124 3300046559 Ga0495667_0047116 Ga0495667_0047116_732_2282 490
125 3300046642 Ga0495634_0040597 Ga0495634_0040597_721_2271 490
126 3300046675 Ga0495657_0008418 Ga0495657_0008418_4219_5769 490
127 3300046678 Ga0495599_0064877 Ga0495599_0064877_314_1864 490
128 3300046679 Ga0495623_0098947 Ga0495623_0098947_188_1738 490
129 3300046680 Ga0495646_0078482 Ga0495646_0078482_124_1674 490
130 3300046683 Ga0495658_0079330 Ga0495658_0079330_175_1725 490
131 3300046689 Ga0495613_0077679 Ga0495613_0077679_377_1927 490
132 3300046809 Ga0495600_0005570 Ga0495600_0005570_1588_3138 490
133 3300047315 Ga0495581_0057220 Ga0495581_0057220_609_2159 490
134 3300047317 Ga0495604_0126884 Ga0495604_0126884_99_1649 490
135 3300047319 Ga0495674_0054617 Ga0495674_0054617_1625_3175 490
136 3300047471 Ga0495684_0138089 Ga0495684_0138089_210_1760 490
137 3300048088 Ga0495602_0133407 Ga0495602_0133407_368_1918 490
138 3300053085 Ga0495619_0139572 Ga0495619_0139572_67_1617 490
139 3300005434 Ga0070709_10127544 Ga0070709_101275441 491
140 3300005435 Ga0070714_100182083 Ga0070714_1001820831 491
141 3300005436 Ga0070713_100182478 Ga0070713_1001824781 491
142 3300005437 Ga0070710_10078295 Ga0070710_100782951 491
143 3300025898 Ga0207692_10053680 Ga0207692_100536801 491
144 3300025906 Ga0207699_10101491 Ga0207699_101014911 491
145 3300025915 Ga0207693_10142428 Ga0207693_101424281 491
146 3300025928 Ga0207700_10187970 Ga0207700_101879701 491
147 3300025929 Ga0207664_10179051 Ga0207664_101790511 491
148 3300005435 Ga0070714_100179203 Ga0070714_1001792032 493
149 3300025944 Ga0207661_10152815 Ga0207661_101528151 493
150 3300035691 Ga0373931_0081446 Ga0373931_0081446_162_1733 493
151 3300048911 Ga0496108_0200107 Ga0496108_0200107_35_1606 493
152 3300048912 Ga0496109_0204295 Ga0496109_0204295_89_1660 493
153 3300048914 Ga0496111_0104895 Ga0496111_0104895_146_1696 493
154 3300048915 Ga0496112_0150742 Ga0496112_0150742_124_1695 493
155 3300048916 Ga0496113_0150856 Ga0496113_0150856_191_1762 493
156 3300005530 Ga0070679_100121408 Ga0070679_1001214081 494
157 3300005535 Ga0070684_100105821 Ga0070684_1001058212 494
158 3300005564 Ga0070664_100126234 Ga0070664_1001262341 494
159 3300005614 Ga0068856_100240832 Ga0068856_1002408321 494
160 3300005618 Ga0068864_100164047 Ga0068864_1001640471 494
161 3300005841 Ga0068863_100063758 Ga0068863_1000637581 494
162 3300006173 Ga0070716_100089035 Ga0070716_1000890351 494
163 3300006175 Ga0070712_100090221 Ga0070712_1000902212 494
164 3300006914 Ga0075436_100130705 Ga0075436_1001307051 494
165 3300014325 Ga0163163_10148313 Ga0163163_101483131 494
166 3300025898 Ga0207692_10033275 Ga0207692_100332751 494
167 3300025906 Ga0207699_10111477 Ga0207699_101114771 494
168 3300025915 Ga0207693_10050159 Ga0207693_100501593 494
169 3300025920 Ga0207649_10130032 Ga0207649_101300321 494
170 3300025928 Ga0207700_10040114 Ga0207700_100401143 494
171 3300025929 Ga0207664_10191888 Ga0207664_101918881 494
172 3300025939 Ga0207665_10053360 Ga0207665_100533602 494
173 3300025944 Ga0207661_10189417 Ga0207661_101894171 494
174 3300025945 Ga0207679_10186474 Ga0207679_101864741 494
175 3300026078 Ga0207702_10174292 Ga0207702_101742921 494
176 3300026095 Ga0207676_10182115 Ga0207676_101821151 494
177 3300026116 Ga0207674_10218708 Ga0207674_102187081 494
178 3300048907 Ga0496104_0136211 Ga0496104_0136211_703_2256 494
179 3300048908 Ga0496105_0066021 Ga0496105_0066021_800_2353 494
180 3300048911 Ga0496108_0142321 Ga0496108_0142321_306_1859 494
181 3300048912 Ga0496109_0212306 Ga0496109_0212306_231_1784 494
182 3300048913 Ga0496110_0117341 Ga0496110_0117341_301_1854 494
183 3300048915 Ga0496112_0183925 Ga0496112_0183925_245_1798 494
184 3300048916 Ga0496113_0076860 Ga0496113_0076860_645_2198 494
185 3300048917 Ga0496114_0171833 Ga0496114_0171833_174_1727 494
186 3300050514 nmdc:mga08x19_34303_c1 nmdc:mga08x19_34303_c1_178_1731 494
187 3300005355 Ga0070671_100142515 Ga0070671_1001425151 495
188 3300005434 Ga0070709_10082082 Ga0070709_100820821 495
189 3300005435 Ga0070714_100185032 Ga0070714_1001850321 495
190 3300005439 Ga0070711_100084214 Ga0070711_1000842141 495
191 3300005456 Ga0070678_100069852 Ga0070678_1000698521 495
192 3300005547 Ga0070693_100029303 Ga0070693_1000293032 495
193 3300005577 Ga0068857_100124283 Ga0068857_1001242832 495
194 3300005614 Ga0068856_100222624 Ga0068856_1002226241 495
195 3300006028 Ga0070717_10132505 Ga0070717_101325052 495
196 3300006871 Ga0075434_100227666 Ga0075434_1002276661 495
197 3300009177 Ga0105248_10281820 Ga0105248_102818201 495
198 3300009545 Ga0105237_10181343 Ga0105237_101813431 495
199 3300009551 Ga0105238_10211052 Ga0105238_102110522 495
200 3300011119 Ga0105246_10062971 Ga0105246_100629711 495
201 3300013105 Ga0157369_10266269 Ga0157369_102662691 495
202 3300013307 Ga0157372_10313445 Ga0157372_103134451 495
203 3300013308 Ga0157375_10235823 Ga0157375_102358232 495
204 3300025906 Ga0207699_10114514 Ga0207699_101145141 495
205 3300025914 Ga0207671_10139403 Ga0207671_101394031 495
206 3300025915 Ga0207693_10104813 Ga0207693_101048131 495
207 3300025916 Ga0207663_10103093 Ga0207663_101030931 495
208 3300025923 Ga0207681_10122196 Ga0207681_101221961 495
209 3300025929 Ga0207664_10196000 Ga0207664_101960001 495
210 3300026078 Ga0207702_10228659 Ga0207702_102286591 495
211 3300026121 Ga0207683_10220171 Ga0207683_102201711 495
212 3300028379 Ga0268266_10236267 Ga0268266_102362671 495
213 3300028381 Ga0268264_10209547 Ga0268264_102095471 495
214 3300031616 Ga0307508_10154293 Ga0307508_101542931 495
215 3300048903 Ga0496100_0132995 Ga0496100_0132995_124_1671 495
216 3300048905 Ga0496102_0171942 Ga0496102_0171942_389_1936 495
217 3300048906 Ga0496103_0105111 Ga0496103_0105111_154_1701 495
218 3300048909 Ga0496106_0158599 Ga0496106_0158599_218_1765 495
219 3300048911 Ga0496108_0184985 Ga0496108_0184985_226_1773 495
220 3300048912 Ga0496109_0222643 Ga0496109_0222643_87_1634 495
221 3300048915 Ga0496112_0213935 Ga0496112_0213935_133_1680 495
222 3300005434 Ga0070709_10070019 Ga0070709_100700192 496
223 3300006028 Ga0070717_10178424 Ga0070717_101784242 496
224 3300006173 Ga0070716_100106763 Ga0070716_1001067631 496
225 3300025898 Ga0207692_10073546 Ga0207692_100735461 496
226 3300025910 Ga0207684_10068842 Ga0207684_100688422 496
227 3300025915 Ga0207693_10065552 Ga0207693_100655521 496
228 3300025916 Ga0207663_10094592 Ga0207663_100945921 496
229 3300025922 Ga0207646_10143357 Ga0207646_101433571 496
230 3300025929 Ga0207664_10195034 Ga0207664_101950341 496
231 3300025939 Ga0207665_10015361 Ga0207665_100153614 496
232 3300025945 Ga0207679_10113442 Ga0207679_101134421 496
233 3300048918 Ga0496115_0167204 Ga0496115_0167204_159_1706 496
234 3300005340 Ga0070689_100157582 Ga0070689_1001575821 497
235 3300007076 Ga0075435_100160082 Ga0075435_1001600821 497
236 3300007788 Ga0099795_10002225 Ga0099795_100022252 497
237 3300046454 Ga0495592_0126164 Ga0495592_0126164_129_1673 497
238 3300046463 Ga0495653_0148180 Ga0495653_0148180_57_1601 497
239 3300046477 Ga0495664_0087170 Ga0495664_0087170_124_1668 497
240 3300046516 Ga0495628_0146155 Ga0495628_0146155_66_1610 497
241 3300046517 Ga0495630_0159551 Ga0495630_0159551_125_1669 497
242 3300046675 Ga0495657_0019925 Ga0495657_0019925_3048_4592 497
243 3300046678 Ga0495599_0101792 Ga0495599_0101792_84_1628 497
244 3300046680 Ga0495646_0084653 Ga0495646_0084653_170_1714 497
245 3300047319 Ga0495674_0169216 Ga0495674_0169216_103_1647 497
246 3300047322 Ga0495680_0129061 Ga0495680_0129061_123_1667 497
247 3300005327 Ga0070658_10157086 Ga0070658_101570862 498
248 3300005329 Ga0070683_100119995 Ga0070683_1001199952 498
249 3300005331 Ga0070670_100121033 Ga0070670_1001210332 498
250 3300005337 Ga0070682_100004693 Ga0070682_1000046934 498
251 3300005344 Ga0070661_100015087 Ga0070661_1000150872 498
252 3300005345 Ga0070692_10051937 Ga0070692_100519372 498
253 3300005347 Ga0070668_100117151 Ga0070668_1001171511 498
254 3300005353 Ga0070669_100088809 Ga0070669_1000888091 498
255 3300005354 Ga0070675_100144094 Ga0070675_1001440941 498
256 3300005364 Ga0070673_100016657 Ga0070673_1000166571 498
257 3300005366 Ga0070659_100015663 Ga0070659_1000156635 498
258 3300005406 Ga0070703_10007010 Ga0070703_100070101 498
259 3300005434 Ga0070709_10100639 Ga0070709_101006392 498
260 3300005436 Ga0070713_100218202 Ga0070713_1002182021 498
261 3300005437 Ga0070710_10049247 Ga0070710_100492471 498
262 3300005438 Ga0070701_10056823 Ga0070701_100568231 498
263 3300005439 Ga0070711_100122748 Ga0070711_1001227481 498
264 3300005440 Ga0070705_100021993 Ga0070705_1000219931 498
265 3300005444 Ga0070694_100126720 Ga0070694_1001267201 498
266 3300005455 Ga0070663_100155542 Ga0070663_1001555421 498
267 3300005456 Ga0070678_100154265 Ga0070678_1001542651 498
268 3300005457 Ga0070662_100138812 Ga0070662_1001388121 498
269 3300005466 Ga0070685_10097537 Ga0070685_100975371 498
270 3300005530 Ga0070679_100153980 Ga0070679_1001539803 498
271 3300005539 Ga0068853_100226629 Ga0068853_1002266291 498
272 3300005543 Ga0070672_100042424 Ga0070672_1000424241 498
273 3300005544 Ga0070686_100106767 Ga0070686_1001067671 498
274 3300005547 Ga0070693_100070664 Ga0070693_1000706642 498
275 3300005548 Ga0070665_100019813 Ga0070665_1000198136 498
276 3300005549 Ga0070704_100028363 Ga0070704_1000283633 498
277 3300005563 Ga0068855_100266737 Ga0068855_1002667371 498
278 3300005564 Ga0070664_100155248 Ga0070664_1001552482 498
279 3300005577 Ga0068857_100074597 Ga0068857_1000745972 498
280 3300005615 Ga0070702_100048801 Ga0070702_1000488011 498
281 3300005719 Ga0068861_100133506 Ga0068861_1001335062 498
282 3300005834 Ga0068851_10064147 Ga0068851_100641471 498
283 3300005842 Ga0068858_100077346 Ga0068858_1000773461 498
284 3300005843 Ga0068860_100065438 Ga0068860_1000654381 498
285 3300005844 Ga0068862_100151913 Ga0068862_1001519131 498
286 3300006028 Ga0070717_10147730 Ga0070717_101477301 498
287 3300006175 Ga0070712_100112463 Ga0070712_1001124631 498
288 3300006237 Ga0097621_100023678 Ga0097621_1000236784 498
289 3300006881 Ga0068865_100049640 Ga0068865_1000496402 498
290 3300009011 Ga0105251_10036495 Ga0105251_100364952 498
291 3300009093 Ga0105240_10261642 Ga0105240_102616421 498
292 3300009148 Ga0105243_10070154 Ga0105243_100701543 498
293 3300009176 Ga0105242_10156098 Ga0105242_101560981 498
294 3300009177 Ga0105248_10198310 Ga0105248_101983101 498
295 3300009545 Ga0105237_10208985 Ga0105237_102089851 498
296 3300009551 Ga0105238_10084396 Ga0105238_100843961 498
297 3300009553 Ga0105249_10071169 Ga0105249_100711692 498
298 3300011119 Ga0105246_10024117 Ga0105246_100241173 498
299 3300013100 Ga0157373_10046053 Ga0157373_100460533 498
300 3300013104 Ga0157370_10104784 Ga0157370_101047842 498
301 3300013297 Ga0157378_10199802 Ga0157378_101998021 498
302 3300013306 Ga0163162_10180592 Ga0163162_101805921 498
303 3300013307 Ga0157372_10056525 Ga0157372_100565254 498
304 3300013308 Ga0157375_10212930 Ga0157375_102129301 498
305 3300014325 Ga0163163_10107526 Ga0163163_101075262 498
306 3300014968 Ga0157379_10047464 Ga0157379_100474642 498
307 3300020070 Ga0206356_10114388 Ga0206356_101143882 498
308 3300020081 Ga0206354_10651989 Ga0206354_106519891 498
309 3300020082 Ga0206353_10149819 Ga0206353_101498192 498
310 3300025898 Ga0207692_10078606 Ga0207692_100786061 498
311 3300025898 Ga0207692_10080984 Ga0207692_100809841 498
312 3300025901 Ga0207688_10008454 Ga0207688_100084541 498
313 3300025905 Ga0207685_10024452 Ga0207685_100244521 498
314 3300025906 Ga0207699_10110147 Ga0207699_101101471 498
315 3300025906 Ga0207699_10111902 Ga0207699_101119021 498
316 3300025909 Ga0207705_10111402 Ga0207705_101114021 498
317 3300025912 Ga0207707_10155037 Ga0207707_101550371 498
318 3300025913 Ga0207695_10199833 Ga0207695_101998331 498
319 3300025914 Ga0207671_10163895 Ga0207671_101638951 498
320 3300025915 Ga0207693_10059297 Ga0207693_100592972 498
321 3300025915 Ga0207693_10147533 Ga0207693_101475331 498
322 3300025918 Ga0207662_10004077 Ga0207662_100040771 498
323 3300025919 Ga0207657_10007429 Ga0207657_100074295 498
324 3300025924 Ga0207694_10171815 Ga0207694_101718151 498
325 3300025927 Ga0207687_10016169 Ga0207687_100161694 498
326 3300025928 Ga0207700_10028804 Ga0207700_100288043 498
327 3300025928 Ga0207700_10176395 Ga0207700_101763952 498
328 3300025929 Ga0207664_10099361 Ga0207664_100993612 498
329 3300025929 Ga0207664_10190229 Ga0207664_101902292 498
330 3300025931 Ga0207644_10023410 Ga0207644_100234103 498
331 3300025932 Ga0207690_10146170 Ga0207690_101461701 498
332 3300025933 Ga0207706_10118789 Ga0207706_101187891 498
333 3300025934 Ga0207686_10107434 Ga0207686_101074341 498
334 3300025935 Ga0207709_10107221 Ga0207709_101072211 498
335 3300025936 Ga0207670_10086727 Ga0207670_100867272 498
336 3300025939 Ga0207665_10085556 Ga0207665_100855561 498
337 3300025940 Ga0207691_10184419 Ga0207691_101844191 498
338 3300025942 Ga0207689_10170374 Ga0207689_101703741 498
339 3300025944 Ga0207661_10198731 Ga0207661_101987311 498
340 3300025945 Ga0207679_10068574 Ga0207679_100685742 498
341 3300025949 Ga0207667_10255035 Ga0207667_102550351 498
342 3300025961 Ga0207712_10156544 Ga0207712_101565441 498
343 3300025972 Ga0207668_10166358 Ga0207668_101663581 498
344 3300025981 Ga0207640_10133129 Ga0207640_101331291 498
345 3300026023 Ga0207677_10106877 Ga0207677_101068771 498
346 3300026035 Ga0207703_10183411 Ga0207703_101834111 498
347 3300026041 Ga0207639_10156641 Ga0207639_101566411 498
348 3300026067 Ga0207678_10000836 Ga0207678_1000083628 498
349 3300026078 Ga0207702_10176600 Ga0207702_101766001 498
350 3300026088 Ga0207641_10183005 Ga0207641_101830051 498
351 3300026095 Ga0207676_10205400 Ga0207676_102054001 498
352 3300026116 Ga0207674_10008446 Ga0207674_1000844612 498
353 3300026118 Ga0207675_100108848 Ga0207675_1001088482 498
354 3300026121 Ga0207683_10012892 Ga0207683_100128925 498
355 3300026142 Ga0207698_10209299 Ga0207698_102092991 498
356 3300028379 Ga0268266_10220145 Ga0268266_102201451 498
357 3300028381 Ga0268264_10186009 Ga0268264_101860091 498
358 3300034816 Ga0373930_0008162 Ga0373930_0008162_137_1690 498
359 3300035085 Ga0373929_0008882 Ga0373929_0008882_161_1714 498
360 3300035112 Ga0373932_0012393 Ga0373932_0012393_79_1632 498
361 3300035114 Ga0373939_0021509 Ga0373939_0021509_91_1644 498
362 3300035121 Ga0373960_0018542 Ga0373960_0018542_211_1764 498
363 3300035241 Ga0373961_0014643 Ga0373961_0014643_224_1777 498
364 3300035242 Ga0373962_0015499 Ga0373962_0015499_329_1882 498
365 3300046477 Ga0495664_0087647 Ga0495664_0087647_266_1822 498
366 3300046516 Ga0495628_0115594 Ga0495628_0115594_162_1718 498
367 3300046529 Ga0495652_0091355 Ga0495652_0091355_790_2346 498
368 3300046543 Ga0495645_0134084 Ga0495645_0134084_120_1676 498
369 3300047321 Ga0495676_0131795 Ga0495676_0131795_126_1682 498
370 3300048903 Ga0496100_0125572 Ga0496100_0125572_88_1641 498
371 3300048904 Ga0496101_0126415 Ga0496101_0126415_50_1603 498
372 3300048905 Ga0496102_0178433 Ga0496102_0178433_385_1938 498
373 3300048906 Ga0496103_0045100 Ga0496103_0045100_1119_2672 498
374 3300048908 Ga0496105_0046463 Ga0496105_0046463_894_2447 498
375 3300048909 Ga0496106_0161810 Ga0496106_0161810_58_1611 498
376 3300048910 Ga0496107_0146277 Ga0496107_0146277_56_1609 498
377 3300048915 Ga0496112_0174667 Ga0496112_0174667_360_1913 498
378 3300048916 Ga0496113_0171456 Ga0496113_0171456_21_1574 498
379 3300048918 Ga0496115_0188231 Ga0496115_0188231_43_1596 498
380 3300005367 Ga0070667_100216233 Ga0070667_1002162331 499
381 3300005434 Ga0070709_10017626 Ga0070709_100176262 499
382 3300005437 Ga0070710_10100647 Ga0070710_101006471 499
383 3300005439 Ga0070711_100035811 Ga0070711_1000358114 499
384 3300005445 Ga0070708_100101530 Ga0070708_1001015302 499
385 3300005564 Ga0070664_100088615 Ga0070664_1000886151 499
386 3300005841 Ga0068863_100118930 Ga0068863_1001189302 499
387 3300006175 Ga0070712_100160958 Ga0070712_1001609581 499
388 3300025898 Ga0207692_10008863 Ga0207692_100088634 499
389 3300025906 Ga0207699_10104056 Ga0207699_101040561 499
390 3300025910 Ga0207684_10196339 Ga0207684_101963391 499
391 3300025915 Ga0207693_10101185 Ga0207693_101011851 499
392 3300025916 Ga0207663_10085014 Ga0207663_100850141 499
393 3300025928 Ga0207700_10137505 Ga0207700_101375051 499
394 3300025929 Ga0207664_10105717 Ga0207664_101057171 499
395 3300025929 Ga0207664_10169746 Ga0207664_101697461 499
396 3300025939 Ga0207665_10118369 Ga0207665_101183691 499
397 3300025986 Ga0207658_10106334 Ga0207658_101063341 499
398 3300026088 Ga0207641_10187318 Ga0207641_101873181 499
399 3300026095 Ga0207676_10186261 Ga0207676_101862611 499
400 3300035083 Ga0373926_0033082 Ga0373926_0033082_157_1713 499
401 3300035083 Ga0373926_0033469 Ga0373926_0033469_112_1668 499
402 3300035113 Ga0373936_0042367 Ga0373936_0042367_161_1717 499
403 3300035116 Ga0373945_0035881 Ga0373945_0035881_26_1582 499
404 3300035170 Ga0373943_0063998 Ga0373943_0063998_191_1747 499
405 3300035171 Ga0373946_0042964 Ga0373946_0042964_97_1653 499
406 3300035692 Ga0373935_0123455 Ga0373935_0123455_94_1650 499
407 3300035695 Ga0373927_0118643 Ga0373927_0118643_121_1677 499
408 3300035725 Ga0373947_0077318 Ga0373947_0077318_392_1948 499
409 3300036401 Ga0373937_0200362 Ga0373937_0200362_97_1653 499
410 3300037068 Ga0373925_0142241 Ga0373925_0142241_105_1661 499
411 3300037068 Ga0373925_0153547 Ga0373925_0153547_190_1746 499
412 3300045049 Ga0466959_0101895 Ga0466959_0101895_192_1742 499
413 3300046454 Ga0495592_0111400 Ga0495592_0111400_237_1793 499
414 3300046455 Ga0495603_0088627 Ga0495603_0088627_64_1620 499
415 3300046461 Ga0495641_0055501 Ga0495641_0055501_104_1660 499
416 3300046462 Ga0495651_0141192 Ga0495651_0141192_41_1597 499
417 3300046463 Ga0495653_0132152 Ga0495653_0132152_170_1726 499
418 3300046472 Ga0495580_0130892 Ga0495580_0130892_60_1616 499
419 3300046475 Ga0495639_0064848 Ga0495639_0064848_90_1646 499
420 3300046476 Ga0495662_0004516 Ga0495662_0004516_5248_6804 499
421 3300046477 Ga0495664_0022173 Ga0495664_0022173_137_1693 499
422 3300046499 Ga0495594_0061932 Ga0495594_0061932_389_1945 499
423 3300046511 Ga0495608_0115125 Ga0495608_0115125_43_1599 499
424 3300046514 Ga0495618_0096240 Ga0495618_0096240_107_1663 499
425 3300046516 Ga0495628_0145421 Ga0495628_0145421_171_1727 499
426 3300046517 Ga0495630_0098267 Ga0495630_0098267_607_2163 499
427 3300046526 Ga0495666_0010409 Ga0495666_0010409_52_1608 499
428 3300046529 Ga0495652_0151347 Ga0495652_0151347_125_1681 499
429 3300046533 Ga0495640_0118069 Ga0495640_0118069_102_1658 499
430 3300046535 Ga0495586_0086134 Ga0495586_0086134_42_1598 499
431 3300046543 Ga0495645_0119530 Ga0495645_0119530_211_1767 499
432 3300046642 Ga0495634_0095526 Ga0495634_0095526_152_1708 499
433 3300046642 Ga0495634_0106463 Ga0495634_0106463_138_1688 499
434 3300046663 Ga0495635_0109979 Ga0495635_0109979_218_1774 499
435 3300046674 Ga0495588_0052569 Ga0495588_0052569_359_1915 499
436 3300046675 Ga0495657_0027338 Ga0495657_0027338_2305_3861 499
437 3300046678 Ga0495599_0097920 Ga0495599_0097920_232_1788 499
438 3300046680 Ga0495646_0083937 Ga0495646_0083937_186_1742 499
439 3300046681 Ga0495647_0028397 Ga0495647_0028397_465_2021 499
440 3300046809 Ga0495600_0103884 Ga0495600_0103884_245_1801 499
441 3300047317 Ga0495604_0122213 Ga0495604_0122213_289_1845 499
442 3300047319 Ga0495674_0168864 Ga0495674_0168864_82_1638 499
443 3300047322 Ga0495680_0126624 Ga0495680_0126624_110_1666 499
444 3300047444 Ga0495675_0093137 Ga0495675_0093137_117_1673 499
445 3300047471 Ga0495684_0134401 Ga0495684_0134401_219_1775 499
446 3300048088 Ga0495602_0184385 Ga0495602_0184385_13_1569 499
447 3300048089 Ga0495614_0047978 Ga0495614_0047978_174_1730 499
448 3300048913 Ga0496110_0177038 Ga0496110_0177038_277_1854 499
449 3300048915 Ga0496112_0221047 Ga0496112_0221047_86_1663 499
450 3300053077 Ga0495601_0087616 Ga0495601_0087616_209_1765 499
451 3300053085 Ga0495619_0120012 Ga0495619_0120012_65_1621 499
452 3300035083 Ga0373926_0010757 Ga0373926_0010757_1368_2927 500
453 3300035086 Ga0373934_0024195 Ga0373934_0024195_608_2173 500
454 3300035111 Ga0373923_0044348 Ga0373923_0044348_14_1579 500
455 3300035113 Ga0373936_0029454 Ga0373936_0029454_231_1805 500
456 3300035117 Ga0373953_0026148 Ga0373953_0026148_498_2072 500
457 3300035117 Ga0373953_0026761 Ga0373953_0026761_390_1955 500
458 3300035118 Ga0373954_0042038 Ga0373954_0042038_306_1871 500
459 3300035118 Ga0373954_0045698 Ga0373954_0045698_132_1706 500
460 3300035119 Ga0373956_0023944 Ga0373956_0023944_878_2443 500
461 3300035119 Ga0373956_0031899 Ga0373956_0031899_50_1624 500
462 3300035120 Ga0373957_0020105 Ga0373957_0020105_330_1904 500
463 3300035172 Ga0373955_0049802 Ga0373955_0049802_339_1913 500
464 3300035410 Ga0373924_0048693 Ga0373924_0048693_148_1713 500
465 3300035692 Ga0373935_0079983 Ga0373935_0079983_514_2073 500
466 3300035692 Ga0373935_0097195 Ga0373935_0097195_164_1738 500
467 3300035724 Ga0373933_0071955 Ga0373933_0071955_373_1947 500
468 3300035725 Ga0373947_0046800 Ga0373947_0046800_226_1785 500
469 3300035725 Ga0373947_0059541 Ga0373947_0059541_301_1860 500
470 3300036401 Ga0373937_0140717 Ga0373937_0140717_346_1920 500
471 3300037068 Ga0373925_0109995 Ga0373925_0109995_193_1752 500
472 3300046454 Ga0495592_0100540 Ga0495592_0100540_191_1765 500
473 3300046462 Ga0495651_0079054 Ga0495651_0079054_497_2071 500
474 3300046463 Ga0495653_0094331 Ga0495653_0094331_147_1721 500
475 3300046473 Ga0495582_0081651 Ga0495582_0081651_131_1690 500
476 3300046476 Ga0495662_0052955 Ga0495662_0052955_122_1696 500
477 3300046477 Ga0495664_0048412 Ga0495664_0048412_608_2182 500
478 3300046511 Ga0495608_0078271 Ga0495608_0078271_379_1953 500
479 3300046514 Ga0495618_0076244 Ga0495618_0076244_453_2027 500
480 3300046514 Ga0495618_0098015 Ga0495618_0098015_161_1723 500
481 3300046516 Ga0495628_0141854 Ga0495628_0141854_212_1786 500
482 3300046529 Ga0495652_0093019 Ga0495652_0093019_498_2072 500
483 3300046533 Ga0495640_0074040 Ga0495640_0074040_211_1785 500
484 3300046536 Ga0495587_0043104 Ga0495587_0043104_654_2228 500
485 3300046543 Ga0495645_0046319 Ga0495645_0046319_1440_3014 500
486 3300046559 Ga0495667_0086117 Ga0495667_0086117_406_1980 500
487 3300046642 Ga0495634_0107326 Ga0495634_0107326_130_1704 500
488 3300046663 Ga0495635_0074803 Ga0495635_0074803_474_2048 500
489 3300046675 Ga0495657_0063654 Ga0495657_0063654_428_2002 500
490 3300046678 Ga0495599_0057646 Ga0495599_0057646_825_2399 500
491 3300046679 Ga0495623_0071232 Ga0495623_0071232_71_1645 500
492 3300046680 Ga0495646_0057813 Ga0495646_0057813_575_2149 500
493 3300046809 Ga0495600_0079706 Ga0495600_0079706_382_1956 500
494 3300047317 Ga0495604_0111933 Ga0495604_0111933_356_1930 500
495 3300047319 Ga0495674_0024334 Ga0495674_0024334_1433_2995 500
496 3300047319 Ga0495674_0116207 Ga0495674_0116207_369_1943 500
497 3300047322 Ga0495680_0018697 Ga0495680_0018697_52_1626 500
498 3300047444 Ga0495675_0086415 Ga0495675_0086415_194_1768 500
499 3300047471 Ga0495684_0046850 Ga0495684_0046850_1130_2692 500
500 3300047471 Ga0495684_0098192 Ga0495684_0098192_185_1759 500
501 3300048088 Ga0495602_0095884 Ga0495602_0095884_765_2339 500
502 3300048088 Ga0495602_0149971 Ga0495602_0149971_210_1775 500
503 3300053077 Ga0495601_0103802 Ga0495601_0103802_199_1773 500
504 3300053078 Ga0495612_0046402 Ga0495612_0046402_119_1693 500
505 3300053085 Ga0495619_0113362 Ga0495619_0113362_167_1741 500
506 3300007265 Ga0099794_10022796 Ga0099794_100227961 501
507 3300025898 Ga0207692_10047707 Ga0207692_100477071 501
508 3300005437 Ga0070710_10059946 Ga0070710_100599461 503
509 3300025916 Ga0207663_10113546 Ga0207663_101135461 503
510 3300037853 Ga0436364_0206840 Ga0436364_0206840_1939_3537 503
511 3300024227 Ga0228598_1007956 Ga0228598_10079561 506
512 3300005329 Ga0070683_100105722 Ga0070683_1001057221 508
513 3300047319 Ga0495674_0111780 Ga0495674_0111780_517_2160 508
514 3300005344 Ga0070661_100119366 Ga0070661_1001193662 509
515 3300021358 Ga0213873_10012627 Ga0213873_100126271 510
516 3300039453 Ga0436362_0587610 Ga0436362_0587610_154_1743 510
517 3300005467 Ga0070706_100224512 Ga0070706_1002245121 511
518 3300005536 Ga0070697_100187802 Ga0070697_1001878021 511
519 3300005983 Ga0081540_1029438 Ga0081540_10294381 511
520 3300005937 Ga0081455_10090085 Ga0081455_100900852 512
521 3300005983 Ga0081540_1000999 Ga0081540_10009991 512
522 3300006175 Ga0070712_100077610 Ga0070712_1000776102 513
523 3300005435 Ga0070714_100182602 Ga0070714_1001826021 515
524 3300005436 Ga0070713_100153373 Ga0070713_1001533731 515
525 3300005437 Ga0070710_10063015 Ga0070710_100630153 515
526 3300006028 Ga0070717_10177387 Ga0070717_101773871 515
527 3300025898 Ga0207692_10066352 Ga0207692_100663521 515
528 3300025916 Ga0207663_10061772 Ga0207663_100617722 515
529 3300025928 Ga0207700_10180499 Ga0207700_101804991 515
530 3300046477 Ga0495664_0099167 Ga0495664_0099167_44_1675 519
531 3300035171 Ga0373946_0032099 Ga0373946_0032099_135_1772 521
532 3300046690 Ga0495624_0093188 Ga0495624_0093188_143_1780 521
533 3300053077 Ga0495601_0101515 Ga0495601_0101515_146_1783 521
534 3300005518 Ga0070699_100209347 Ga0070699_1002093471 526
535 3300003659 JGI25404J52841_10013805 JGI25404J52841_100138051 527

Feature Viewer

pLDDT pTM Quality
64.85 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map