F460670
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 535 | 239 | 535 | 512 |
Family's Representative Sequence
| Representative Sequence | 3300025916|Ga0207663_10113546|Ga0207663_101135461 |
| Length | 555 |
| Sequence | MWHGCGSFRVSCRSGVVAVWVRLPFRRVLSCEFGTAEGKPQVEAYGLDELAASAEAVVAGLGPEAGGAVTLDAMEALVAERGRELLRGVVQLGLDAQAAAEVRLAGVAGADGVRRGRAERGHARAVVTTLGEVVVRRIGYRSGIKGAVSLFPRDAVLNLPPGGYSWAMQRLAVMFCLAVSYAQGHEFVLAATGVSIGKRQLEEIVAAAAADAERFCQDPGRARDEPVLPVTGEEGNLPPLGLSGDGKGVAMLPEARRRSARSPEQRVRTFSKRAGTGEKKGHKRMAETGCVFDVIPPDEPRTPEQVMRPAPGTAGNAPRAVNRWYACDITAGRDVTIGKVFDEAERRDPDHRRAWIALADGDNCQLGLIRAQAAARDVTVVIIIDFIHVLGYLWKAAWCFHPPRDPAMEDWVITQGTDILHGRAAEVITRIARLAGQHPPRPGSEHAKIIRTTLHYLDAKQPYMDYPRALAEGWPIATGVIEGACRHLIQDRMGITGARWGLAGAQAMLWLRAITASGDTEAYWDWHIQQEHRRNHLSRYKDGPGPRRDGLGLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 65 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 66 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 90 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 142 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 145 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 151 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 156 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 171 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.36 |
| Rhizosphere | 92.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10013805 | 3300003659 | Bacteria | 1752 |
| 2 | Ga0070658_10157086 | 3300005327 | Bacteria | 1907 |
| 3 | Ga0070683_100105722 | 3300005329 | Bacteria | 2654 |
| 4 | Ga0070683_100119995 | 3300005329 | Bacteria | 2483 |
| 5 | Ga0070670_100121033 | 3300005331 | Bacteria | 2258 |
| 6 | Ga0070682_100004693 | 3300005337 | Bacteria | 7592 |
| 7 | Ga0070689_100157582 | 3300005340 | Bacteria | 1834 |
| 8 | Ga0070661_100015087 | 3300005344 | Bacteria | 5451 |
| 9 | Ga0070661_100119366 | 3300005344 | Bacteria | 1974 |
| 10 | Ga0070692_10051937 | 3300005345 | Bacteria | 2134 |
| 11 | Ga0070668_100117151 | 3300005347 | Bacteria | 2125 |
| 12 | Ga0070669_100088809 | 3300005353 | Bacteria | 2314 |
| 13 | Ga0070675_100144094 | 3300005354 | Bacteria | 2038 |
| 14 | Ga0070671_100142515 | 3300005355 | Bacteria | 2022 |
| 15 | Ga0070673_100016657 | 3300005364 | Bacteria | 5204 |
| 16 | Ga0070659_100015663 | 3300005366 | Bacteria | 5679 |
| 17 | Ga0070667_100216233 | 3300005367 | Bacteria | 1705 |
| 18 | Ga0070703_10007010 | 3300005406 | Bacteria | 3159 |
| 19 | Ga0070709_10017626 | 3300005434 | Bacteria | 4099 |
| 20 | Ga0070709_10070019 | 3300005434 | Bacteria | 2260 |
| 21 | Ga0070709_10082082 | 3300005434 | Bacteria | 2105 |
| 22 | Ga0070709_10100639 | 3300005434 | Bacteria | 1925 |
| 23 | Ga0070709_10127544 | 3300005434 | Bacteria | 1733 |
| 24 | Ga0070714_100043344 | 3300005435 | Bacteria | 3805 |
| 25 | Ga0070714_100179203 | 3300005435 | Bacteria | 1927 |
| 26 | Ga0070714_100182083 | 3300005435 | Bacteria | 1912 |
| 27 | Ga0070714_100182602 | 3300005435 | Bacteria | 1909 |
| 28 | Ga0070714_100185032 | 3300005435 | Bacteria | 1898 |
| 29 | Ga0070714_100208004 | 3300005435 | Bacteria | 1792 |
| 30 | Ga0070713_100116027 | 3300005436 | Bacteria | 2341 |
| 31 | Ga0070713_100153373 | 3300005436 | Bacteria | 2051 |
| 32 | Ga0070713_100182478 | 3300005436 | Bacteria | 1886 |
| 33 | Ga0070713_100218202 | 3300005436 | Bacteria | 1729 |
| 34 | Ga0070710_10049247 | 3300005437 | Bacteria | 2356 |
| 35 | Ga0070710_10059946 | 3300005437 | Bacteria | 2163 |
| 36 | Ga0070710_10063015 | 3300005437 | Bacteria | 2117 |
| 37 | Ga0070710_10078295 | 3300005437 | Bacteria | 1923 |
| 38 | Ga0070710_10100647 | 3300005437 | Bacteria | 1720 |
| 39 | Ga0070701_10056823 | 3300005438 | Bacteria | 2049 |
| 40 | Ga0070711_100035811 | 3300005439 | Bacteria | 3321 |
| 41 | Ga0070711_100084214 | 3300005439 | Bacteria | 2274 |
| 42 | Ga0070711_100122748 | 3300005439 | Bacteria | 1924 |
| 43 | Ga0070705_100021993 | 3300005440 | Bacteria | 3400 |
| 44 | Ga0070694_100126720 | 3300005444 | Bacteria | 1839 |
| 45 | Ga0070708_100101530 | 3300005445 | Bacteria | 2634 |
| 46 | Ga0070663_100155542 | 3300005455 | Bacteria | 1756 |
| 47 | Ga0070678_100069852 | 3300005456 | Bacteria | 2624 |
| 48 | Ga0070678_100154265 | 3300005456 | Bacteria | 1854 |
| 49 | Ga0070662_100138812 | 3300005457 | Bacteria | 1881 |
| 50 | Ga0070685_10097537 | 3300005466 | Bacteria | 1789 |
| 51 | Ga0070706_100224512 | 3300005467 | Bacteria | 1753 |
| 52 | Ga0070698_100173333 | 3300005471 | Bacteria | 2097 |
| 53 | Ga0070698_100219434 | 3300005471 | Bacteria | 1835 |
| 54 | Ga0070699_100209347 | 3300005518 | Bacteria | 1735 |
| 55 | Ga0070679_100121408 | 3300005530 | Bacteria | 2598 |
| 56 | Ga0070679_100153980 | 3300005530 | Bacteria | 2274 |
| 57 | Ga0070684_100105821 | 3300005535 | Bacteria | 2518 |
| 58 | Ga0070697_100163065 | 3300005536 | Bacteria | 1884 |
| 59 | Ga0070697_100187802 | 3300005536 | Bacteria | 1753 |
| 60 | Ga0068853_100226629 | 3300005539 | Bacteria | 1708 |
| 61 | Ga0070672_100042424 | 3300005543 | Bacteria | 3503 |
| 62 | Ga0070686_100106767 | 3300005544 | Bacteria | 1901 |
| 63 | Ga0070693_100029303 | 3300005547 | Bacteria | 3001 |
| 64 | Ga0070693_100070664 | 3300005547 | Bacteria | 2054 |
| 65 | Ga0070665_100019813 | 3300005548 | Bacteria | 6752 |
| 66 | Ga0070704_100028363 | 3300005549 | Bacteria | 3723 |
| 67 | Ga0068855_100266737 | 3300005563 | Bacteria | 1905 |
| 68 | Ga0070664_100088615 | 3300005564 | Bacteria | 2676 |
| 69 | Ga0070664_100126234 | 3300005564 | Bacteria | 2245 |
| 70 | Ga0070664_100155248 | 3300005564 | Bacteria | 2022 |
| 71 | Ga0068857_100074597 | 3300005577 | Bacteria | 3023 |
| 72 | Ga0068857_100124283 | 3300005577 | Bacteria | 2325 |
| 73 | Ga0068856_100222624 | 3300005614 | Bacteria | 1902 |
| 74 | Ga0068856_100240832 | 3300005614 | Bacteria | 1824 |
| 75 | Ga0070702_100048801 | 3300005615 | Bacteria | 2411 |
| 76 | Ga0068864_100164047 | 3300005618 | Bacteria | 2021 |
| 77 | Ga0068861_100133506 | 3300005719 | Bacteria | 2018 |
| 78 | Ga0068851_10064147 | 3300005834 | Bacteria | 1888 |
| 79 | Ga0068863_100063758 | 3300005841 | Bacteria | 3485 |
| 80 | Ga0068863_100118930 | 3300005841 | Bacteria | 2518 |
| 81 | Ga0068858_100077346 | 3300005842 | Bacteria | 3091 |
| 82 | Ga0068860_100065438 | 3300005843 | Bacteria | 3452 |
| 83 | Ga0068862_100151913 | 3300005844 | Bacteria | 2061 |
| 84 | Ga0081455_10090085 | 3300005937 | Bacteria | 2488 |
| 85 | Ga0081540_1000999 | 3300005983 | Bacteria | 25418 |
| 86 | Ga0081540_1029438 | 3300005983 | Bacteria | 3059 |
| 87 | Ga0081540_1046336 | 3300005983 | Bacteria | 2196 |
| 88 | Ga0070717_10132505 | 3300006028 | Bacteria | 2145 |
| 89 | Ga0070717_10147730 | 3300006028 | Bacteria | 2032 |
| 90 | Ga0070717_10177387 | 3300006028 | Bacteria | 1855 |
| 91 | Ga0070717_10178424 | 3300006028 | Bacteria | 1850 |
| 92 | Ga0070716_100089035 | 3300006173 | Bacteria | 1863 |
| 93 | Ga0070716_100106763 | 3300006173 | Bacteria | 1727 |
| 94 | Ga0070712_100077610 | 3300006175 | Bacteria | 2394 |
| 95 | Ga0070712_100087501 | 3300006175 | Bacteria | 2273 |
| 96 | Ga0070712_100090221 | 3300006175 | Bacteria | 2243 |
| 97 | Ga0070712_100112463 | 3300006175 | Bacteria | 2034 |
| 98 | Ga0070712_100160958 | 3300006175 | Bacteria | 1733 |
| 99 | Ga0097621_100023678 | 3300006237 | Bacteria | 4783 |
| 100 | Ga0075434_100227666 | 3300006871 | Bacteria | 1884 |
| 101 | Ga0068865_100049640 | 3300006881 | Bacteria | 2894 |
| 102 | Ga0075436_100130705 | 3300006914 | Bacteria | 1761 |
| 103 | Ga0075435_100160082 | 3300007076 | Bacteria | 1896 |
| 104 | Ga0099794_10022796 | 3300007265 | Bacteria | 2858 |
| 105 | Ga0099795_10002225 | 3300007788 | Bacteria | 4498 |
| 106 | Ga0099795_10019668 | 3300007788 | Bacteria | 2188 |
| 107 | Ga0105251_10036495 | 3300009011 | Bacteria | 2418 |
| 108 | Ga0105240_10261642 | 3300009093 | Bacteria | 1995 |
| 109 | Ga0105243_10070154 | 3300009148 | Bacteria | 2829 |
| 110 | Ga0105242_10156098 | 3300009176 | Bacteria | 1993 |
| 111 | Ga0105248_10198310 | 3300009177 | Bacteria | 2261 |
| 112 | Ga0105248_10281820 | 3300009177 | Bacteria | 1871 |
| 113 | Ga0105237_10181343 | 3300009545 | Bacteria | 2106 |
| 114 | Ga0105237_10208985 | 3300009545 | Bacteria | 1952 |
| 115 | Ga0105238_10084396 | 3300009551 | Bacteria | 3166 |
| 116 | Ga0105238_10211052 | 3300009551 | Bacteria | 1917 |
| 117 | Ga0105249_10071169 | 3300009553 | Bacteria | 3212 |
| 118 | Ga0099796_10013799 | 3300010159 | Bacteria | 2317 |
| 119 | Ga0099796_10025196 | 3300010159 | Bacteria | 1875 |
| 120 | Ga0105246_10024117 | 3300011119 | Bacteria | 3947 |
| 121 | Ga0105246_10062971 | 3300011119 | Bacteria | 2585 |
| 122 | Ga0157373_10046053 | 3300013100 | Bacteria | 3113 |
| 123 | Ga0157370_10104784 | 3300013104 | Bacteria | 2647 |
| 124 | Ga0157369_10266269 | 3300013105 | Bacteria | 1787 |
| 125 | Ga0157374_10165507 | 3300013296 | Bacteria | 2155 |
| 126 | Ga0157378_10199802 | 3300013297 | Bacteria | 1890 |
| 127 | Ga0163162_10180592 | 3300013306 | Bacteria | 2236 |
| 128 | Ga0157372_10056525 | 3300013307 | Bacteria | 4384 |
| 129 | Ga0157372_10313445 | 3300013307 | Bacteria | 1826 |
| 130 | Ga0157375_10212930 | 3300013308 | Bacteria | 2090 |
| 131 | Ga0157375_10235823 | 3300013308 | Bacteria | 1989 |
| 132 | Ga0163163_10107526 | 3300014325 | Bacteria | 2816 |
| 133 | Ga0163163_10148313 | 3300014325 | Bacteria | 2390 |
| 134 | Ga0157379_10047464 | 3300014968 | Bacteria | 3831 |
| 135 | Ga0206356_10114388 | 3300020070 | Bacteria | 2043 |
| 136 | Ga0206354_10651989 | 3300020081 | Bacteria | 1972 |
| 137 | Ga0206353_10149819 | 3300020082 | Bacteria | 2573 |
| 138 | Ga0213873_10012627 | 3300021358 | Bacteria | 1835 |
| 139 | Ga0228598_1007956 | 3300024227 | Bacteria | 2148 |
| 140 | Ga0207692_10008863 | 3300025898 | Bacteria | 4181 |
| 141 | Ga0207692_10010452 | 3300025898 | Bacteria | 3911 |
| 142 | Ga0207692_10033275 | 3300025898 | Bacteria | 2485 |
| 143 | Ga0207692_10047707 | 3300025898 | Bacteria | 2152 |
| 144 | Ga0207692_10053680 | 3300025898 | Bacteria | 2054 |
| 145 | Ga0207692_10066352 | 3300025898 | Bacteria | 1886 |
| 146 | Ga0207692_10073546 | 3300025898 | Bacteria | 1808 |
| 147 | Ga0207692_10078255 | 3300025898 | Bacteria | 1761 |
| 148 | Ga0207692_10078606 | 3300025898 | Bacteria | 1758 |
| 149 | Ga0207692_10079042 | 3300025898 | Bacteria | 1754 |
| 150 | Ga0207692_10080984 | 3300025898 | Bacteria | 1736 |
| 151 | Ga0207688_10008454 | 3300025901 | Bacteria | 5599 |
| 152 | Ga0207685_10024452 | 3300025905 | Bacteria | 2071 |
| 153 | Ga0207699_10101491 | 3300025906 | Bacteria | 1826 |
| 154 | Ga0207699_10104056 | 3300025906 | Bacteria | 1807 |
| 155 | Ga0207699_10110147 | 3300025906 | Bacteria | 1763 |
| 156 | Ga0207699_10111477 | 3300025906 | Bacteria | 1754 |
| 157 | Ga0207699_10111902 | 3300025906 | Bacteria | 1751 |
| 158 | Ga0207699_10114514 | 3300025906 | Bacteria | 1734 |
| 159 | Ga0207705_10111402 | 3300025909 | Bacteria | 2022 |
| 160 | Ga0207684_10068842 | 3300025910 | Bacteria | 3008 |
| 161 | Ga0207684_10196339 | 3300025910 | Bacteria | 1741 |
| 162 | Ga0207707_10155037 | 3300025912 | Bacteria | 2003 |
| 163 | Ga0207695_10199833 | 3300025913 | Bacteria | 1914 |
| 164 | Ga0207671_10139403 | 3300025914 | Bacteria | 1867 |
| 165 | Ga0207671_10163895 | 3300025914 | Bacteria | 1723 |
| 166 | Ga0207693_10050159 | 3300025915 | Bacteria | 3278 |
| 167 | Ga0207693_10059297 | 3300025915 | Bacteria | 2998 |
| 168 | Ga0207693_10065552 | 3300025915 | Bacteria | 2844 |
| 169 | Ga0207693_10101185 | 3300025915 | Bacteria | 2260 |
| 170 | Ga0207693_10104813 | 3300025915 | Bacteria | 2218 |
| 171 | Ga0207693_10142428 | 3300025915 | Bacteria | 1885 |
| 172 | Ga0207693_10147533 | 3300025915 | Bacteria | 1850 |
| 173 | Ga0207663_10026465 | 3300025916 | Bacteria | 3367 |
| 174 | Ga0207663_10061772 | 3300025916 | Bacteria | 2378 |
| 175 | Ga0207663_10085014 | 3300025916 | Bacteria | 2082 |
| 176 | Ga0207663_10094592 | 3300025916 | Bacteria | 1991 |
| 177 | Ga0207663_10103093 | 3300025916 | Bacteria | 1921 |
| 178 | Ga0207663_10113546 | 3300025916 | Bacteria | 1842 |
| 179 | Ga0207663_10127243 | 3300025916 | Bacteria | 1754 |
| 180 | Ga0207662_10004077 | 3300025918 | Bacteria | 7629 |
| 181 | Ga0207657_10007429 | 3300025919 | Bacteria | 11240 |
| 182 | Ga0207649_10130032 | 3300025920 | Bacteria | 1709 |
| 183 | Ga0207646_10143357 | 3300025922 | Bacteria | 2152 |
| 184 | Ga0207681_10122196 | 3300025923 | Bacteria | 1911 |
| 185 | Ga0207694_10171815 | 3300025924 | Bacteria | 1755 |
| 186 | Ga0207687_10016169 | 3300025927 | Bacteria | 4899 |
| 187 | Ga0207700_10028804 | 3300025928 | Bacteria | 3912 |
| 188 | Ga0207700_10040114 | 3300025928 | Bacteria | 3414 |
| 189 | Ga0207700_10051606 | 3300025928 | Bacteria | 3070 |
| 190 | Ga0207700_10137505 | 3300025928 | Bacteria | 2003 |
| 191 | Ga0207700_10176395 | 3300025928 | Bacteria | 1786 |
| 192 | Ga0207700_10180499 | 3300025928 | Bacteria | 1767 |
| 193 | Ga0207700_10187970 | 3300025928 | Bacteria | 1734 |
| 194 | Ga0207664_10099361 | 3300025929 | Bacteria | 2401 |
| 195 | Ga0207664_10105717 | 3300025929 | Bacteria | 2333 |
| 196 | Ga0207664_10153470 | 3300025929 | Bacteria | 1958 |
| 197 | Ga0207664_10169746 | 3300025929 | Bacteria | 1866 |
| 198 | Ga0207664_10179051 | 3300025929 | Bacteria | 1819 |
| 199 | Ga0207664_10190229 | 3300025929 | Bacteria | 1766 |
| 200 | Ga0207664_10191888 | 3300025929 | Bacteria | 1759 |
| 201 | Ga0207664_10195034 | 3300025929 | Bacteria | 1745 |
| 202 | Ga0207664_10196000 | 3300025929 | Bacteria | 1741 |
| 203 | Ga0207644_10023410 | 3300025931 | Bacteria | 4230 |
| 204 | Ga0207690_10146170 | 3300025932 | Bacteria | 1748 |
| 205 | Ga0207706_10118789 | 3300025933 | Bacteria | 2325 |
| 206 | Ga0207686_10107434 | 3300025934 | Bacteria | 1875 |
| 207 | Ga0207709_10107221 | 3300025935 | Bacteria | 1860 |
| 208 | Ga0207670_10086727 | 3300025936 | Bacteria | 2203 |
| 209 | Ga0207665_10015361 | 3300025939 | Bacteria | 5028 |
| 210 | Ga0207665_10053360 | 3300025939 | Bacteria | 2725 |
| 211 | Ga0207665_10085556 | 3300025939 | Bacteria | 2177 |
| 212 | Ga0207665_10118369 | 3300025939 | Bacteria | 1869 |
| 213 | Ga0207691_10184419 | 3300025940 | Bacteria | 1822 |
| 214 | Ga0207689_10170374 | 3300025942 | Bacteria | 1794 |
| 215 | Ga0207661_10152815 | 3300025944 | Bacteria | 1996 |
| 216 | Ga0207661_10189417 | 3300025944 | Bacteria | 1802 |
| 217 | Ga0207661_10198731 | 3300025944 | Bacteria | 1761 |
| 218 | Ga0207679_10068574 | 3300025945 | Bacteria | 2665 |
| 219 | Ga0207679_10113442 | 3300025945 | Bacteria | 2144 |
| 220 | Ga0207679_10186474 | 3300025945 | Bacteria | 1720 |
| 221 | Ga0207667_10255035 | 3300025949 | Bacteria | 1794 |
| 222 | Ga0207712_10156544 | 3300025961 | Bacteria | 1766 |
| 223 | Ga0207668_10166358 | 3300025972 | Bacteria | 1724 |
| 224 | Ga0207640_10133129 | 3300025981 | Bacteria | 1800 |
| 225 | Ga0207658_10106334 | 3300025986 | Bacteria | 2209 |
| 226 | Ga0207677_10106877 | 3300026023 | Bacteria | 2074 |
| 227 | Ga0207703_10183411 | 3300026035 | Bacteria | 1848 |
| 228 | Ga0207639_10156641 | 3300026041 | Bacteria | 1914 |
| 229 | Ga0207678_10000836 | 3300026067 | Bacteria | 28232 |
| 230 | Ga0207702_10174292 | 3300026078 | Bacteria | 1975 |
| 231 | Ga0207702_10176600 | 3300026078 | Bacteria | 1963 |
| 232 | Ga0207702_10228659 | 3300026078 | Bacteria | 1737 |
| 233 | Ga0207641_10183005 | 3300026088 | Bacteria | 1920 |
| 234 | Ga0207641_10187318 | 3300026088 | Bacteria | 1899 |
| 235 | Ga0207676_10182115 | 3300026095 | Bacteria | 1840 |
| 236 | Ga0207676_10186261 | 3300026095 | Bacteria | 1822 |
| 237 | Ga0207676_10205400 | 3300026095 | Bacteria | 1743 |
| 238 | Ga0207674_10008446 | 3300026116 | Bacteria | 11892 |
| 239 | Ga0207674_10218708 | 3300026116 | Bacteria | 1853 |
| 240 | Ga0207675_100108848 | 3300026118 | Bacteria | 2614 |
| 241 | Ga0207683_10012892 | 3300026121 | Bacteria | 7136 |
| 242 | Ga0207683_10220171 | 3300026121 | Bacteria | 1729 |
| 243 | Ga0207698_10209299 | 3300026142 | Bacteria | 1753 |
| 244 | Ga0209179_1005936 | 3300027512 | Bacteria | 1940 |
| 245 | Ga0268266_10220145 | 3300028379 | Bacteria | 1744 |
| 246 | Ga0268266_10236267 | 3300028379 | Bacteria | 1685 |
| 247 | Ga0268264_10186009 | 3300028381 | Bacteria | 1890 |
| 248 | Ga0268264_10209547 | 3300028381 | Bacteria | 1788 |
| 249 | Ga0307508_10154293 | 3300031616 | Bacteria | 1900 |
| 250 | Ga0373930_0008162 | 3300034816 | Bacteria | 1827 |
| 251 | Ga0373926_0010757 | 3300035083 | Bacteria | 3071 |
| 252 | Ga0373926_0027272 | 3300035083 | Bacteria | 2000 |
| 253 | Ga0373926_0033082 | 3300035083 | Bacteria | 1826 |
| 254 | Ga0373926_0033469 | 3300035083 | Bacteria | 1816 |
| 255 | Ga0373929_0008882 | 3300035085 | Bacteria | 1856 |
| 256 | Ga0373934_0024195 | 3300035086 | Bacteria | 2348 |
| 257 | Ga0373934_0024651 | 3300035086 | Bacteria | 2326 |
| 258 | Ga0373944_0020952 | 3300035089 | Bacteria | 1888 |
| 259 | Ga0373944_0022438 | 3300035089 | Bacteria | 1834 |
| 260 | Ga0373923_0013079 | 3300035111 | Bacteria | 3085 |
| 261 | Ga0373923_0039206 | 3300035111 | Bacteria | 1944 |
| 262 | Ga0373923_0044348 | 3300035111 | Bacteria | 1843 |
| 263 | Ga0373932_0012393 | 3300035112 | Bacteria | 2099 |
| 264 | Ga0373936_0011709 | 3300035113 | Bacteria | 3327 |
| 265 | Ga0373936_0029454 | 3300035113 | Bacteria | 2161 |
| 266 | Ga0373936_0042367 | 3300035113 | Bacteria | 1827 |
| 267 | Ga0373939_0021509 | 3300035114 | Bacteria | 1766 |
| 268 | Ga0373945_0017987 | 3300035116 | Bacteria | 2400 |
| 269 | Ga0373945_0030432 | 3300035116 | Bacteria | 1903 |
| 270 | Ga0373945_0035881 | 3300035116 | Bacteria | 1774 |
| 271 | Ga0373953_0026148 | 3300035117 | Bacteria | 2234 |
| 272 | Ga0373953_0026761 | 3300035117 | Bacteria | 2211 |
| 273 | Ga0373954_0037981 | 3300035118 | Bacteria | 2238 |
| 274 | Ga0373954_0042038 | 3300035118 | Bacteria | 2131 |
| 275 | Ga0373954_0045698 | 3300035118 | Bacteria | 2046 |
| 276 | Ga0373956_0023944 | 3300035119 | Bacteria | 2625 |
| 277 | Ga0373956_0031899 | 3300035119 | Bacteria | 2310 |
| 278 | Ga0373956_0057423 | 3300035119 | Bacteria | 1758 |
| 279 | Ga0373956_0057631 | 3300035119 | Bacteria | 1755 |
| 280 | Ga0373957_0020105 | 3300035120 | Bacteria | 2356 |
| 281 | Ga0373957_0027840 | 3300035120 | Bacteria | 2055 |
| 282 | Ga0373960_0018542 | 3300035121 | Bacteria | 1816 |
| 283 | Ga0373943_0024211 | 3300035170 | Bacteria | 2829 |
| 284 | Ga0373943_0034446 | 3300035170 | Bacteria | 2415 |
| 285 | Ga0373943_0063998 | 3300035170 | Bacteria | 1845 |
| 286 | Ga0373943_0124420 | 3300035170 | Bacteria | 1373 |
| 287 | Ga0373946_0015927 | 3300035171 | Bacteria | 2858 |
| 288 | Ga0373946_0032099 | 3300035171 | Bacteria | 2107 |
| 289 | Ga0373946_0042964 | 3300035171 | Bacteria | 1860 |
| 290 | Ga0373946_0058106 | 3300035171 | Bacteria | 1637 |
| 291 | Ga0373955_0016758 | 3300035172 | Bacteria | 3611 |
| 292 | Ga0373955_0049802 | 3300035172 | Bacteria | 2275 |
| 293 | Ga0373961_0014643 | 3300035241 | Bacteria | 1994 |
| 294 | Ga0373962_0015499 | 3300035242 | Bacteria | 1955 |
| 295 | Ga0373924_0022969 | 3300035410 | Bacteria | 2441 |
| 296 | Ga0373924_0035225 | 3300035410 | Bacteria | 2029 |
| 297 | Ga0373924_0048693 | 3300035410 | Bacteria | 1751 |
| 298 | Ga0373924_0078622 | 3300035410 | Bacteria | 1400 |
| 299 | Ga0373931_0081446 | 3300035691 | Bacteria | 1787 |
| 300 | Ga0373931_0144901 | 3300035691 | Bacteria | 1379 |
| 301 | Ga0373935_0050731 | 3300035692 | Bacteria | 2634 |
| 302 | Ga0373935_0064580 | 3300035692 | Bacteria | 2347 |
| 303 | Ga0373935_0079983 | 3300035692 | Bacteria | 2122 |
| 304 | Ga0373935_0097195 | 3300035692 | Bacteria | 1936 |
| 305 | Ga0373935_0120618 | 3300035692 | Bacteria | 1751 |
| 306 | Ga0373935_0123455 | 3300035692 | Bacteria | 1732 |
| 307 | Ga0373927_0043339 | 3300035695 | Bacteria | 2913 |
| 308 | Ga0373927_0105106 | 3300035695 | Bacteria | 1838 |
| 309 | Ga0373927_0118643 | 3300035695 | Bacteria | 1726 |
| 310 | Ga0373927_0159364 | 3300035695 | Bacteria | 1478 |
| 311 | Ga0373933_0054797 | 3300035724 | Bacteria | 2390 |
| 312 | Ga0373933_0071955 | 3300035724 | Bacteria | 2105 |
| 313 | Ga0373933_0110645 | 3300035724 | Bacteria | 1713 |
| 314 | Ga0373947_0011150 | 3300035725 | Bacteria | 5161 |
| 315 | Ga0373947_0046800 | 3300035725 | Bacteria | 2591 |
| 316 | Ga0373947_0059541 | 3300035725 | Bacteria | 2315 |
| 317 | Ga0373947_0062167 | 3300035725 | Bacteria | 2271 |
| 318 | Ga0373947_0077318 | 3300035725 | Bacteria | 2052 |
| 319 | Ga0373947_0109008 | 3300035725 | Bacteria | 1747 |
| 320 | Ga0373937_0095823 | 3300036401 | Bacteria | 2751 |
| 321 | Ga0373937_0140717 | 3300036401 | Bacteria | 2257 |
| 322 | Ga0373937_0192900 | 3300036401 | Bacteria | 1914 |
| 323 | Ga0373937_0200362 | 3300036401 | Bacteria | 1876 |
| 324 | Ga0373937_0232931 | 3300036401 | Bacteria | 1734 |
| 325 | Ga0373937_0262040 | 3300036401 | Bacteria | 1630 |
| 326 | Ga0373925_0029089 | 3300037068 | Bacteria | 4053 |
| 327 | Ga0373925_0058538 | 3300037068 | Bacteria | 2889 |
| 328 | Ga0373925_0071015 | 3300037068 | Bacteria | 2632 |
| 329 | Ga0373925_0109995 | 3300037068 | Bacteria | 2127 |
| 330 | Ga0373925_0142241 | 3300037068 | Bacteria | 1878 |
| 331 | Ga0373925_0147240 | 3300037068 | Bacteria | 1846 |
| 332 | Ga0373925_0153547 | 3300037068 | Bacteria | 1809 |
| 333 | Ga0373925_0163852 | 3300037068 | Bacteria | 1752 |
| 334 | Ga0436364_0202490 | 3300037853 | Bacteria | 2081 |
| 335 | Ga0436364_0206840 | 3300037853 | Bacteria | 3862 |
| 336 | Ga0436364_0448425 | 3300037853 | Bacteria | 2293 |
| 337 | Ga0436362_0587610 | 3300039453 | Bacteria | 2038 |
| 338 | Ga0466959_0101895 | 3300045049 | Bacteria | 2055 |
| 339 | Ga0466967_0289022 | 3300045976 | Bacteria | 1574 |
| 340 | Ga0495592_0006679 | 3300046454 | Bacteria | 8598 |
| 341 | Ga0495592_0100540 | 3300046454 | Bacteria | 2061 |
| 342 | Ga0495592_0111400 | 3300046454 | Bacteria | 1936 |
| 343 | Ga0495592_0120691 | 3300046454 | Bacteria | 1844 |
| 344 | Ga0495592_0126164 | 3300046454 | Bacteria | 1795 |
| 345 | Ga0495603_0086375 | 3300046455 | Bacteria | 1836 |
| 346 | Ga0495603_0088627 | 3300046455 | Bacteria | 1810 |
| 347 | Ga0495629_0032964 | 3300046459 | Bacteria | 3665 |
| 348 | Ga0495629_0108260 | 3300046459 | Bacteria | 1938 |
| 349 | Ga0495641_0054044 | 3300046461 | Bacteria | 1825 |
| 350 | Ga0495641_0055501 | 3300046461 | Bacteria | 1798 |
| 351 | Ga0495651_0068655 | 3300046462 | Bacteria | 2701 |
| 352 | Ga0495651_0079054 | 3300046462 | Bacteria | 2486 |
| 353 | Ga0495651_0118957 | 3300046462 | Bacteria | 1943 |
| 354 | Ga0495651_0141192 | 3300046462 | Bacteria | 1746 |
| 355 | Ga0495653_0023632 | 3300046463 | Bacteria | 4961 |
| 356 | Ga0495653_0094331 | 3300046463 | Bacteria | 2180 |
| 357 | Ga0495653_0132152 | 3300046463 | Bacteria | 1765 |
| 358 | Ga0495653_0148180 | 3300046463 | Bacteria | 1642 |
| 359 | Ga0495580_0130892 | 3300046472 | Bacteria | 1740 |
| 360 | Ga0495582_0030227 | 3300046473 | Bacteria | 2973 |
| 361 | Ga0495582_0081651 | 3300046473 | Bacteria | 1795 |
| 362 | Ga0495582_0116744 | 3300046473 | Bacteria | 1501 |
| 363 | Ga0495639_0064848 | 3300046475 | Bacteria | 1679 |
| 364 | Ga0495639_0084863 | 3300046475 | Bacteria | 1479 |
| 365 | Ga0495662_0004516 | 3300046476 | Bacteria | 6979 |
| 366 | Ga0495662_0052003 | 3300046476 | Bacteria | 1977 |
| 367 | Ga0495662_0052955 | 3300046476 | Bacteria | 1960 |
| 368 | Ga0495664_0022173 | 3300046477 | Bacteria | 3677 |
| 369 | Ga0495664_0048412 | 3300046477 | Bacteria | 2523 |
| 370 | Ga0495664_0048872 | 3300046477 | Bacteria | 2511 |
| 371 | Ga0495664_0087170 | 3300046477 | Bacteria | 1875 |
| 372 | Ga0495664_0087647 | 3300046477 | Bacteria | 1870 |
| 373 | Ga0495664_0099167 | 3300046477 | Bacteria | 1754 |
| 374 | Ga0495594_0007576 | 3300046499 | Bacteria | 5586 |
| 375 | Ga0495594_0061932 | 3300046499 | Bacteria | 2071 |
| 376 | Ga0495608_0019288 | 3300046511 | Bacteria | 4694 |
| 377 | Ga0495608_0046626 | 3300046511 | Bacteria | 2883 |
| 378 | Ga0495608_0078271 | 3300046511 | Bacteria | 2152 |
| 379 | Ga0495608_0115125 | 3300046511 | Bacteria | 1726 |
| 380 | Ga0495618_0062742 | 3300046514 | Bacteria | 2358 |
| 381 | Ga0495618_0076244 | 3300046514 | Bacteria | 2136 |
| 382 | Ga0495618_0096240 | 3300046514 | Bacteria | 1893 |
| 383 | Ga0495618_0098015 | 3300046514 | Bacteria | 1876 |
| 384 | Ga0495618_0116006 | 3300046514 | Bacteria | 1714 |
| 385 | Ga0495628_0088123 | 3300046516 | Bacteria | 2405 |
| 386 | Ga0495628_0092081 | 3300046516 | Bacteria | 2345 |
| 387 | Ga0495628_0115594 | 3300046516 | Bacteria | 2060 |
| 388 | Ga0495628_0141854 | 3300046516 | Bacteria | 1833 |
| 389 | Ga0495628_0145421 | 3300046516 | Bacteria | 1807 |
| 390 | Ga0495628_0146155 | 3300046516 | Bacteria | 1802 |
| 391 | Ga0495630_0066393 | 3300046517 | Bacteria | 2711 |
| 392 | Ga0495630_0098267 | 3300046517 | Bacteria | 2214 |
| 393 | Ga0495630_0143781 | 3300046517 | Bacteria | 1813 |
| 394 | Ga0495630_0159551 | 3300046517 | Bacteria | 1717 |
| 395 | Ga0495666_0010409 | 3300046526 | Bacteria | 4637 |
| 396 | Ga0495666_0041013 | 3300046526 | Bacteria | 2243 |
| 397 | Ga0495652_0091355 | 3300046529 | Bacteria | 2489 |
| 398 | Ga0495652_0093019 | 3300046529 | Bacteria | 2462 |
| 399 | Ga0495652_0097157 | 3300046529 | Bacteria | 2396 |
| 400 | Ga0495652_0141507 | 3300046529 | Bacteria | 1891 |
| 401 | Ga0495652_0151347 | 3300046529 | Bacteria | 1812 |
| 402 | Ga0495665_0053053 | 3300046531 | Bacteria | 2145 |
| 403 | Ga0495640_0020799 | 3300046533 | Bacteria | 4822 |
| 404 | Ga0495640_0074040 | 3300046533 | Bacteria | 2278 |
| 405 | Ga0495640_0090967 | 3300046533 | Bacteria | 2013 |
| 406 | Ga0495640_0118069 | 3300046533 | Bacteria | 1726 |
| 407 | Ga0495586_0086134 | 3300046535 | Bacteria | 1731 |
| 408 | Ga0495587_0013329 | 3300046536 | Bacteria | 5167 |
| 409 | Ga0495587_0043104 | 3300046536 | Bacteria | 2688 |
| 410 | Ga0495587_0072944 | 3300046536 | Bacteria | 1994 |
| 411 | Ga0495645_0046319 | 3300046543 | Bacteria | 3169 |
| 412 | Ga0495645_0074176 | 3300046543 | Bacteria | 2450 |
| 413 | Ga0495645_0119530 | 3300046543 | Bacteria | 1856 |
| 414 | Ga0495645_0127359 | 3300046543 | Bacteria | 1788 |
| 415 | Ga0495645_0134084 | 3300046543 | Bacteria | 1733 |
| 416 | Ga0495667_0047116 | 3300046559 | Bacteria | 2848 |
| 417 | Ga0495667_0075080 | 3300046559 | Bacteria | 2200 |
| 418 | Ga0495667_0086117 | 3300046559 | Bacteria | 2038 |
| 419 | Ga0495667_0192278 | 3300046559 | Bacteria | 1307 |
| 420 | Ga0495634_0040597 | 3300046642 | Bacteria | 3163 |
| 421 | Ga0495634_0042561 | 3300046642 | Bacteria | 3080 |
| 422 | Ga0495634_0095526 | 3300046642 | Bacteria | 1925 |
| 423 | Ga0495634_0106463 | 3300046642 | Bacteria | 1807 |
| 424 | Ga0495634_0107326 | 3300046642 | Bacteria | 1798 |
| 425 | Ga0495635_0074803 | 3300046663 | Bacteria | 2320 |
| 426 | Ga0495635_0109979 | 3300046663 | Bacteria | 1882 |
| 427 | Ga0495588_0052569 | 3300046674 | Bacteria | 2100 |
| 428 | Ga0495657_0008418 | 3300046675 | Bacteria | 7890 |
| 429 | Ga0495657_0019925 | 3300046675 | Bacteria | 4832 |
| 430 | Ga0495657_0027338 | 3300046675 | Bacteria | 4028 |
| 431 | Ga0495657_0063654 | 3300046675 | Bacteria | 2432 |
| 432 | Ga0495657_0081556 | 3300046675 | Bacteria | 2091 |
| 433 | Ga0495599_0032381 | 3300046678 | Bacteria | 3282 |
| 434 | Ga0495599_0041508 | 3300046678 | Bacteria | 2888 |
| 435 | Ga0495599_0057646 | 3300046678 | Bacteria | 2430 |
| 436 | Ga0495599_0064877 | 3300046678 | Bacteria | 2281 |
| 437 | Ga0495599_0097920 | 3300046678 | Bacteria | 1828 |
| 438 | Ga0495599_0101792 | 3300046678 | Bacteria | 1790 |
| 439 | Ga0495599_0170910 | 3300046678 | Bacteria | 1341 |
| 440 | Ga0495623_0071232 | 3300046679 | Bacteria | 2163 |
| 441 | Ga0495623_0098947 | 3300046679 | Bacteria | 1779 |
| 442 | Ga0495646_0057813 | 3300046680 | Bacteria | 2319 |
| 443 | Ga0495646_0069431 | 3300046680 | Bacteria | 2078 |
| 444 | Ga0495646_0078482 | 3300046680 | Bacteria | 1929 |
| 445 | Ga0495646_0083937 | 3300046680 | Bacteria | 1850 |
| 446 | Ga0495646_0084653 | 3300046680 | Bacteria | 1841 |
| 447 | Ga0495647_0028397 | 3300046681 | Bacteria | 2062 |
| 448 | Ga0495658_0018404 | 3300046683 | Bacteria | 3632 |
| 449 | Ga0495658_0079330 | 3300046683 | Bacteria | 1923 |
| 450 | Ga0495613_0077679 | 3300046689 | Bacteria | 2415 |
| 451 | Ga0495624_0093188 | 3300046690 | Bacteria | 1857 |
| 452 | Ga0495624_0120769 | 3300046690 | Bacteria | 1609 |
| 453 | Ga0495600_0005570 | 3300046809 | Bacteria | 7603 |
| 454 | Ga0495600_0038608 | 3300046809 | Bacteria | 3107 |
| 455 | Ga0495600_0079706 | 3300046809 | Bacteria | 2137 |
| 456 | Ga0495600_0103884 | 3300046809 | Bacteria | 1851 |
| 457 | Ga0495581_0057220 | 3300047315 | Bacteria | 2250 |
| 458 | Ga0495581_0084844 | 3300047315 | Bacteria | 1835 |
| 459 | Ga0495604_0111933 | 3300047317 | Bacteria | 1989 |
| 460 | Ga0495604_0122213 | 3300047317 | Bacteria | 1883 |
| 461 | Ga0495604_0126884 | 3300047317 | Bacteria | 1838 |
| 462 | Ga0495604_0134847 | 3300047317 | Bacteria | 1770 |
| 463 | Ga0495674_0024334 | 3300047319 | Bacteria | 5565 |
| 464 | Ga0495674_0054617 | 3300047319 | Bacteria | 3507 |
| 465 | Ga0495674_0093255 | 3300047319 | Bacteria | 2569 |
| 466 | Ga0495674_0110962 | 3300047319 | Bacteria | 2325 |
| 467 | Ga0495674_0111780 | 3300047319 | Bacteria | 2315 |
| 468 | Ga0495674_0116207 | 3300047319 | Bacteria | 2263 |
| 469 | Ga0495674_0168864 | 3300047319 | Bacteria | 1826 |
| 470 | Ga0495674_0169216 | 3300047319 | Bacteria | 1824 |
| 471 | Ga0495676_0105608 | 3300047321 | Bacteria | 2076 |
| 472 | Ga0495676_0131795 | 3300047321 | Bacteria | 1803 |
| 473 | Ga0495680_0018697 | 3300047322 | Bacteria | 5872 |
| 474 | Ga0495680_0075550 | 3300047322 | Bacteria | 2556 |
| 475 | Ga0495680_0126624 | 3300047322 | Bacteria | 1880 |
| 476 | Ga0495680_0129061 | 3300047322 | Bacteria | 1859 |
| 477 | Ga0495675_0086415 | 3300047444 | Bacteria | 1971 |
| 478 | Ga0495675_0093137 | 3300047444 | Bacteria | 1890 |
| 479 | Ga0495684_0046850 | 3300047471 | Bacteria | 3307 |
| 480 | Ga0495684_0098192 | 3300047471 | Bacteria | 2214 |
| 481 | Ga0495684_0134401 | 3300047471 | Bacteria | 1856 |
| 482 | Ga0495684_0138089 | 3300047471 | Bacteria | 1828 |
| 483 | Ga0495684_0142517 | 3300047471 | Bacteria | 1796 |
| 484 | Ga0495593_0057207 | 3300047673 | Bacteria | 2048 |
| 485 | Ga0495602_0095884 | 3300048088 | Bacteria | 2447 |
| 486 | Ga0495602_0130713 | 3300048088 | Bacteria | 2003 |
| 487 | Ga0495602_0133407 | 3300048088 | Bacteria | 1976 |
| 488 | Ga0495602_0149971 | 3300048088 | Bacteria | 1834 |
| 489 | Ga0495602_0184385 | 3300048088 | Bacteria | 1606 |
| 490 | Ga0495614_0047978 | 3300048089 | Bacteria | 1831 |
| 491 | Ga0496100_0125572 | 3300048903 | Bacteria | 1800 |
| 492 | Ga0496100_0132995 | 3300048903 | Bacteria | 1754 |
| 493 | Ga0496101_0126415 | 3300048904 | Bacteria | 1937 |
| 494 | Ga0496102_0171942 | 3300048905 | Bacteria | 2039 |
| 495 | Ga0496102_0178433 | 3300048905 | Bacteria | 2000 |
| 496 | Ga0496103_0045100 | 3300048906 | Bacteria | 2719 |
| 497 | Ga0496103_0105111 | 3300048906 | Bacteria | 1790 |
| 498 | Ga0496104_0136211 | 3300048907 | Bacteria | 2359 |
| 499 | Ga0496105_0046463 | 3300048908 | Bacteria | 3583 |
| 500 | Ga0496105_0066021 | 3300048908 | Bacteria | 2986 |
| 501 | Ga0496106_0158599 | 3300048909 | Bacteria | 1788 |
| 502 | Ga0496106_0161810 | 3300048909 | Bacteria | 1770 |
| 503 | Ga0496107_0146277 | 3300048910 | Bacteria | 1747 |
| 504 | Ga0496108_0142321 | 3300048911 | Bacteria | 2066 |
| 505 | Ga0496108_0184985 | 3300048911 | Bacteria | 1804 |
| 506 | Ga0496108_0200107 | 3300048911 | Bacteria | 1733 |
| 507 | Ga0496109_0204295 | 3300048912 | Bacteria | 1857 |
| 508 | Ga0496109_0212306 | 3300048912 | Bacteria | 1820 |
| 509 | Ga0496109_0222643 | 3300048912 | Bacteria | 1774 |
| 510 | Ga0496110_0117341 | 3300048913 | Bacteria | 2396 |
| 511 | Ga0496110_0177038 | 3300048913 | Bacteria | 1936 |
| 512 | Ga0496111_0104895 | 3300048914 | Bacteria | 2079 |
| 513 | Ga0496111_0199256 | 3300048914 | Bacteria | 1488 |
| 514 | Ga0496112_0150742 | 3300048915 | Bacteria | 2292 |
| 515 | Ga0496112_0174667 | 3300048915 | Bacteria | 2113 |
| 516 | Ga0496112_0183925 | 3300048915 | Bacteria | 2053 |
| 517 | Ga0496112_0213935 | 3300048915 | Bacteria | 1884 |
| 518 | Ga0496112_0221047 | 3300048915 | Bacteria | 1850 |
| 519 | Ga0496113_0076860 | 3300048916 | Bacteria | 2551 |
| 520 | Ga0496113_0150856 | 3300048916 | Bacteria | 1833 |
| 521 | Ga0496113_0171456 | 3300048916 | Bacteria | 1718 |
| 522 | Ga0496114_0171833 | 3300048917 | Bacteria | 1889 |
| 523 | Ga0496115_0167204 | 3300048918 | Bacteria | 1819 |
| 524 | Ga0496115_0188231 | 3300048918 | Bacteria | 1705 |
| 525 | nmdc:mga08x19_34303_c1 | 3300050514 | Bacteria | 3206 |
| 526 | Ga0495601_0007098 | 3300053077 | Bacteria | 6563 |
| 527 | Ga0495601_0087616 | 3300053077 | Bacteria | 2001 |
| 528 | Ga0495601_0101515 | 3300053077 | Bacteria | 1858 |
| 529 | Ga0495601_0103802 | 3300053077 | Bacteria | 1837 |
| 530 | Ga0495612_0042011 | 3300053078 | Bacteria | 1865 |
| 531 | Ga0495612_0046402 | 3300053078 | Bacteria | 1779 |
| 532 | Ga0495619_0072250 | 3300053085 | Bacteria | 2310 |
| 533 | Ga0495619_0113362 | 3300053085 | Bacteria | 1854 |
| 534 | Ga0495619_0120012 | 3300053085 | Bacteria | 1802 |
| 535 | Ga0495619_0139572 | 3300053085 | Bacteria | 1668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046473 | Ga0495582_0116744 | Ga0495582_0116744_242_1486 | 390 |
| 2 | 3300046559 | Ga0495667_0192278 | Ga0495667_0192278_49_1290 | 396 |
| 3 | 3300035410 | Ga0373924_0078622 | Ga0373924_0078622_89_1351 | 403 |
| 4 | 3300035691 | Ga0373931_0144901 | Ga0373931_0144901_80_1351 | 404 |
| 5 | 3300035695 | Ga0373927_0159364 | Ga0373927_0159364_37_1305 | 405 |
| 6 | 3300046475 | Ga0495639_0084863 | Ga0495639_0084863_59_1333 | 405 |
| 7 | 3300035170 | Ga0373943_0124420 | Ga0373943_0124420_56_1333 | 406 |
| 8 | 3300046678 | Ga0495599_0170910 | Ga0495599_0170910_33_1310 | 406 |
| 9 | 3300046455 | Ga0495603_0086375 | Ga0495603_0086375_141_1526 | 437 |
| 10 | 3300046462 | Ga0495651_0118957 | Ga0495651_0118957_187_1572 | 437 |
| 11 | 3300046642 | Ga0495634_0042561 | Ga0495634_0042561_1069_2454 | 437 |
| 12 | 3300035725 | Ga0373947_0011150 | Ga0373947_0011150_1228_2856 | 449 |
| 13 | 3300037068 | Ga0373925_0058538 | Ga0373925_0058538_27_1655 | 449 |
| 14 | 3300035089 | Ga0373944_0022438 | Ga0373944_0022438_385_1800 | 452 |
| 15 | 3300046690 | Ga0495624_0120769 | Ga0495624_0120769_120_1535 | 452 |
| 16 | 3300048914 | Ga0496111_0199256 | Ga0496111_0199256_15_1442 | 456 |
| 17 | 3300035170 | Ga0373943_0034446 | Ga0373943_0034446_576_2021 | 457 |
| 18 | 3300035171 | Ga0373946_0015927 | Ga0373946_0015927_297_1742 | 457 |
| 19 | 3300035410 | Ga0373924_0022969 | Ga0373924_0022969_111_1556 | 457 |
| 20 | 3300025928 | Ga0207700_10051606 | Ga0207700_100516063 | 459 |
| 21 | 3300025898 | Ga0207692_10079042 | Ga0207692_100790421 | 460 |
| 22 | 3300013296 | Ga0157374_10165507 | Ga0157374_101655073 | 461 |
| 23 | 3300046529 | Ga0495652_0141507 | Ga0495652_0141507_247_1830 | 461 |
| 24 | 3300046678 | Ga0495599_0032381 | Ga0495599_0032381_1824_3269 | 461 |
| 25 | 3300045976 | Ga0466967_0289022 | Ga0466967_0289022_100_1557 | 468 |
| 26 | 3300035083 | Ga0373926_0027272 | Ga0373926_0027272_178_1719 | 470 |
| 27 | 3300035170 | Ga0373943_0024211 | Ga0373943_0024211_317_1858 | 470 |
| 28 | 3300035692 | Ga0373935_0064580 | Ga0373935_0064580_124_1665 | 470 |
| 29 | 3300035695 | Ga0373927_0105106 | Ga0373927_0105106_241_1782 | 470 |
| 30 | 3300035725 | Ga0373947_0109008 | Ga0373947_0109008_43_1584 | 470 |
| 31 | 3300037068 | Ga0373925_0071015 | Ga0373925_0071015_645_2186 | 470 |
| 32 | 3300005471 | Ga0070698_100173333 | Ga0070698_1001733331 | 472 |
| 33 | 3300005983 | Ga0081540_1046336 | Ga0081540_10463362 | 472 |
| 34 | 3300046543 | Ga0495645_0127359 | Ga0495645_0127359_66_1616 | 473 |
| 35 | 3300035692 | Ga0373935_0050731 | Ga0373935_0050731_282_1835 | 476 |
| 36 | 3300025916 | Ga0207663_10127243 | Ga0207663_101272431 | 477 |
| 37 | 3300035724 | Ga0373933_0110645 | Ga0373933_0110645_125_1684 | 477 |
| 38 | 3300025898 | Ga0207692_10010452 | Ga0207692_100104524 | 478 |
| 39 | 3300025916 | Ga0207663_10026465 | Ga0207663_100264651 | 478 |
| 40 | 3300025929 | Ga0207664_10153470 | Ga0207664_101534701 | 478 |
| 41 | 3300037853 | Ga0436364_0202490 | Ga0436364_0202490_340_1899 | 478 |
| 42 | 3300005435 | Ga0070714_100043344 | Ga0070714_1000433444 | 480 |
| 43 | 3300007788 | Ga0099795_10019668 | Ga0099795_100196681 | 480 |
| 44 | 3300010159 | Ga0099796_10013799 | Ga0099796_100137992 | 480 |
| 45 | 3300027512 | Ga0209179_1005936 | Ga0209179_10059361 | 480 |
| 46 | 3300047319 | Ga0495674_0110962 | Ga0495674_0110962_166_1686 | 480 |
| 47 | 3300035089 | Ga0373944_0020952 | Ga0373944_0020952_151_1680 | 481 |
| 48 | 3300035111 | Ga0373923_0013079 | Ga0373923_0013079_93_1622 | 481 |
| 49 | 3300035113 | Ga0373936_0011709 | Ga0373936_0011709_1449_2978 | 481 |
| 50 | 3300035116 | Ga0373945_0017987 | Ga0373945_0017987_348_1877 | 481 |
| 51 | 3300035119 | Ga0373956_0057423 | Ga0373956_0057423_85_1614 | 481 |
| 52 | 3300035172 | Ga0373955_0016758 | Ga0373955_0016758_779_2308 | 481 |
| 53 | 3300035724 | Ga0373933_0054797 | Ga0373933_0054797_339_1868 | 481 |
| 54 | 3300036401 | Ga0373937_0095823 | Ga0373937_0095823_828_2357 | 481 |
| 55 | 3300037068 | Ga0373925_0147240 | Ga0373925_0147240_92_1621 | 481 |
| 56 | 3300046454 | Ga0495592_0006679 | Ga0495592_0006679_4199_5728 | 481 |
| 57 | 3300046459 | Ga0495629_0032964 | Ga0495629_0032964_232_1761 | 481 |
| 58 | 3300046461 | Ga0495641_0054044 | Ga0495641_0054044_131_1660 | 481 |
| 59 | 3300046463 | Ga0495653_0023632 | Ga0495653_0023632_2707_4236 | 481 |
| 60 | 3300046476 | Ga0495662_0052003 | Ga0495662_0052003_103_1632 | 481 |
| 61 | 3300046499 | Ga0495594_0007576 | Ga0495594_0007576_155_1684 | 481 |
| 62 | 3300046511 | Ga0495608_0046626 | Ga0495608_0046626_71_1600 | 481 |
| 63 | 3300046514 | Ga0495618_0116006 | Ga0495618_0116006_149_1678 | 481 |
| 64 | 3300046516 | Ga0495628_0088123 | Ga0495628_0088123_774_2303 | 481 |
| 65 | 3300046517 | Ga0495630_0143781 | Ga0495630_0143781_117_1646 | 481 |
| 66 | 3300046529 | Ga0495652_0097157 | Ga0495652_0097157_473_2002 | 481 |
| 67 | 3300046533 | Ga0495640_0090967 | Ga0495640_0090967_135_1664 | 481 |
| 68 | 3300046536 | Ga0495587_0013329 | Ga0495587_0013329_70_1599 | 481 |
| 69 | 3300046543 | Ga0495645_0074176 | Ga0495645_0074176_548_2077 | 481 |
| 70 | 3300046559 | Ga0495667_0075080 | Ga0495667_0075080_124_1653 | 481 |
| 71 | 3300046675 | Ga0495657_0081556 | Ga0495657_0081556_104_1633 | 481 |
| 72 | 3300046678 | Ga0495599_0041508 | Ga0495599_0041508_618_2147 | 481 |
| 73 | 3300046680 | Ga0495646_0069431 | Ga0495646_0069431_104_1633 | 481 |
| 74 | 3300046683 | Ga0495658_0018404 | Ga0495658_0018404_164_1693 | 481 |
| 75 | 3300046809 | Ga0495600_0038608 | Ga0495600_0038608_114_1643 | 481 |
| 76 | 3300047315 | Ga0495581_0084844 | Ga0495581_0084844_172_1701 | 481 |
| 77 | 3300047317 | Ga0495604_0134847 | Ga0495604_0134847_202_1731 | 481 |
| 78 | 3300047319 | Ga0495674_0093255 | Ga0495674_0093255_395_1924 | 481 |
| 79 | 3300047321 | Ga0495676_0105608 | Ga0495676_0105608_506_2035 | 481 |
| 80 | 3300047322 | Ga0495680_0075550 | Ga0495680_0075550_488_2017 | 481 |
| 81 | 3300047471 | Ga0495684_0142517 | Ga0495684_0142517_135_1664 | 481 |
| 82 | 3300047673 | Ga0495593_0057207 | Ga0495593_0057207_494_2023 | 481 |
| 83 | 3300048088 | Ga0495602_0130713 | Ga0495602_0130713_120_1649 | 481 |
| 84 | 3300053077 | Ga0495601_0007098 | Ga0495601_0007098_529_2058 | 481 |
| 85 | 3300053078 | Ga0495612_0042011 | Ga0495612_0042011_246_1775 | 481 |
| 86 | 3300053085 | Ga0495619_0072250 | Ga0495619_0072250_136_1665 | 481 |
| 87 | 3300036401 | Ga0373937_0192900 | Ga0373937_0192900_230_1777 | 482 |
| 88 | 3300036401 | Ga0373937_0262040 | Ga0373937_0262040_24_1523 | 482 |
| 89 | 3300006175 | Ga0070712_100087501 | Ga0070712_1000875011 | 483 |
| 90 | 3300010159 | Ga0099796_10025196 | Ga0099796_100251961 | 484 |
| 91 | 3300005536 | Ga0070697_100163065 | Ga0070697_1001630651 | 485 |
| 92 | 3300035171 | Ga0373946_0058106 | Ga0373946_0058106_103_1617 | 485 |
| 93 | 3300037853 | Ga0436364_0448425 | Ga0436364_0448425_455_2044 | 485 |
| 94 | 3300005436 | Ga0070713_100116027 | Ga0070713_1001160272 | 488 |
| 95 | 3300005471 | Ga0070698_100219434 | Ga0070698_1002194341 | 488 |
| 96 | 3300035695 | Ga0373927_0043339 | Ga0373927_0043339_333_1880 | 488 |
| 97 | 3300037068 | Ga0373925_0029089 | Ga0373925_0029089_1151_2698 | 488 |
| 98 | 3300005435 | Ga0070714_100208004 | Ga0070714_1002080041 | 489 |
| 99 | 3300025898 | Ga0207692_10078255 | Ga0207692_100782551 | 489 |
| 100 | 3300035086 | Ga0373934_0024651 | Ga0373934_0024651_647_2197 | 490 |
| 101 | 3300035111 | Ga0373923_0039206 | Ga0373923_0039206_99_1649 | 490 |
| 102 | 3300035116 | Ga0373945_0030432 | Ga0373945_0030432_226_1776 | 490 |
| 103 | 3300035118 | Ga0373954_0037981 | Ga0373954_0037981_514_2064 | 490 |
| 104 | 3300035119 | Ga0373956_0057631 | Ga0373956_0057631_64_1614 | 490 |
| 105 | 3300035120 | Ga0373957_0027840 | Ga0373957_0027840_456_2006 | 490 |
| 106 | 3300035410 | Ga0373924_0035225 | Ga0373924_0035225_86_1636 | 490 |
| 107 | 3300035692 | Ga0373935_0120618 | Ga0373935_0120618_134_1684 | 490 |
| 108 | 3300035725 | Ga0373947_0062167 | Ga0373947_0062167_290_1840 | 490 |
| 109 | 3300036401 | Ga0373937_0232931 | Ga0373937_0232931_28_1578 | 490 |
| 110 | 3300037068 | Ga0373925_0163852 | Ga0373925_0163852_145_1695 | 490 |
| 111 | 3300046454 | Ga0495592_0120691 | Ga0495592_0120691_139_1689 | 490 |
| 112 | 3300046459 | Ga0495629_0108260 | Ga0495629_0108260_358_1908 | 490 |
| 113 | 3300046462 | Ga0495651_0068655 | Ga0495651_0068655_768_2318 | 490 |
| 114 | 3300046473 | Ga0495582_0030227 | Ga0495582_0030227_774_2324 | 490 |
| 115 | 3300046477 | Ga0495664_0048872 | Ga0495664_0048872_845_2395 | 490 |
| 116 | 3300046511 | Ga0495608_0019288 | Ga0495608_0019288_147_1697 | 490 |
| 117 | 3300046514 | Ga0495618_0062742 | Ga0495618_0062742_209_1759 | 490 |
| 118 | 3300046516 | Ga0495628_0092081 | Ga0495628_0092081_152_1702 | 490 |
| 119 | 3300046517 | Ga0495630_0066393 | Ga0495630_0066393_1031_2581 | 490 |
| 120 | 3300046526 | Ga0495666_0041013 | Ga0495666_0041013_537_2087 | 490 |
| 121 | 3300046531 | Ga0495665_0053053 | Ga0495665_0053053_126_1676 | 490 |
| 122 | 3300046533 | Ga0495640_0020799 | Ga0495640_0020799_400_1950 | 490 |
| 123 | 3300046536 | Ga0495587_0072944 | Ga0495587_0072944_287_1837 | 490 |
| 124 | 3300046559 | Ga0495667_0047116 | Ga0495667_0047116_732_2282 | 490 |
| 125 | 3300046642 | Ga0495634_0040597 | Ga0495634_0040597_721_2271 | 490 |
| 126 | 3300046675 | Ga0495657_0008418 | Ga0495657_0008418_4219_5769 | 490 |
| 127 | 3300046678 | Ga0495599_0064877 | Ga0495599_0064877_314_1864 | 490 |
| 128 | 3300046679 | Ga0495623_0098947 | Ga0495623_0098947_188_1738 | 490 |
| 129 | 3300046680 | Ga0495646_0078482 | Ga0495646_0078482_124_1674 | 490 |
| 130 | 3300046683 | Ga0495658_0079330 | Ga0495658_0079330_175_1725 | 490 |
| 131 | 3300046689 | Ga0495613_0077679 | Ga0495613_0077679_377_1927 | 490 |
| 132 | 3300046809 | Ga0495600_0005570 | Ga0495600_0005570_1588_3138 | 490 |
| 133 | 3300047315 | Ga0495581_0057220 | Ga0495581_0057220_609_2159 | 490 |
| 134 | 3300047317 | Ga0495604_0126884 | Ga0495604_0126884_99_1649 | 490 |
| 135 | 3300047319 | Ga0495674_0054617 | Ga0495674_0054617_1625_3175 | 490 |
| 136 | 3300047471 | Ga0495684_0138089 | Ga0495684_0138089_210_1760 | 490 |
| 137 | 3300048088 | Ga0495602_0133407 | Ga0495602_0133407_368_1918 | 490 |
| 138 | 3300053085 | Ga0495619_0139572 | Ga0495619_0139572_67_1617 | 490 |
| 139 | 3300005434 | Ga0070709_10127544 | Ga0070709_101275441 | 491 |
| 140 | 3300005435 | Ga0070714_100182083 | Ga0070714_1001820831 | 491 |
| 141 | 3300005436 | Ga0070713_100182478 | Ga0070713_1001824781 | 491 |
| 142 | 3300005437 | Ga0070710_10078295 | Ga0070710_100782951 | 491 |
| 143 | 3300025898 | Ga0207692_10053680 | Ga0207692_100536801 | 491 |
| 144 | 3300025906 | Ga0207699_10101491 | Ga0207699_101014911 | 491 |
| 145 | 3300025915 | Ga0207693_10142428 | Ga0207693_101424281 | 491 |
| 146 | 3300025928 | Ga0207700_10187970 | Ga0207700_101879701 | 491 |
| 147 | 3300025929 | Ga0207664_10179051 | Ga0207664_101790511 | 491 |
| 148 | 3300005435 | Ga0070714_100179203 | Ga0070714_1001792032 | 493 |
| 149 | 3300025944 | Ga0207661_10152815 | Ga0207661_101528151 | 493 |
| 150 | 3300035691 | Ga0373931_0081446 | Ga0373931_0081446_162_1733 | 493 |
| 151 | 3300048911 | Ga0496108_0200107 | Ga0496108_0200107_35_1606 | 493 |
| 152 | 3300048912 | Ga0496109_0204295 | Ga0496109_0204295_89_1660 | 493 |
| 153 | 3300048914 | Ga0496111_0104895 | Ga0496111_0104895_146_1696 | 493 |
| 154 | 3300048915 | Ga0496112_0150742 | Ga0496112_0150742_124_1695 | 493 |
| 155 | 3300048916 | Ga0496113_0150856 | Ga0496113_0150856_191_1762 | 493 |
| 156 | 3300005530 | Ga0070679_100121408 | Ga0070679_1001214081 | 494 |
| 157 | 3300005535 | Ga0070684_100105821 | Ga0070684_1001058212 | 494 |
| 158 | 3300005564 | Ga0070664_100126234 | Ga0070664_1001262341 | 494 |
| 159 | 3300005614 | Ga0068856_100240832 | Ga0068856_1002408321 | 494 |
| 160 | 3300005618 | Ga0068864_100164047 | Ga0068864_1001640471 | 494 |
| 161 | 3300005841 | Ga0068863_100063758 | Ga0068863_1000637581 | 494 |
| 162 | 3300006173 | Ga0070716_100089035 | Ga0070716_1000890351 | 494 |
| 163 | 3300006175 | Ga0070712_100090221 | Ga0070712_1000902212 | 494 |
| 164 | 3300006914 | Ga0075436_100130705 | Ga0075436_1001307051 | 494 |
| 165 | 3300014325 | Ga0163163_10148313 | Ga0163163_101483131 | 494 |
| 166 | 3300025898 | Ga0207692_10033275 | Ga0207692_100332751 | 494 |
| 167 | 3300025906 | Ga0207699_10111477 | Ga0207699_101114771 | 494 |
| 168 | 3300025915 | Ga0207693_10050159 | Ga0207693_100501593 | 494 |
| 169 | 3300025920 | Ga0207649_10130032 | Ga0207649_101300321 | 494 |
| 170 | 3300025928 | Ga0207700_10040114 | Ga0207700_100401143 | 494 |
| 171 | 3300025929 | Ga0207664_10191888 | Ga0207664_101918881 | 494 |
| 172 | 3300025939 | Ga0207665_10053360 | Ga0207665_100533602 | 494 |
| 173 | 3300025944 | Ga0207661_10189417 | Ga0207661_101894171 | 494 |
| 174 | 3300025945 | Ga0207679_10186474 | Ga0207679_101864741 | 494 |
| 175 | 3300026078 | Ga0207702_10174292 | Ga0207702_101742921 | 494 |
| 176 | 3300026095 | Ga0207676_10182115 | Ga0207676_101821151 | 494 |
| 177 | 3300026116 | Ga0207674_10218708 | Ga0207674_102187081 | 494 |
| 178 | 3300048907 | Ga0496104_0136211 | Ga0496104_0136211_703_2256 | 494 |
| 179 | 3300048908 | Ga0496105_0066021 | Ga0496105_0066021_800_2353 | 494 |
| 180 | 3300048911 | Ga0496108_0142321 | Ga0496108_0142321_306_1859 | 494 |
| 181 | 3300048912 | Ga0496109_0212306 | Ga0496109_0212306_231_1784 | 494 |
| 182 | 3300048913 | Ga0496110_0117341 | Ga0496110_0117341_301_1854 | 494 |
| 183 | 3300048915 | Ga0496112_0183925 | Ga0496112_0183925_245_1798 | 494 |
| 184 | 3300048916 | Ga0496113_0076860 | Ga0496113_0076860_645_2198 | 494 |
| 185 | 3300048917 | Ga0496114_0171833 | Ga0496114_0171833_174_1727 | 494 |
| 186 | 3300050514 | nmdc:mga08x19_34303_c1 | nmdc:mga08x19_34303_c1_178_1731 | 494 |
| 187 | 3300005355 | Ga0070671_100142515 | Ga0070671_1001425151 | 495 |
| 188 | 3300005434 | Ga0070709_10082082 | Ga0070709_100820821 | 495 |
| 189 | 3300005435 | Ga0070714_100185032 | Ga0070714_1001850321 | 495 |
| 190 | 3300005439 | Ga0070711_100084214 | Ga0070711_1000842141 | 495 |
| 191 | 3300005456 | Ga0070678_100069852 | Ga0070678_1000698521 | 495 |
| 192 | 3300005547 | Ga0070693_100029303 | Ga0070693_1000293032 | 495 |
| 193 | 3300005577 | Ga0068857_100124283 | Ga0068857_1001242832 | 495 |
| 194 | 3300005614 | Ga0068856_100222624 | Ga0068856_1002226241 | 495 |
| 195 | 3300006028 | Ga0070717_10132505 | Ga0070717_101325052 | 495 |
| 196 | 3300006871 | Ga0075434_100227666 | Ga0075434_1002276661 | 495 |
| 197 | 3300009177 | Ga0105248_10281820 | Ga0105248_102818201 | 495 |
| 198 | 3300009545 | Ga0105237_10181343 | Ga0105237_101813431 | 495 |
| 199 | 3300009551 | Ga0105238_10211052 | Ga0105238_102110522 | 495 |
| 200 | 3300011119 | Ga0105246_10062971 | Ga0105246_100629711 | 495 |
| 201 | 3300013105 | Ga0157369_10266269 | Ga0157369_102662691 | 495 |
| 202 | 3300013307 | Ga0157372_10313445 | Ga0157372_103134451 | 495 |
| 203 | 3300013308 | Ga0157375_10235823 | Ga0157375_102358232 | 495 |
| 204 | 3300025906 | Ga0207699_10114514 | Ga0207699_101145141 | 495 |
| 205 | 3300025914 | Ga0207671_10139403 | Ga0207671_101394031 | 495 |
| 206 | 3300025915 | Ga0207693_10104813 | Ga0207693_101048131 | 495 |
| 207 | 3300025916 | Ga0207663_10103093 | Ga0207663_101030931 | 495 |
| 208 | 3300025923 | Ga0207681_10122196 | Ga0207681_101221961 | 495 |
| 209 | 3300025929 | Ga0207664_10196000 | Ga0207664_101960001 | 495 |
| 210 | 3300026078 | Ga0207702_10228659 | Ga0207702_102286591 | 495 |
| 211 | 3300026121 | Ga0207683_10220171 | Ga0207683_102201711 | 495 |
| 212 | 3300028379 | Ga0268266_10236267 | Ga0268266_102362671 | 495 |
| 213 | 3300028381 | Ga0268264_10209547 | Ga0268264_102095471 | 495 |
| 214 | 3300031616 | Ga0307508_10154293 | Ga0307508_101542931 | 495 |
| 215 | 3300048903 | Ga0496100_0132995 | Ga0496100_0132995_124_1671 | 495 |
| 216 | 3300048905 | Ga0496102_0171942 | Ga0496102_0171942_389_1936 | 495 |
| 217 | 3300048906 | Ga0496103_0105111 | Ga0496103_0105111_154_1701 | 495 |
| 218 | 3300048909 | Ga0496106_0158599 | Ga0496106_0158599_218_1765 | 495 |
| 219 | 3300048911 | Ga0496108_0184985 | Ga0496108_0184985_226_1773 | 495 |
| 220 | 3300048912 | Ga0496109_0222643 | Ga0496109_0222643_87_1634 | 495 |
| 221 | 3300048915 | Ga0496112_0213935 | Ga0496112_0213935_133_1680 | 495 |
| 222 | 3300005434 | Ga0070709_10070019 | Ga0070709_100700192 | 496 |
| 223 | 3300006028 | Ga0070717_10178424 | Ga0070717_101784242 | 496 |
| 224 | 3300006173 | Ga0070716_100106763 | Ga0070716_1001067631 | 496 |
| 225 | 3300025898 | Ga0207692_10073546 | Ga0207692_100735461 | 496 |
| 226 | 3300025910 | Ga0207684_10068842 | Ga0207684_100688422 | 496 |
| 227 | 3300025915 | Ga0207693_10065552 | Ga0207693_100655521 | 496 |
| 228 | 3300025916 | Ga0207663_10094592 | Ga0207663_100945921 | 496 |
| 229 | 3300025922 | Ga0207646_10143357 | Ga0207646_101433571 | 496 |
| 230 | 3300025929 | Ga0207664_10195034 | Ga0207664_101950341 | 496 |
| 231 | 3300025939 | Ga0207665_10015361 | Ga0207665_100153614 | 496 |
| 232 | 3300025945 | Ga0207679_10113442 | Ga0207679_101134421 | 496 |
| 233 | 3300048918 | Ga0496115_0167204 | Ga0496115_0167204_159_1706 | 496 |
| 234 | 3300005340 | Ga0070689_100157582 | Ga0070689_1001575821 | 497 |
| 235 | 3300007076 | Ga0075435_100160082 | Ga0075435_1001600821 | 497 |
| 236 | 3300007788 | Ga0099795_10002225 | Ga0099795_100022252 | 497 |
| 237 | 3300046454 | Ga0495592_0126164 | Ga0495592_0126164_129_1673 | 497 |
| 238 | 3300046463 | Ga0495653_0148180 | Ga0495653_0148180_57_1601 | 497 |
| 239 | 3300046477 | Ga0495664_0087170 | Ga0495664_0087170_124_1668 | 497 |
| 240 | 3300046516 | Ga0495628_0146155 | Ga0495628_0146155_66_1610 | 497 |
| 241 | 3300046517 | Ga0495630_0159551 | Ga0495630_0159551_125_1669 | 497 |
| 242 | 3300046675 | Ga0495657_0019925 | Ga0495657_0019925_3048_4592 | 497 |
| 243 | 3300046678 | Ga0495599_0101792 | Ga0495599_0101792_84_1628 | 497 |
| 244 | 3300046680 | Ga0495646_0084653 | Ga0495646_0084653_170_1714 | 497 |
| 245 | 3300047319 | Ga0495674_0169216 | Ga0495674_0169216_103_1647 | 497 |
| 246 | 3300047322 | Ga0495680_0129061 | Ga0495680_0129061_123_1667 | 497 |
| 247 | 3300005327 | Ga0070658_10157086 | Ga0070658_101570862 | 498 |
| 248 | 3300005329 | Ga0070683_100119995 | Ga0070683_1001199952 | 498 |
| 249 | 3300005331 | Ga0070670_100121033 | Ga0070670_1001210332 | 498 |
| 250 | 3300005337 | Ga0070682_100004693 | Ga0070682_1000046934 | 498 |
| 251 | 3300005344 | Ga0070661_100015087 | Ga0070661_1000150872 | 498 |
| 252 | 3300005345 | Ga0070692_10051937 | Ga0070692_100519372 | 498 |
| 253 | 3300005347 | Ga0070668_100117151 | Ga0070668_1001171511 | 498 |
| 254 | 3300005353 | Ga0070669_100088809 | Ga0070669_1000888091 | 498 |
| 255 | 3300005354 | Ga0070675_100144094 | Ga0070675_1001440941 | 498 |
| 256 | 3300005364 | Ga0070673_100016657 | Ga0070673_1000166571 | 498 |
| 257 | 3300005366 | Ga0070659_100015663 | Ga0070659_1000156635 | 498 |
| 258 | 3300005406 | Ga0070703_10007010 | Ga0070703_100070101 | 498 |
| 259 | 3300005434 | Ga0070709_10100639 | Ga0070709_101006392 | 498 |
| 260 | 3300005436 | Ga0070713_100218202 | Ga0070713_1002182021 | 498 |
| 261 | 3300005437 | Ga0070710_10049247 | Ga0070710_100492471 | 498 |
| 262 | 3300005438 | Ga0070701_10056823 | Ga0070701_100568231 | 498 |
| 263 | 3300005439 | Ga0070711_100122748 | Ga0070711_1001227481 | 498 |
| 264 | 3300005440 | Ga0070705_100021993 | Ga0070705_1000219931 | 498 |
| 265 | 3300005444 | Ga0070694_100126720 | Ga0070694_1001267201 | 498 |
| 266 | 3300005455 | Ga0070663_100155542 | Ga0070663_1001555421 | 498 |
| 267 | 3300005456 | Ga0070678_100154265 | Ga0070678_1001542651 | 498 |
| 268 | 3300005457 | Ga0070662_100138812 | Ga0070662_1001388121 | 498 |
| 269 | 3300005466 | Ga0070685_10097537 | Ga0070685_100975371 | 498 |
| 270 | 3300005530 | Ga0070679_100153980 | Ga0070679_1001539803 | 498 |
| 271 | 3300005539 | Ga0068853_100226629 | Ga0068853_1002266291 | 498 |
| 272 | 3300005543 | Ga0070672_100042424 | Ga0070672_1000424241 | 498 |
| 273 | 3300005544 | Ga0070686_100106767 | Ga0070686_1001067671 | 498 |
| 274 | 3300005547 | Ga0070693_100070664 | Ga0070693_1000706642 | 498 |
| 275 | 3300005548 | Ga0070665_100019813 | Ga0070665_1000198136 | 498 |
| 276 | 3300005549 | Ga0070704_100028363 | Ga0070704_1000283633 | 498 |
| 277 | 3300005563 | Ga0068855_100266737 | Ga0068855_1002667371 | 498 |
| 278 | 3300005564 | Ga0070664_100155248 | Ga0070664_1001552482 | 498 |
| 279 | 3300005577 | Ga0068857_100074597 | Ga0068857_1000745972 | 498 |
| 280 | 3300005615 | Ga0070702_100048801 | Ga0070702_1000488011 | 498 |
| 281 | 3300005719 | Ga0068861_100133506 | Ga0068861_1001335062 | 498 |
| 282 | 3300005834 | Ga0068851_10064147 | Ga0068851_100641471 | 498 |
| 283 | 3300005842 | Ga0068858_100077346 | Ga0068858_1000773461 | 498 |
| 284 | 3300005843 | Ga0068860_100065438 | Ga0068860_1000654381 | 498 |
| 285 | 3300005844 | Ga0068862_100151913 | Ga0068862_1001519131 | 498 |
| 286 | 3300006028 | Ga0070717_10147730 | Ga0070717_101477301 | 498 |
| 287 | 3300006175 | Ga0070712_100112463 | Ga0070712_1001124631 | 498 |
| 288 | 3300006237 | Ga0097621_100023678 | Ga0097621_1000236784 | 498 |
| 289 | 3300006881 | Ga0068865_100049640 | Ga0068865_1000496402 | 498 |
| 290 | 3300009011 | Ga0105251_10036495 | Ga0105251_100364952 | 498 |
| 291 | 3300009093 | Ga0105240_10261642 | Ga0105240_102616421 | 498 |
| 292 | 3300009148 | Ga0105243_10070154 | Ga0105243_100701543 | 498 |
| 293 | 3300009176 | Ga0105242_10156098 | Ga0105242_101560981 | 498 |
| 294 | 3300009177 | Ga0105248_10198310 | Ga0105248_101983101 | 498 |
| 295 | 3300009545 | Ga0105237_10208985 | Ga0105237_102089851 | 498 |
| 296 | 3300009551 | Ga0105238_10084396 | Ga0105238_100843961 | 498 |
| 297 | 3300009553 | Ga0105249_10071169 | Ga0105249_100711692 | 498 |
| 298 | 3300011119 | Ga0105246_10024117 | Ga0105246_100241173 | 498 |
| 299 | 3300013100 | Ga0157373_10046053 | Ga0157373_100460533 | 498 |
| 300 | 3300013104 | Ga0157370_10104784 | Ga0157370_101047842 | 498 |
| 301 | 3300013297 | Ga0157378_10199802 | Ga0157378_101998021 | 498 |
| 302 | 3300013306 | Ga0163162_10180592 | Ga0163162_101805921 | 498 |
| 303 | 3300013307 | Ga0157372_10056525 | Ga0157372_100565254 | 498 |
| 304 | 3300013308 | Ga0157375_10212930 | Ga0157375_102129301 | 498 |
| 305 | 3300014325 | Ga0163163_10107526 | Ga0163163_101075262 | 498 |
| 306 | 3300014968 | Ga0157379_10047464 | Ga0157379_100474642 | 498 |
| 307 | 3300020070 | Ga0206356_10114388 | Ga0206356_101143882 | 498 |
| 308 | 3300020081 | Ga0206354_10651989 | Ga0206354_106519891 | 498 |
| 309 | 3300020082 | Ga0206353_10149819 | Ga0206353_101498192 | 498 |
| 310 | 3300025898 | Ga0207692_10078606 | Ga0207692_100786061 | 498 |
| 311 | 3300025898 | Ga0207692_10080984 | Ga0207692_100809841 | 498 |
| 312 | 3300025901 | Ga0207688_10008454 | Ga0207688_100084541 | 498 |
| 313 | 3300025905 | Ga0207685_10024452 | Ga0207685_100244521 | 498 |
| 314 | 3300025906 | Ga0207699_10110147 | Ga0207699_101101471 | 498 |
| 315 | 3300025906 | Ga0207699_10111902 | Ga0207699_101119021 | 498 |
| 316 | 3300025909 | Ga0207705_10111402 | Ga0207705_101114021 | 498 |
| 317 | 3300025912 | Ga0207707_10155037 | Ga0207707_101550371 | 498 |
| 318 | 3300025913 | Ga0207695_10199833 | Ga0207695_101998331 | 498 |
| 319 | 3300025914 | Ga0207671_10163895 | Ga0207671_101638951 | 498 |
| 320 | 3300025915 | Ga0207693_10059297 | Ga0207693_100592972 | 498 |
| 321 | 3300025915 | Ga0207693_10147533 | Ga0207693_101475331 | 498 |
| 322 | 3300025918 | Ga0207662_10004077 | Ga0207662_100040771 | 498 |
| 323 | 3300025919 | Ga0207657_10007429 | Ga0207657_100074295 | 498 |
| 324 | 3300025924 | Ga0207694_10171815 | Ga0207694_101718151 | 498 |
| 325 | 3300025927 | Ga0207687_10016169 | Ga0207687_100161694 | 498 |
| 326 | 3300025928 | Ga0207700_10028804 | Ga0207700_100288043 | 498 |
| 327 | 3300025928 | Ga0207700_10176395 | Ga0207700_101763952 | 498 |
| 328 | 3300025929 | Ga0207664_10099361 | Ga0207664_100993612 | 498 |
| 329 | 3300025929 | Ga0207664_10190229 | Ga0207664_101902292 | 498 |
| 330 | 3300025931 | Ga0207644_10023410 | Ga0207644_100234103 | 498 |
| 331 | 3300025932 | Ga0207690_10146170 | Ga0207690_101461701 | 498 |
| 332 | 3300025933 | Ga0207706_10118789 | Ga0207706_101187891 | 498 |
| 333 | 3300025934 | Ga0207686_10107434 | Ga0207686_101074341 | 498 |
| 334 | 3300025935 | Ga0207709_10107221 | Ga0207709_101072211 | 498 |
| 335 | 3300025936 | Ga0207670_10086727 | Ga0207670_100867272 | 498 |
| 336 | 3300025939 | Ga0207665_10085556 | Ga0207665_100855561 | 498 |
| 337 | 3300025940 | Ga0207691_10184419 | Ga0207691_101844191 | 498 |
| 338 | 3300025942 | Ga0207689_10170374 | Ga0207689_101703741 | 498 |
| 339 | 3300025944 | Ga0207661_10198731 | Ga0207661_101987311 | 498 |
| 340 | 3300025945 | Ga0207679_10068574 | Ga0207679_100685742 | 498 |
| 341 | 3300025949 | Ga0207667_10255035 | Ga0207667_102550351 | 498 |
| 342 | 3300025961 | Ga0207712_10156544 | Ga0207712_101565441 | 498 |
| 343 | 3300025972 | Ga0207668_10166358 | Ga0207668_101663581 | 498 |
| 344 | 3300025981 | Ga0207640_10133129 | Ga0207640_101331291 | 498 |
| 345 | 3300026023 | Ga0207677_10106877 | Ga0207677_101068771 | 498 |
| 346 | 3300026035 | Ga0207703_10183411 | Ga0207703_101834111 | 498 |
| 347 | 3300026041 | Ga0207639_10156641 | Ga0207639_101566411 | 498 |
| 348 | 3300026067 | Ga0207678_10000836 | Ga0207678_1000083628 | 498 |
| 349 | 3300026078 | Ga0207702_10176600 | Ga0207702_101766001 | 498 |
| 350 | 3300026088 | Ga0207641_10183005 | Ga0207641_101830051 | 498 |
| 351 | 3300026095 | Ga0207676_10205400 | Ga0207676_102054001 | 498 |
| 352 | 3300026116 | Ga0207674_10008446 | Ga0207674_1000844612 | 498 |
| 353 | 3300026118 | Ga0207675_100108848 | Ga0207675_1001088482 | 498 |
| 354 | 3300026121 | Ga0207683_10012892 | Ga0207683_100128925 | 498 |
| 355 | 3300026142 | Ga0207698_10209299 | Ga0207698_102092991 | 498 |
| 356 | 3300028379 | Ga0268266_10220145 | Ga0268266_102201451 | 498 |
| 357 | 3300028381 | Ga0268264_10186009 | Ga0268264_101860091 | 498 |
| 358 | 3300034816 | Ga0373930_0008162 | Ga0373930_0008162_137_1690 | 498 |
| 359 | 3300035085 | Ga0373929_0008882 | Ga0373929_0008882_161_1714 | 498 |
| 360 | 3300035112 | Ga0373932_0012393 | Ga0373932_0012393_79_1632 | 498 |
| 361 | 3300035114 | Ga0373939_0021509 | Ga0373939_0021509_91_1644 | 498 |
| 362 | 3300035121 | Ga0373960_0018542 | Ga0373960_0018542_211_1764 | 498 |
| 363 | 3300035241 | Ga0373961_0014643 | Ga0373961_0014643_224_1777 | 498 |
| 364 | 3300035242 | Ga0373962_0015499 | Ga0373962_0015499_329_1882 | 498 |
| 365 | 3300046477 | Ga0495664_0087647 | Ga0495664_0087647_266_1822 | 498 |
| 366 | 3300046516 | Ga0495628_0115594 | Ga0495628_0115594_162_1718 | 498 |
| 367 | 3300046529 | Ga0495652_0091355 | Ga0495652_0091355_790_2346 | 498 |
| 368 | 3300046543 | Ga0495645_0134084 | Ga0495645_0134084_120_1676 | 498 |
| 369 | 3300047321 | Ga0495676_0131795 | Ga0495676_0131795_126_1682 | 498 |
| 370 | 3300048903 | Ga0496100_0125572 | Ga0496100_0125572_88_1641 | 498 |
| 371 | 3300048904 | Ga0496101_0126415 | Ga0496101_0126415_50_1603 | 498 |
| 372 | 3300048905 | Ga0496102_0178433 | Ga0496102_0178433_385_1938 | 498 |
| 373 | 3300048906 | Ga0496103_0045100 | Ga0496103_0045100_1119_2672 | 498 |
| 374 | 3300048908 | Ga0496105_0046463 | Ga0496105_0046463_894_2447 | 498 |
| 375 | 3300048909 | Ga0496106_0161810 | Ga0496106_0161810_58_1611 | 498 |
| 376 | 3300048910 | Ga0496107_0146277 | Ga0496107_0146277_56_1609 | 498 |
| 377 | 3300048915 | Ga0496112_0174667 | Ga0496112_0174667_360_1913 | 498 |
| 378 | 3300048916 | Ga0496113_0171456 | Ga0496113_0171456_21_1574 | 498 |
| 379 | 3300048918 | Ga0496115_0188231 | Ga0496115_0188231_43_1596 | 498 |
| 380 | 3300005367 | Ga0070667_100216233 | Ga0070667_1002162331 | 499 |
| 381 | 3300005434 | Ga0070709_10017626 | Ga0070709_100176262 | 499 |
| 382 | 3300005437 | Ga0070710_10100647 | Ga0070710_101006471 | 499 |
| 383 | 3300005439 | Ga0070711_100035811 | Ga0070711_1000358114 | 499 |
| 384 | 3300005445 | Ga0070708_100101530 | Ga0070708_1001015302 | 499 |
| 385 | 3300005564 | Ga0070664_100088615 | Ga0070664_1000886151 | 499 |
| 386 | 3300005841 | Ga0068863_100118930 | Ga0068863_1001189302 | 499 |
| 387 | 3300006175 | Ga0070712_100160958 | Ga0070712_1001609581 | 499 |
| 388 | 3300025898 | Ga0207692_10008863 | Ga0207692_100088634 | 499 |
| 389 | 3300025906 | Ga0207699_10104056 | Ga0207699_101040561 | 499 |
| 390 | 3300025910 | Ga0207684_10196339 | Ga0207684_101963391 | 499 |
| 391 | 3300025915 | Ga0207693_10101185 | Ga0207693_101011851 | 499 |
| 392 | 3300025916 | Ga0207663_10085014 | Ga0207663_100850141 | 499 |
| 393 | 3300025928 | Ga0207700_10137505 | Ga0207700_101375051 | 499 |
| 394 | 3300025929 | Ga0207664_10105717 | Ga0207664_101057171 | 499 |
| 395 | 3300025929 | Ga0207664_10169746 | Ga0207664_101697461 | 499 |
| 396 | 3300025939 | Ga0207665_10118369 | Ga0207665_101183691 | 499 |
| 397 | 3300025986 | Ga0207658_10106334 | Ga0207658_101063341 | 499 |
| 398 | 3300026088 | Ga0207641_10187318 | Ga0207641_101873181 | 499 |
| 399 | 3300026095 | Ga0207676_10186261 | Ga0207676_101862611 | 499 |
| 400 | 3300035083 | Ga0373926_0033082 | Ga0373926_0033082_157_1713 | 499 |
| 401 | 3300035083 | Ga0373926_0033469 | Ga0373926_0033469_112_1668 | 499 |
| 402 | 3300035113 | Ga0373936_0042367 | Ga0373936_0042367_161_1717 | 499 |
| 403 | 3300035116 | Ga0373945_0035881 | Ga0373945_0035881_26_1582 | 499 |
| 404 | 3300035170 | Ga0373943_0063998 | Ga0373943_0063998_191_1747 | 499 |
| 405 | 3300035171 | Ga0373946_0042964 | Ga0373946_0042964_97_1653 | 499 |
| 406 | 3300035692 | Ga0373935_0123455 | Ga0373935_0123455_94_1650 | 499 |
| 407 | 3300035695 | Ga0373927_0118643 | Ga0373927_0118643_121_1677 | 499 |
| 408 | 3300035725 | Ga0373947_0077318 | Ga0373947_0077318_392_1948 | 499 |
| 409 | 3300036401 | Ga0373937_0200362 | Ga0373937_0200362_97_1653 | 499 |
| 410 | 3300037068 | Ga0373925_0142241 | Ga0373925_0142241_105_1661 | 499 |
| 411 | 3300037068 | Ga0373925_0153547 | Ga0373925_0153547_190_1746 | 499 |
| 412 | 3300045049 | Ga0466959_0101895 | Ga0466959_0101895_192_1742 | 499 |
| 413 | 3300046454 | Ga0495592_0111400 | Ga0495592_0111400_237_1793 | 499 |
| 414 | 3300046455 | Ga0495603_0088627 | Ga0495603_0088627_64_1620 | 499 |
| 415 | 3300046461 | Ga0495641_0055501 | Ga0495641_0055501_104_1660 | 499 |
| 416 | 3300046462 | Ga0495651_0141192 | Ga0495651_0141192_41_1597 | 499 |
| 417 | 3300046463 | Ga0495653_0132152 | Ga0495653_0132152_170_1726 | 499 |
| 418 | 3300046472 | Ga0495580_0130892 | Ga0495580_0130892_60_1616 | 499 |
| 419 | 3300046475 | Ga0495639_0064848 | Ga0495639_0064848_90_1646 | 499 |
| 420 | 3300046476 | Ga0495662_0004516 | Ga0495662_0004516_5248_6804 | 499 |
| 421 | 3300046477 | Ga0495664_0022173 | Ga0495664_0022173_137_1693 | 499 |
| 422 | 3300046499 | Ga0495594_0061932 | Ga0495594_0061932_389_1945 | 499 |
| 423 | 3300046511 | Ga0495608_0115125 | Ga0495608_0115125_43_1599 | 499 |
| 424 | 3300046514 | Ga0495618_0096240 | Ga0495618_0096240_107_1663 | 499 |
| 425 | 3300046516 | Ga0495628_0145421 | Ga0495628_0145421_171_1727 | 499 |
| 426 | 3300046517 | Ga0495630_0098267 | Ga0495630_0098267_607_2163 | 499 |
| 427 | 3300046526 | Ga0495666_0010409 | Ga0495666_0010409_52_1608 | 499 |
| 428 | 3300046529 | Ga0495652_0151347 | Ga0495652_0151347_125_1681 | 499 |
| 429 | 3300046533 | Ga0495640_0118069 | Ga0495640_0118069_102_1658 | 499 |
| 430 | 3300046535 | Ga0495586_0086134 | Ga0495586_0086134_42_1598 | 499 |
| 431 | 3300046543 | Ga0495645_0119530 | Ga0495645_0119530_211_1767 | 499 |
| 432 | 3300046642 | Ga0495634_0095526 | Ga0495634_0095526_152_1708 | 499 |
| 433 | 3300046642 | Ga0495634_0106463 | Ga0495634_0106463_138_1688 | 499 |
| 434 | 3300046663 | Ga0495635_0109979 | Ga0495635_0109979_218_1774 | 499 |
| 435 | 3300046674 | Ga0495588_0052569 | Ga0495588_0052569_359_1915 | 499 |
| 436 | 3300046675 | Ga0495657_0027338 | Ga0495657_0027338_2305_3861 | 499 |
| 437 | 3300046678 | Ga0495599_0097920 | Ga0495599_0097920_232_1788 | 499 |
| 438 | 3300046680 | Ga0495646_0083937 | Ga0495646_0083937_186_1742 | 499 |
| 439 | 3300046681 | Ga0495647_0028397 | Ga0495647_0028397_465_2021 | 499 |
| 440 | 3300046809 | Ga0495600_0103884 | Ga0495600_0103884_245_1801 | 499 |
| 441 | 3300047317 | Ga0495604_0122213 | Ga0495604_0122213_289_1845 | 499 |
| 442 | 3300047319 | Ga0495674_0168864 | Ga0495674_0168864_82_1638 | 499 |
| 443 | 3300047322 | Ga0495680_0126624 | Ga0495680_0126624_110_1666 | 499 |
| 444 | 3300047444 | Ga0495675_0093137 | Ga0495675_0093137_117_1673 | 499 |
| 445 | 3300047471 | Ga0495684_0134401 | Ga0495684_0134401_219_1775 | 499 |
| 446 | 3300048088 | Ga0495602_0184385 | Ga0495602_0184385_13_1569 | 499 |
| 447 | 3300048089 | Ga0495614_0047978 | Ga0495614_0047978_174_1730 | 499 |
| 448 | 3300048913 | Ga0496110_0177038 | Ga0496110_0177038_277_1854 | 499 |
| 449 | 3300048915 | Ga0496112_0221047 | Ga0496112_0221047_86_1663 | 499 |
| 450 | 3300053077 | Ga0495601_0087616 | Ga0495601_0087616_209_1765 | 499 |
| 451 | 3300053085 | Ga0495619_0120012 | Ga0495619_0120012_65_1621 | 499 |
| 452 | 3300035083 | Ga0373926_0010757 | Ga0373926_0010757_1368_2927 | 500 |
| 453 | 3300035086 | Ga0373934_0024195 | Ga0373934_0024195_608_2173 | 500 |
| 454 | 3300035111 | Ga0373923_0044348 | Ga0373923_0044348_14_1579 | 500 |
| 455 | 3300035113 | Ga0373936_0029454 | Ga0373936_0029454_231_1805 | 500 |
| 456 | 3300035117 | Ga0373953_0026148 | Ga0373953_0026148_498_2072 | 500 |
| 457 | 3300035117 | Ga0373953_0026761 | Ga0373953_0026761_390_1955 | 500 |
| 458 | 3300035118 | Ga0373954_0042038 | Ga0373954_0042038_306_1871 | 500 |
| 459 | 3300035118 | Ga0373954_0045698 | Ga0373954_0045698_132_1706 | 500 |
| 460 | 3300035119 | Ga0373956_0023944 | Ga0373956_0023944_878_2443 | 500 |
| 461 | 3300035119 | Ga0373956_0031899 | Ga0373956_0031899_50_1624 | 500 |
| 462 | 3300035120 | Ga0373957_0020105 | Ga0373957_0020105_330_1904 | 500 |
| 463 | 3300035172 | Ga0373955_0049802 | Ga0373955_0049802_339_1913 | 500 |
| 464 | 3300035410 | Ga0373924_0048693 | Ga0373924_0048693_148_1713 | 500 |
| 465 | 3300035692 | Ga0373935_0079983 | Ga0373935_0079983_514_2073 | 500 |
| 466 | 3300035692 | Ga0373935_0097195 | Ga0373935_0097195_164_1738 | 500 |
| 467 | 3300035724 | Ga0373933_0071955 | Ga0373933_0071955_373_1947 | 500 |
| 468 | 3300035725 | Ga0373947_0046800 | Ga0373947_0046800_226_1785 | 500 |
| 469 | 3300035725 | Ga0373947_0059541 | Ga0373947_0059541_301_1860 | 500 |
| 470 | 3300036401 | Ga0373937_0140717 | Ga0373937_0140717_346_1920 | 500 |
| 471 | 3300037068 | Ga0373925_0109995 | Ga0373925_0109995_193_1752 | 500 |
| 472 | 3300046454 | Ga0495592_0100540 | Ga0495592_0100540_191_1765 | 500 |
| 473 | 3300046462 | Ga0495651_0079054 | Ga0495651_0079054_497_2071 | 500 |
| 474 | 3300046463 | Ga0495653_0094331 | Ga0495653_0094331_147_1721 | 500 |
| 475 | 3300046473 | Ga0495582_0081651 | Ga0495582_0081651_131_1690 | 500 |
| 476 | 3300046476 | Ga0495662_0052955 | Ga0495662_0052955_122_1696 | 500 |
| 477 | 3300046477 | Ga0495664_0048412 | Ga0495664_0048412_608_2182 | 500 |
| 478 | 3300046511 | Ga0495608_0078271 | Ga0495608_0078271_379_1953 | 500 |
| 479 | 3300046514 | Ga0495618_0076244 | Ga0495618_0076244_453_2027 | 500 |
| 480 | 3300046514 | Ga0495618_0098015 | Ga0495618_0098015_161_1723 | 500 |
| 481 | 3300046516 | Ga0495628_0141854 | Ga0495628_0141854_212_1786 | 500 |
| 482 | 3300046529 | Ga0495652_0093019 | Ga0495652_0093019_498_2072 | 500 |
| 483 | 3300046533 | Ga0495640_0074040 | Ga0495640_0074040_211_1785 | 500 |
| 484 | 3300046536 | Ga0495587_0043104 | Ga0495587_0043104_654_2228 | 500 |
| 485 | 3300046543 | Ga0495645_0046319 | Ga0495645_0046319_1440_3014 | 500 |
| 486 | 3300046559 | Ga0495667_0086117 | Ga0495667_0086117_406_1980 | 500 |
| 487 | 3300046642 | Ga0495634_0107326 | Ga0495634_0107326_130_1704 | 500 |
| 488 | 3300046663 | Ga0495635_0074803 | Ga0495635_0074803_474_2048 | 500 |
| 489 | 3300046675 | Ga0495657_0063654 | Ga0495657_0063654_428_2002 | 500 |
| 490 | 3300046678 | Ga0495599_0057646 | Ga0495599_0057646_825_2399 | 500 |
| 491 | 3300046679 | Ga0495623_0071232 | Ga0495623_0071232_71_1645 | 500 |
| 492 | 3300046680 | Ga0495646_0057813 | Ga0495646_0057813_575_2149 | 500 |
| 493 | 3300046809 | Ga0495600_0079706 | Ga0495600_0079706_382_1956 | 500 |
| 494 | 3300047317 | Ga0495604_0111933 | Ga0495604_0111933_356_1930 | 500 |
| 495 | 3300047319 | Ga0495674_0024334 | Ga0495674_0024334_1433_2995 | 500 |
| 496 | 3300047319 | Ga0495674_0116207 | Ga0495674_0116207_369_1943 | 500 |
| 497 | 3300047322 | Ga0495680_0018697 | Ga0495680_0018697_52_1626 | 500 |
| 498 | 3300047444 | Ga0495675_0086415 | Ga0495675_0086415_194_1768 | 500 |
| 499 | 3300047471 | Ga0495684_0046850 | Ga0495684_0046850_1130_2692 | 500 |
| 500 | 3300047471 | Ga0495684_0098192 | Ga0495684_0098192_185_1759 | 500 |
| 501 | 3300048088 | Ga0495602_0095884 | Ga0495602_0095884_765_2339 | 500 |
| 502 | 3300048088 | Ga0495602_0149971 | Ga0495602_0149971_210_1775 | 500 |
| 503 | 3300053077 | Ga0495601_0103802 | Ga0495601_0103802_199_1773 | 500 |
| 504 | 3300053078 | Ga0495612_0046402 | Ga0495612_0046402_119_1693 | 500 |
| 505 | 3300053085 | Ga0495619_0113362 | Ga0495619_0113362_167_1741 | 500 |
| 506 | 3300007265 | Ga0099794_10022796 | Ga0099794_100227961 | 501 |
| 507 | 3300025898 | Ga0207692_10047707 | Ga0207692_100477071 | 501 |
| 508 | 3300005437 | Ga0070710_10059946 | Ga0070710_100599461 | 503 |
| 509 | 3300025916 | Ga0207663_10113546 | Ga0207663_101135461 | 503 |
| 510 | 3300037853 | Ga0436364_0206840 | Ga0436364_0206840_1939_3537 | 503 |
| 511 | 3300024227 | Ga0228598_1007956 | Ga0228598_10079561 | 506 |
| 512 | 3300005329 | Ga0070683_100105722 | Ga0070683_1001057221 | 508 |
| 513 | 3300047319 | Ga0495674_0111780 | Ga0495674_0111780_517_2160 | 508 |
| 514 | 3300005344 | Ga0070661_100119366 | Ga0070661_1001193662 | 509 |
| 515 | 3300021358 | Ga0213873_10012627 | Ga0213873_100126271 | 510 |
| 516 | 3300039453 | Ga0436362_0587610 | Ga0436362_0587610_154_1743 | 510 |
| 517 | 3300005467 | Ga0070706_100224512 | Ga0070706_1002245121 | 511 |
| 518 | 3300005536 | Ga0070697_100187802 | Ga0070697_1001878021 | 511 |
| 519 | 3300005983 | Ga0081540_1029438 | Ga0081540_10294381 | 511 |
| 520 | 3300005937 | Ga0081455_10090085 | Ga0081455_100900852 | 512 |
| 521 | 3300005983 | Ga0081540_1000999 | Ga0081540_10009991 | 512 |
| 522 | 3300006175 | Ga0070712_100077610 | Ga0070712_1000776102 | 513 |
| 523 | 3300005435 | Ga0070714_100182602 | Ga0070714_1001826021 | 515 |
| 524 | 3300005436 | Ga0070713_100153373 | Ga0070713_1001533731 | 515 |
| 525 | 3300005437 | Ga0070710_10063015 | Ga0070710_100630153 | 515 |
| 526 | 3300006028 | Ga0070717_10177387 | Ga0070717_101773871 | 515 |
| 527 | 3300025898 | Ga0207692_10066352 | Ga0207692_100663521 | 515 |
| 528 | 3300025916 | Ga0207663_10061772 | Ga0207663_100617722 | 515 |
| 529 | 3300025928 | Ga0207700_10180499 | Ga0207700_101804991 | 515 |
| 530 | 3300046477 | Ga0495664_0099167 | Ga0495664_0099167_44_1675 | 519 |
| 531 | 3300035171 | Ga0373946_0032099 | Ga0373946_0032099_135_1772 | 521 |
| 532 | 3300046690 | Ga0495624_0093188 | Ga0495624_0093188_143_1780 | 521 |
| 533 | 3300053077 | Ga0495601_0101515 | Ga0495601_0101515_146_1783 | 521 |
| 534 | 3300005518 | Ga0070699_100209347 | Ga0070699_1002093471 | 526 |
| 535 | 3300003659 | JGI25404J52841_10013805 | JGI25404J52841_100138051 | 527 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar