F460552

General Info

Members Datasets Scaffolds Average Seq Length
534 236 504 160

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100177607|Ga0307415_1001776073
Length 194
Sequence MSWRVSVAHAGFRCPAEVRLQRPSDPSRLSYGACMAVFLRKLLRIGGLPAELRAEVEAEGVIYVAEYVPVTRRFSGKIPGKRAHGNVASYVGALALTNQRILGTLSTVPKLAGRTIDQPWSAPQSGTVNADISEAGLHLEVNISAVDPRCQGQLSLQYKTPIPPEVLTRVPRRSLAFDVPPEYVFRAVGVPYHP

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
3 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.28
Nodule 0
Rhizoplane 8.99
Rhizosphere 67.6
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1010399 3300002073 Bacteria 1058
2 JGI24748J21848_1008174 3300002074 Bacteria 1229
3 JGI24738J21930_10054665 3300002075 Bacteria 815
4 JGI24744J21845_10001674 3300002077 Bacteria 4437
5 JGI24744J21845_10035231 3300002077 Bacteria 947
6 JGI24034J26672_10031307 3300002239 Bacteria 868
7 Ga0070676_10054780 3300005328 Bacteria 2352
8 Ga0070690_100125084 3300005330 Bacteria 1730
9 Ga0070670_100287200 3300005331 Bacteria 1437
10 Ga0070677_10115618 3300005333 Bacteria 1204
11 Ga0068869_100006215 3300005334 Bacteria 7561
12 Ga0068869_101388847 3300005334 Bacteria 621
13 Ga0070666_10052095 3300005335 Bacteria 2758
14 Ga0070666_10182197 3300005335 Bacteria 1473
15 Ga0070680_100460917 3300005336 Bacteria 1086
16 Ga0070682_100114675 3300005337 Bacteria 1801
17 Ga0068868_100006676 3300005338 Bacteria 8189
18 Ga0070660_100106718 3300005339 Bacteria 2224
19 Ga0070689_100003095 3300005340 Bacteria 10976
20 Ga0070687_100417257 3300005343 Bacteria 884
21 Ga0070661_100471877 3300005344 Bacteria 1001
22 Ga0070692_11140604 3300005345 Bacteria 552
23 Ga0070668_100050371 3300005347 Bacteria 3206
24 Ga0070668_100171388 3300005347 Bacteria 1767
25 Ga0070668_100290762 3300005347 Bacteria 1368
26 Ga0070668_100355870 3300005347 Bacteria 1240
27 Ga0070669_100037509 3300005353 Bacteria 3516
28 Ga0070675_100014586 3300005354 Bacteria 6196
29 Ga0070671_100004325 3300005355 Bacteria 11237
30 Ga0070671_100113477 3300005355 Bacteria 2277
31 Ga0070671_100412113 3300005355 Bacteria 1157
32 Ga0070674_100031357 3300005356 Bacteria 3522
33 Ga0070674_100246759 3300005356 Bacteria 1400
34 Ga0070674_100251921 3300005356 Unclassified 1387
35 Ga0070673_100122317 3300005364 Bacteria 2173
36 Ga0070673_100201049 3300005364 Bacteria 1716
37 Ga0070659_100180920 3300005366 Bacteria 1730
38 Ga0070659_100850684 3300005366 Bacteria 795
39 Ga0070667_100020189 3300005367 Bacteria 5531
40 Ga0070667_100137782 3300005367 Bacteria 2135
41 Ga0070667_100145764 3300005367 Bacteria 2076
42 Ga0070709_10001138 3300005434 Bacteria 14658
43 Ga0070709_10099956 3300005434 Bacteria 1931
44 Ga0070714_100125074 3300005435 Bacteria 2291
45 Ga0070710_10008017 3300005437 Bacteria 5134
46 Ga0070710_10010338 3300005437 Bacteria 4583
47 Ga0070701_10000574 3300005438 Bacteria 12789
48 Ga0070701_10650231 3300005438 Bacteria 704
49 Ga0070711_100001370 3300005439 Bacteria 13312
50 Ga0070711_100009214 3300005439 Bacteria 6069
51 Ga0070705_100096175 3300005440 Bacteria 1859
52 Ga0070700_100009041 3300005441 Bacteria 5458
53 Ga0070700_100059079 3300005441 Bacteria 2412
54 Ga0070700_100125173 3300005441 Bacteria 1727
55 Ga0070694_100017618 3300005444 Bacteria 4517
56 Ga0070694_100569900 3300005444 Bacteria 909
57 Ga0070663_100028239 3300005455 Bacteria 3818
58 Ga0070663_100064115 3300005455 Bacteria 2655
59 Ga0070678_100007637 3300005456 Bacteria 6426
60 Ga0070678_100573657 3300005456 Bacteria 1004
61 Ga0070662_100002522 3300005457 Bacteria 11280
62 Ga0070662_100336214 3300005457 Bacteria 1234
63 Ga0068867_100002753 3300005459 Bacteria 12389
64 Ga0068867_100105904 3300005459 Bacteria 2154
65 Ga0070685_10277155 3300005466 Bacteria 1121
66 Ga0070707_100921757 3300005468 Bacteria 838
67 Ga0070684_100184190 3300005535 Bacteria 1899
68 Ga0068853_100007969 3300005539 Bacteria 8494
69 Ga0068853_101338667 3300005539 Bacteria 692
70 Ga0070672_100016053 3300005543 Bacteria 5353
71 Ga0070686_100127240 3300005544 Bacteria 1757
72 Ga0070686_101493950 3300005544 Bacteria 569
73 Ga0070695_100017923 3300005545 Bacteria 4296
74 Ga0070695_100103188 3300005545 Bacteria 1924
75 Ga0070696_100002819 3300005546 Bacteria 11548
76 Ga0070696_100091608 3300005546 Bacteria 2165
77 Ga0070693_100030732 3300005547 Bacteria 2939
78 Ga0070665_100006270 3300005548 Bacteria 12155
79 Ga0070665_100106009 3300005548 Bacteria 2813
80 Ga0070665_101212700 3300005548 Bacteria 765
81 Ga0070665_101864143 3300005548 Bacteria 607
82 Ga0070704_100000324 3300005549 Bacteria 21508
83 Ga0070704_100149875 3300005549 Bacteria 1832
84 Ga0070704_100701865 3300005549 Bacteria 897
85 Ga0068855_100028591 3300005563 Bacteria 6671
86 Ga0068855_100243442 3300005563 Bacteria 2009
87 Ga0068854_100005612 3300005578 Bacteria 7930
88 Ga0070702_100134713 3300005615 Bacteria 1565
89 Ga0070702_101307367 3300005615 Bacteria 589
90 Ga0068859_100007033 3300005617 Bacteria 11425
91 Ga0068859_100072184 3300005617 Bacteria 3488
92 Ga0068859_100250774 3300005617 Bacteria 1861
93 Ga0068864_100101488 3300005618 Bacteria 2552
94 Ga0068864_100141541 3300005618 Bacteria 2170
95 Ga0068864_101681394 3300005618 Bacteria 639
96 Ga0068866_10000937 3300005718 Bacteria 12824
97 Ga0068866_10117836 3300005718 Bacteria 1491
98 Ga0068861_100006110 3300005719 Bacteria 8195
99 Ga0068861_100087465 3300005719 Bacteria 2452
100 Ga0068851_10071868 3300005834 Bacteria 1791
101 Ga0068851_10103170 3300005834 Bacteria 1515
102 Ga0068870_10181439 3300005840 Bacteria 1264
103 Ga0068863_100118854 3300005841 Bacteria 2519
104 Ga0068863_100125657 3300005841 Bacteria 2447
105 Ga0068858_100040452 3300005842 Bacteria 4323
106 Ga0068858_100282183 3300005842 Bacteria 1582
107 Ga0068860_100006774 3300005843 Bacteria 11490
108 Ga0068860_100193726 3300005843 Bacteria 1967
109 Ga0068862_100000958 3300005844 Bacteria 27782
110 Ga0068862_100116575 3300005844 Bacteria 2350
111 Ga0081455_10148508 3300005937 Bacteria 1810
112 Ga0075365_10111430 3300006038 Bacteria 1881
113 Ga0075365_10302580 3300006038 Bacteria 1126
114 Ga0075365_10312323 3300006038 Bacteria 1106
115 Ga0075365_10323755 3300006038 Bacteria 1086
116 Ga0075365_10599454 3300006038 Bacteria 779
117 Ga0075365_10688057 3300006038 Bacteria 722
118 Ga0075368_10261286 3300006042 Bacteria 741
119 Ga0075363_100005917 3300006048 Bacteria 5509
120 Ga0075363_100007024 3300006048 Bacteria 5148
121 Ga0075363_100008869 3300006048 Bacteria 4706
122 Ga0075363_100018022 3300006048 Bacteria 3511
123 Ga0075363_100033601 3300006048 Bacteria 2672
124 Ga0075363_100101785 3300006048 Bacteria 1590
125 Ga0075363_100209879 3300006048 Bacteria 1114
126 Ga0075363_100215068 3300006048 Bacteria 1101
127 Ga0075363_100250334 3300006048 Bacteria 1020
128 Ga0075363_100346034 3300006048 Bacteria 868
129 Ga0075363_100385522 3300006048 Bacteria 822
130 Ga0075364_10009147 3300006051 Bacteria 5933
131 Ga0075364_10104238 3300006051 Bacteria 1889
132 Ga0075364_10118431 3300006051 Bacteria 1771
133 Ga0075364_10157154 3300006051 Bacteria 1534
134 Ga0075364_10169707 3300006051 Bacteria 1475
135 Ga0075364_10189817 3300006051 Bacteria 1391
136 Ga0075364_10268338 3300006051 Bacteria 1160
137 Ga0075364_10329849 3300006051 Bacteria 1039
138 Ga0075364_10964050 3300006051 Bacteria 580
139 Ga0070715_10043152 3300006163 Bacteria 1900
140 Ga0070716_100007252 3300006173 Bacteria 5452
141 Ga0070712_100002027 3300006175 Bacteria 12411
142 Ga0070712_100048808 3300006175 Bacteria 2936
143 Ga0070712_100892180 3300006175 Bacteria 766
144 Ga0075362_10008884 3300006177 Bacteria 3862
145 Ga0075362_10027289 3300006177 Bacteria 2444
146 Ga0075362_10104827 3300006177 Bacteria 1326
147 Ga0075362_10401649 3300006177 Bacteria 691
148 Ga0075367_10294888 3300006178 Bacteria 1020
149 Ga0075367_10367520 3300006178 Bacteria 908
150 Ga0075369_10014637 3300006186 Bacteria 3137
151 Ga0075369_10017408 3300006186 Bacteria 2912
152 Ga0075369_10018470 3300006186 Bacteria 2839
153 Ga0075369_10026514 3300006186 Bacteria 2416
154 Ga0075369_10049891 3300006186 Bacteria 1808
155 Ga0075369_10090995 3300006186 Bacteria 1361
156 Ga0075369_10269615 3300006186 Bacteria 792
157 Ga0097621_100188583 3300006237 Bacteria 1785
158 Ga0097621_101248651 3300006237 Bacteria 701
159 Ga0075370_10005807 3300006353 Bacteria 6165
160 Ga0075370_10007772 3300006353 Bacteria 5478
161 Ga0075370_10042561 3300006353 Bacteria 2566
162 Ga0075370_10227946 3300006353 Bacteria 1102
163 Ga0075370_10356929 3300006353 Bacteria 873
164 Ga0075370_10365921 3300006353 Bacteria 863
165 Ga0075370_10838574 3300006353 Bacteria 561
166 Ga0068871_100142331 3300006358 Bacteria 2040
167 Ga0068871_100260723 3300006358 Bacteria 1512
168 Ga0075428_100000609 3300006844 Bacteria 36516
169 Ga0075430_100003543 3300006846 Bacteria 13073
170 Ga0068865_100002876 3300006881 Bacteria 10258
171 Ga0068865_100497927 3300006881 Bacteria 1015
172 Ga0097620_100007032 3300006931 Bacteria 11425
173 Ga0097620_100072185 3300006931 Bacteria 3488
174 Ga0097620_100250783 3300006931 Bacteria 1861
175 Ga0099795_10048313 3300007788 Bacteria 1540
176 Ga0105250_10062121 3300009092 Bacteria 1502
177 Ga0105250_10076367 3300009092 Bacteria 1355
178 Ga0111539_10157924 3300009094 Bacteria 2653
179 Ga0111539_11158659 3300009094 Bacteria 898
180 Ga0105245_10020964 3300009098 Bacteria 5730
181 Ga0105245_10076235 3300009098 Bacteria 3054
182 Ga0105245_10222886 3300009098 Bacteria 1820
183 Ga0105247_10000265 3300009101 Bacteria 48548
184 Ga0105247_10072267 3300009101 Bacteria 2159
185 Ga0105247_10206165 3300009101 Bacteria 1324
186 Ga0114129_11088237 3300009147 Bacteria 1001
187 Ga0105243_10006348 3300009148 Bacteria 9128
188 Ga0105243_10039788 3300009148 Bacteria 3668
189 Ga0105241_10022698 3300009174 Bacteria 4650
190 Ga0105241_10104366 3300009174 Bacteria 2258
191 Ga0105242_10011028 3300009176 Bacteria 6942
192 Ga0105248_10006313 3300009177 Bacteria 13005
193 Ga0105248_10074541 3300009177 Bacteria 3814
194 Ga0105248_10808142 3300009177 Bacteria 1058
195 Ga0105237_10239378 3300009545 Bacteria 1816
196 Ga0105238_10042957 3300009551 Bacteria 4575
197 Ga0105238_10249529 3300009551 Bacteria 1753
198 Ga0105238_10554161 3300009551 Bacteria 1154
199 Ga0105238_11673199 3300009551 Bacteria 667
200 Ga0105249_10000892 3300009553 Bacteria 26445
201 Ga0105249_10055358 3300009553 Bacteria 3628
202 Ga0105249_10337860 3300009553 Bacteria 1522
203 Ga0105249_11480305 3300009553 Bacteria 751
204 Ga0105249_11510893 3300009553 Bacteria 744
205 Ga0099796_10014124 3300010159 Bacteria 2299
206 Ga0105239_10022038 3300010375 Bacteria 7023
207 Ga0105239_10308829 3300010375 Bacteria 1782
208 Ga0105239_10615076 3300010375 Bacteria 1240
209 Ga0105239_11368181 3300010375 Bacteria 817
210 Ga0105239_12142236 3300010375 Bacteria 650
211 Ga0105246_10021209 3300011119 Bacteria 4178
212 Ga0105246_10348744 3300011119 Unclassified 1212
213 Ga0157369_10290005 3300013105 Bacteria 1704
214 Ga0157374_10015517 3300013296 Bacteria 6682
215 Ga0157374_11302228 3300013296 Bacteria 749
216 Ga0157378_10165038 3300013297 Bacteria 2074
217 Ga0163162_10031742 3300013306 Bacteria 5241
218 Ga0163162_10177198 3300013306 Bacteria 2257
219 Ga0163162_10445777 3300013306 Bacteria 1426
220 Ga0163162_11500884 3300013306 Bacteria 768
221 Ga0157372_10005825 3300013307 Bacteria 13128
222 Ga0157372_10147416 3300013307 Bacteria 2714
223 Ga0157372_11988702 3300013307 Bacteria 668
224 Ga0157375_10000760 3300013308 Bacteria 28299
225 Ga0157375_10211227 3300013308 Bacteria 2098
226 Ga0163163_10018765 3300014325 Bacteria 6483
227 Ga0163163_10126290 3300014325 Bacteria 2596
228 Ga0163163_10313420 3300014325 Bacteria 1622
229 Ga0163163_11082338 3300014325 Bacteria 865
230 Ga0163163_11686046 3300014325 Bacteria 694
231 Ga0157380_10001880 3300014326 Bacteria 13915
232 Ga0157380_10325200 3300014326 Bacteria 1427
233 Ga0157377_10021301 3300014745 Bacteria 3409
234 Ga0157379_10019019 3300014968 Bacteria 6064
235 Ga0157379_10078111 3300014968 Bacteria 2964
236 Ga0157379_10466483 3300014968 Bacteria 1167
237 Ga0157379_10628703 3300014968 Unclassified 1004
238 Ga0157376_10374608 3300014969 Bacteria 1369
239 Ga0163161_10071957 3300017792 Bacteria 2531
240 Ga0163161_10091342 3300017792 Bacteria 2253
241 Ga0163161_10248836 3300017792 Bacteria 1385
242 Ga0207653_10091696 3300025885 Bacteria 1065
243 Ga0207692_10033528 3300025898 Bacteria 2478
244 Ga0207692_10080193 3300025898 Bacteria 1743
245 Ga0207642_10000396 3300025899 Bacteria 13057
246 Ga0207710_10008666 3300025900 Bacteria 4289
247 Ga0207688_10000235 3300025901 Bacteria 25164
248 Ga0207688_10001781 3300025901 Bacteria 11436
249 Ga0207680_10043619 3300025903 Bacteria 2632
250 Ga0207647_10043635 3300025904 Bacteria 2805
251 Ga0207647_10264413 3300025904 Bacteria 984
252 Ga0207685_10025585 3300025905 Bacteria 2040
253 Ga0207699_10051379 3300025906 Bacteria 2435
254 Ga0207699_10300252 3300025906 Bacteria 1121
255 Ga0207645_10166151 3300025907 Bacteria 1445
256 Ga0207645_10706260 3300025907 Bacteria 685
257 Ga0207643_10099514 3300025908 Bacteria 1704
258 Ga0207654_10063031 3300025911 Bacteria 2174
259 Ga0207671_10124618 3300025914 Bacteria 1972
260 Ga0207693_10002003 3300025915 Bacteria 17881
261 Ga0207693_10009436 3300025915 Bacteria 7951
262 Ga0207663_10176942 3300025916 Bacteria 1520
263 Ga0207662_10276285 3300025918 Bacteria 1110
264 Ga0207657_10066138 3300025919 Bacteria 3078
265 Ga0207657_10302676 3300025919 Bacteria 1266
266 Ga0207649_10281743 3300025920 Bacteria 1209
267 Ga0207649_11055989 3300025920 Bacteria 640
268 Ga0207646_10632289 3300025922 Bacteria 959
269 Ga0207681_10021138 3300025923 Bacteria 4132
270 Ga0207694_10039624 3300025924 Bacteria 3626
271 Ga0207694_10532576 3300025924 Bacteria 985
272 Ga0207694_11235836 3300025924 Bacteria 632
273 Ga0207687_10203889 3300025927 Bacteria 1548
274 Ga0207687_10509076 3300025927 Bacteria 1006
275 Ga0207700_11026274 3300025928 Bacteria 738
276 Ga0207644_10211797 3300025931 Bacteria 1533
277 Ga0207644_10260170 3300025931 Bacteria 1387
278 Ga0207644_10520824 3300025931 Bacteria 982
279 Ga0207690_10473766 3300025932 Bacteria 1010
280 Ga0207706_10004218 3300025933 Bacteria 13539
281 Ga0207686_10082090 3300025934 Bacteria 2106
282 Ga0207709_10001915 3300025935 Bacteria 13707
283 Ga0207709_10043270 3300025935 Bacteria 2714
284 Ga0207670_10038174 3300025936 Bacteria 3135
285 Ga0207669_10057741 3300025937 Bacteria 2364
286 Ga0207669_10093064 3300025937 Bacteria 1968
287 Ga0207669_10818566 3300025937 Unclassified 773
288 Ga0207704_10014473 3300025938 Bacteria 3983
289 Ga0207704_10318723 3300025938 Bacteria 1198
290 Ga0207665_10002735 3300025939 Bacteria 11828
291 Ga0207665_10019187 3300025939 Bacteria 4493
292 Ga0207691_10038812 3300025940 Bacteria 4407
293 Ga0207711_10588181 3300025941 Bacteria 1038
294 Ga0207711_10748616 3300025941 Bacteria 911
295 Ga0207689_10009672 3300025942 Bacteria 8307
296 Ga0207689_10018530 3300025942 Bacteria 5873
297 Ga0207667_10264003 3300025949 Bacteria 1761
298 Ga0207651_10108230 3300025960 Bacteria 2080
299 Ga0207712_10024596 3300025961 Bacteria 3991
300 Ga0207712_10273195 3300025961 Bacteria 1376
301 Ga0207668_10016700 3300025972 Bacteria 4586
302 Ga0207668_10280482 3300025972 Bacteria 1366
303 Ga0207668_10511930 3300025972 Bacteria 1034
304 Ga0207668_10595705 3300025972 Bacteria 962
305 Ga0207640_10147328 3300025981 Bacteria 1724
306 Ga0207658_10007021 3300025986 Bacteria 7668
307 Ga0207658_10097389 3300025986 Bacteria 2296
308 Ga0207658_10442166 3300025986 Bacteria 1150
309 Ga0207658_11132288 3300025986 Bacteria 715
310 Ga0207703_10121918 3300026035 Bacteria 2239
311 Ga0207639_10034325 3300026041 Bacteria 3749
312 Ga0207639_10063197 3300026041 Bacteria 2865
313 Ga0207678_10006719 3300026067 Bacteria 10202
314 Ga0207678_10010674 3300026067 Bacteria 8067
315 Ga0207678_10029794 3300026067 Bacteria 4765
316 Ga0207678_10462565 3300026067 Bacteria 1103
317 Ga0207708_10001625 3300026075 Bacteria 16716
318 Ga0207708_10021001 3300026075 Bacteria 4927
319 Ga0207708_10124926 3300026075 Bacteria 2007
320 Ga0207641_10177202 3300026088 Bacteria 1950
321 Ga0207641_10220024 3300026088 Bacteria 1760
322 Ga0207648_10003286 3300026089 Bacteria 17005
323 Ga0207648_10013165 3300026089 Bacteria 7710
324 Ga0207676_11474149 3300026095 Bacteria 677
325 Ga0207675_100000865 3300026118 Bacteria 30240
326 Ga0207675_100046529 3300026118 Bacteria 4054
327 Ga0207683_10000809 3300026121 Bacteria 28622
328 Ga0207683_10026106 3300026121 Bacteria 5042
329 Ga0207698_10115899 3300026142 Bacteria 2257
330 Ga0209813_10070972 3300027866 Bacteria 1132
331 Ga0207428_10444578 3300027907 Bacteria 946
332 Ga0268266_10110122 3300028379 Bacteria 2439
333 Ga0268266_10178427 3300028379 Bacteria 1932
334 Ga0268265_10039940 3300028380 Bacteria 3462
335 Ga0268265_10057367 3300028380 Bacteria 2967
336 Ga0268265_10499969 3300028380 Bacteria 1145
337 Ga0268264_10147808 3300028381 Bacteria 2103
338 Ga0268264_12161744 3300028381 Bacteria 565
339 Ga0307405_10117143 3300031731 Bacteria 1816
340 Ga0307406_10659314 3300031901 Bacteria 869
341 Ga0307409_100032487 3300031995 Bacteria 3785
342 Ga0307409_100174892 3300031995 Bacteria 1894
343 Ga0307416_100265404 3300032002 Bacteria 1681
344 Ga0307415_100177607 3300032126 Bacteria 1667
345 Ga0373951_0058952 3300035091 Bacteria 958
346 Ga0373939_0022785 3300035114 Bacteria 1729
347 Ga0373941_0069973 3300035115 Bacteria 1163
348 Ga0373931_0047646 3300035691 Bacteria 2269
349 Ga0373931_0282662 3300035691 Bacteria 1019
350 Ga0439461_0000467 3300041410 Bacteria 5828
351 Ga0439466_0010698 3300041411 Bacteria 3408
352 Ga0439466_0015202 3300041411 Bacteria 2797
353 Ga0439466_0032917 3300041411 Bacteria 1764
354 Ga0439465_0003631 3300041413 Bacteria 5031
355 Ga0439465_0005880 3300041413 Bacteria 3902
356 Ga0439465_0014870 3300041413 Bacteria 2427
357 Ga0451789_0514195 3300041443 Bacteria 688
358 Ga0439431_0017060 3300041997 Bacteria 1704
359 Ga0439431_0155220 3300041997 Bacteria 652
360 Ga0439442_015874 3300042002 Bacteria 1552
361 Ga0439442_103041 3300042002 Bacteria 619
362 Ga0439445_0006614 3300042004 Bacteria 2667
363 Ga0439445_0042833 3300042004 Bacteria 1207
364 Ga0439445_0052436 3300042004 Bacteria 1103
365 Ga0439456_031921 3300042013 Bacteria 1130
366 Ga0439434_0042362 3300042435 Bacteria 1400
367 Ga0466972_0004347 3300044658 Bacteria 7082
368 Ga0466972_0031476 3300044658 Bacteria 2609
369 Ga0466972_0051934 3300044658 Bacteria 1977
370 Ga0466972_0060518 3300044658 Bacteria 1816
371 Ga0466972_0125285 3300044658 Bacteria 1211
372 Ga0466965_0000919 3300044683 Bacteria 11292
373 Ga0466965_0001880 3300044683 Bacteria 8748
374 Ga0466965_0082069 3300044683 Bacteria 1630
375 Ga0466966_0080762 3300044684 Bacteria 2025
376 Ga0466963_0760679 3300044694 Bacteria 683
377 Ga0466971_0080261 3300044719 Bacteria 1487
378 Ga0466968_0003050 3300044735 Bacteria 6192
379 Ga0466968_0090149 3300044735 Bacteria 1357
380 Ga0466970_0023720 3300044765 Bacteria 3207
381 Ga0466970_0050590 3300044765 Bacteria 2216
382 Ga0466957_0002631 3300044842 Bacteria 9691
383 Ga0466957_0195713 3300044842 Bacteria 1326
384 Ga0466960_0002634 3300044901 Bacteria 6763
385 Ga0466960_0139675 3300044901 Bacteria 1286
386 Ga0466960_0552108 3300044901 Bacteria 679
387 Ga0466959_0055480 3300045049 Bacteria 2892
388 Ga0466959_0062672 3300045049 Bacteria 2701
389 Ga0466958_0166164 3300045836 Bacteria 1396
390 Ga0466967_0050122 3300045976 Bacteria 3655
391 Ga0466967_0133115 3300045976 Bacteria 2310
392 Ga0466967_0270439 3300045976 Bacteria 1628
393 Ga0466967_0536814 3300045976 Bacteria 1150
394 Ga0466967_1300660 3300045976 Bacteria 724
395 Ga0466967_1813665 3300045976 Bacteria 607
396 Ga0495649_0106131 3300046694 Bacteria 1491
397 Ga0495672_0305970 3300047320 Bacteria 751
398 Ga0496100_0010375 3300048903 Bacteria 5270
399 Ga0496100_0325317 3300048903 Bacteria 1156
400 Ga0496100_0421494 3300048903 Bacteria 1019
401 Ga0496101_0001680 3300048904 Bacteria 13263
402 Ga0496101_0020787 3300048904 Bacteria 4502
403 Ga0496101_0053557 3300048904 Bacteria 2912
404 Ga0496101_0081136 3300048904 Bacteria 2398
405 Ga0496101_0305920 3300048904 Bacteria 1246
406 Ga0496102_0006724 3300048905 Bacteria 9821
407 Ga0496102_0108779 3300048905 Bacteria 2582
408 Ga0496102_0187821 3300048905 Bacteria 1947
409 Ga0496102_0511346 3300048905 Unclassified 1123
410 Ga0496103_0001002 3300048906 Bacteria 19780
411 Ga0496104_0027137 3300048907 Bacteria 5297
412 Ga0496104_0334999 3300048907 Bacteria 1426
413 Ga0496104_0352322 3300048907 Bacteria 1385
414 Ga0496105_0058475 3300048908 Bacteria 3182
415 Ga0496105_0449509 3300048908 Bacteria 1017
416 Ga0496106_0000506 3300048909 Bacteria 27628
417 Ga0496106_0044144 3300048909 Bacteria 3345
418 Ga0496106_1520919 3300048909 Bacteria 514
419 Ga0496107_0007237 3300048910 Bacteria 7646
420 Ga0496107_0154391 3300048910 Bacteria 1699
421 Ga0496107_0503604 3300048910 Bacteria 898
422 Ga0496107_0604094 3300048910 Bacteria 811
423 Ga0496108_0000189 3300048911 Bacteria 57428
424 Ga0496108_0007870 3300048911 Bacteria 8640
425 Ga0496108_0012395 3300048911 Bacteria 6937
426 Ga0496108_0120843 3300048911 Bacteria 2247
427 Ga0496109_0016352 3300048912 Bacteria 6484
428 Ga0496109_0025441 3300048912 Bacteria 5275
429 Ga0496109_0392989 3300048912 Bacteria 1310
430 Ga0496110_0039908 3300048913 Bacteria 4090
431 Ga0496110_0054698 3300048913 Bacteria 3511
432 Ga0496110_0129296 3300048913 Bacteria 2280
433 Ga0496110_0749954 3300048913 Unclassified 879
434 Ga0496111_0037288 3300048914 Bacteria 3479
435 Ga0496112_0024551 3300048915 Bacteria 5775
436 Ga0496112_0031220 3300048915 Bacteria 5165
437 Ga0496112_0075939 3300048915 Bacteria 3323
438 Ga0496112_0111644 3300048915 Bacteria 2703
439 Ga0496112_0230938 3300048915 Bacteria 1805
440 Ga0496113_0299034 3300048916 Bacteria 1288
441 Ga0496113_0655846 3300048916 Bacteria 839
442 Ga0496114_0005432 3300048917 Bacteria 9970
443 Ga0496114_0381502 3300048917 Bacteria 1248
444 Ga0496115_0002308 3300048918 Bacteria 13662
445 Ga0496122_0009690 3300048925 Bacteria 10077
446 Ga0496123_0114746 3300048926 Bacteria 1530
447 Ga0496126_0007614 3300048929 Bacteria 11826
448 Ga0501034_0036205 3300049571 Bacteria 5001
449 Ga0501034_0320971 3300049571 Bacteria 1482
450 Ga0501047_0339953 3300049581 Bacteria 1339
451 Ga0501068_0406000 3300049584 Bacteria 879
452 Ga0501070_0025856 3300049586 Bacteria 4925
453 Ga0501072_0956058 3300049588 Bacteria 668
454 Ga0501044_0707112 3300049823 Bacteria 893
455 nmdc:mga03683_27262_c1 3300050489 Bacteria 2260
456 nmdc:mga03683_28646_c1 3300050489 Bacteria 2216
457 nmdc:mga03683_358424_c1 3300050489 Bacteria 691
458 nmdc:mga03683_418569_c1 3300050489 Bacteria 642
459 nmdc:mga03n38_10208_c1 3300050490 Bacteria 3446
460 nmdc:mga03n38_119322_c1 3300050490 Bacteria 1294
461 nmdc:mga03n38_132275_c1 3300050490 Bacteria 1238
462 nmdc:mga03n38_165275_c1 3300050490 Bacteria 1123
463 nmdc:mga03n38_17766_c1 3300050490 Bacteria 2792
464 nmdc:mga03n38_184758_c1 3300050490 Bacteria 1070
465 nmdc:mga03n38_202551_c1 3300050490 Bacteria 1028
466 nmdc:mga03n38_240177_c1 3300050490 Bacteria 953
467 nmdc:mga03n38_370313_c1 3300050490 Bacteria 783
468 nmdc:mga03n38_65725_c1 3300050490 Bacteria 1664
469 nmdc:mga03n38_6860_c1 3300050490 Bacteria 3992
470 nmdc:mga03n38_75393_c1 3300050490 Bacteria 1571
471 nmdc:mga03n38_82061_c1 3300050490 Bacteria 1517
472 nmdc:mga03n38_90262_c1 3300050490 Bacteria 1457
473 nmdc:mga00v17_10756_c1 3300050491 Bacteria 5012
474 nmdc:mga00v17_167929_c1 3300050491 Bacteria 1414
475 nmdc:mga00v17_19691_c1 3300050491 Bacteria 3858
476 nmdc:mga00v17_53901_c1 3300050491 Bacteria 2453
477 nmdc:mga00v17_7018_c1 3300050491 Bacteria 5996
478 nmdc:mga00v17_7288_c1 3300050491 Bacteria 5894
479 nmdc:mga00v17_771781_c1 3300050491 Bacteria 614
480 nmdc:mga00v17_787169_c1 3300050491 Bacteria 606
481 nmdc:mga0yw44_133195_c1 3300050492 Bacteria 1610
482 nmdc:mga0yw44_24242_c1 3300050492 Bacteria 3431
483 nmdc:mga0yw44_38854_c1 3300050492 Bacteria 2818
484 nmdc:mga0yw44_46010_c1 3300050492 Bacteria 2619
485 nmdc:mga0yw44_93720_c1 3300050492 Bacteria 1902
486 nmdc:mga06z11_163669_c1 3300050494 Bacteria 1273
487 nmdc:mga06z11_166843_c1 3300050494 Bacteria 1262
488 nmdc:mga06z11_217004_c1 3300050494 Bacteria 1116
489 nmdc:mga06z11_256609_c1 3300050494 Bacteria 1031
490 nmdc:mga06z11_290878_c1 3300050494 Bacteria 969
491 nmdc:mga04h51_116870_c1 3300050495 Bacteria 989
492 nmdc:mga07m45_149607_c1 3300050496 Bacteria 1354
493 nmdc:mga07m45_23734_c1 3300050496 Bacteria 3355
494 nmdc:mga07m45_29879_c1 3300050496 Bacteria 3017
495 nmdc:mga07m45_410588_c1 3300050496 Bacteria 786
496 nmdc:mga07m45_414073_c1 3300050496 Bacteria 782
497 nmdc:mga05p37_550920_c1 3300050507 Bacteria 1313
498 nmdc:mga0qj67_157913_c1 3300050509 Bacteria 1841
499 nmdc:mga0qj67_71871_c1 3300050509 Bacteria 2761
500 nmdc:mga0sz30_135478_c1 3300050516 Bacteria 1086
501 nmdc:mga0sz30_144825_c1 3300050516 Bacteria 1050
502 nmdc:mga0sz30_8036_c2 3300050516 Bacteria 3328
503 nmdc:mga0sz30_8890_c1 3300050516 Bacteria 3808
504 Ga0495655_0006375 3300053083 Bacteria 2140

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221715 2644639231 156
2 iso_pu_bacteria 2902810491 2902816061 156
3 iso_pu_bacteria 2929212328 2929212915 156
4 3300028381 Ga0268264_12161744 Ga0268264_121617441 158
5 3300006038 Ga0075365_10111430 Ga0075365_101114303 159
6 3300006048 Ga0075363_100005917 Ga0075363_1000059173 159
7 3300006048 Ga0075363_100007024 Ga0075363_1000070246 159
8 3300006048 Ga0075363_100215068 Ga0075363_1002150682 159
9 3300006048 Ga0075363_100346034 Ga0075363_1003460341 159
10 3300006048 Ga0075363_100385522 Ga0075363_1003855222 159
11 3300006051 Ga0075364_10104238 Ga0075364_101042383 159
12 3300006051 Ga0075364_10118431 Ga0075364_101184313 159
13 3300006051 Ga0075364_10157154 Ga0075364_101571542 159
14 3300006051 Ga0075364_10268338 Ga0075364_102683381 159
15 3300006177 Ga0075362_10008884 Ga0075362_100088844 159
16 3300006177 Ga0075362_10027289 Ga0075362_100272892 159
17 3300006177 Ga0075362_10401649 Ga0075362_104016491 159
18 3300006186 Ga0075369_10014637 Ga0075369_100146373 159
19 3300006186 Ga0075369_10026514 Ga0075369_100265143 159
20 3300006186 Ga0075369_10090995 Ga0075369_100909952 159
21 3300006186 Ga0075369_10269615 Ga0075369_102696152 159
22 3300006353 Ga0075370_10005807 Ga0075370_100058076 159
23 3300006353 Ga0075370_10007772 Ga0075370_100077726 159
24 3300006353 Ga0075370_10042561 Ga0075370_100425612 159
25 3300006353 Ga0075370_10838574 Ga0075370_108385741 159
26 3300009553 Ga0105249_10055358 Ga0105249_100553584 159
27 3300041413 Ga0439465_0014870 Ga0439465_0014870_1638_2120 159
28 3300042004 Ga0439445_0052436 Ga0439445_0052436_576_1058 159
29 3300050489 nmdc:mga03683_27262_c1 nmdc:mga03683_27262_c1_103_585 159
30 3300050489 nmdc:mga03683_28646_c1 nmdc:mga03683_28646_c1_964_1446 159
31 3300050489 nmdc:mga03683_358424_c1 nmdc:mga03683_358424_c1_116_598 159
32 3300050490 nmdc:mga03n38_132275_c1 nmdc:mga03n38_132275_c1_634_1116 159
33 3300050490 nmdc:mga03n38_17766_c1 nmdc:mga03n38_17766_c1_1630_2112 159
34 3300050490 nmdc:mga03n38_202551_c1 nmdc:mga03n38_202551_c1_142_624 159
35 3300050490 nmdc:mga03n38_370313_c1 nmdc:mga03n38_370313_c1_36_590 159
36 3300050490 nmdc:mga03n38_6860_c1 nmdc:mga03n38_6860_c1_2241_2723 159
37 3300050490 nmdc:mga03n38_75393_c1 nmdc:mga03n38_75393_c1_939_1421 159
38 3300050490 nmdc:mga03n38_90262_c1 nmdc:mga03n38_90262_c1_586_1068 159
39 3300050491 nmdc:mga00v17_10756_c1 nmdc:mga00v17_10756_c1_3750_4232 159
40 3300050491 nmdc:mga00v17_167929_c1 nmdc:mga00v17_167929_c1_576_1058 159
41 3300050491 nmdc:mga00v17_7288_c1 nmdc:mga00v17_7288_c1_500_982 159
42 3300050492 nmdc:mga0yw44_24242_c1 nmdc:mga0yw44_24242_c1_2224_2706 159
43 3300050492 nmdc:mga0yw44_46010_c1 nmdc:mga0yw44_46010_c1_1494_1976 159
44 3300050494 nmdc:mga06z11_166843_c1 nmdc:mga06z11_166843_c1_604_1086 159
45 3300050494 nmdc:mga06z11_217004_c1 nmdc:mga06z11_217004_c1_398_880 159
46 3300050496 nmdc:mga07m45_149607_c1 nmdc:mga07m45_149607_c1_676_1158 159
47 3300050496 nmdc:mga07m45_23734_c1 nmdc:mga07m45_23734_c1_674_1156 159
48 3300050496 nmdc:mga07m45_29879_c1 nmdc:mga07m45_29879_c1_1045_1527 159
49 3300050496 nmdc:mga07m45_414073_c1 nmdc:mga07m45_414073_c1_282_764 159
50 3300050516 nmdc:mga0sz30_8036_c2 nmdc:mga0sz30_8036_c2_1015_1497 159
51 3300002073 JGI24745J21846_1010399 JGI24745J21846_10103992 160
52 3300002074 JGI24748J21848_1008174 JGI24748J21848_10081742 160
53 3300002075 JGI24738J21930_10054665 JGI24738J21930_100546652 160
54 3300002077 JGI24744J21845_10001674 JGI24744J21845_100016743 160
55 3300002077 JGI24744J21845_10035231 JGI24744J21845_100352312 160
56 3300002239 JGI24034J26672_10031307 JGI24034J26672_100313072 160
57 3300005328 Ga0070676_10054780 Ga0070676_100547802 160
58 3300005330 Ga0070690_100125084 Ga0070690_1001250842 160
59 3300005331 Ga0070670_100287200 Ga0070670_1002872002 160
60 3300005333 Ga0070677_10115618 Ga0070677_101156182 160
61 3300005334 Ga0068869_100006215 Ga0068869_1000062154 160
62 3300005334 Ga0068869_101388847 Ga0068869_1013888471 160
63 3300005335 Ga0070666_10052095 Ga0070666_100520952 160
64 3300005335 Ga0070666_10182197 Ga0070666_101821971 160
65 3300005336 Ga0070680_100460917 Ga0070680_1004609172 160
66 3300005337 Ga0070682_100114675 Ga0070682_1001146753 160
67 3300005338 Ga0068868_100006676 Ga0068868_1000066766 160
68 3300005339 Ga0070660_100106718 Ga0070660_1001067182 160
69 3300005340 Ga0070689_100003095 Ga0070689_1000030953 160
70 3300005343 Ga0070687_100417257 Ga0070687_1004172572 160
71 3300005344 Ga0070661_100471877 Ga0070661_1004718772 160
72 3300005345 Ga0070692_11140604 Ga0070692_111406041 160
73 3300005347 Ga0070668_100050371 Ga0070668_1000503713 160
74 3300005347 Ga0070668_100171388 Ga0070668_1001713883 160
75 3300005347 Ga0070668_100290762 Ga0070668_1002907622 160
76 3300005347 Ga0070668_100355870 Ga0070668_1003558702 160
77 3300005353 Ga0070669_100037509 Ga0070669_1000375092 160
78 3300005354 Ga0070675_100014586 Ga0070675_1000145862 160
79 3300005355 Ga0070671_100004325 Ga0070671_10000432511 160
80 3300005355 Ga0070671_100113477 Ga0070671_1001134772 160
81 3300005355 Ga0070671_100412113 Ga0070671_1004121131 160
82 3300005356 Ga0070674_100031357 Ga0070674_1000313574 160
83 3300005356 Ga0070674_100246759 Ga0070674_1002467592 160
84 3300005356 Ga0070674_100251921 Ga0070674_1002519213 160
85 3300005364 Ga0070673_100122317 Ga0070673_1001223173 160
86 3300005364 Ga0070673_100201049 Ga0070673_1002010492 160
87 3300005366 Ga0070659_100180920 Ga0070659_1001809202 160
88 3300005366 Ga0070659_100850684 Ga0070659_1008506841 160
89 3300005367 Ga0070667_100020189 Ga0070667_1000201893 160
90 3300005367 Ga0070667_100137782 Ga0070667_1001377823 160
91 3300005367 Ga0070667_100145764 Ga0070667_1001457643 160
92 3300005434 Ga0070709_10001138 Ga0070709_100011387 160
93 3300005434 Ga0070709_10099956 Ga0070709_100999562 160
94 3300005435 Ga0070714_100125074 Ga0070714_1001250743 160
95 3300005437 Ga0070710_10008017 Ga0070710_100080173 160
96 3300005437 Ga0070710_10010338 Ga0070710_100103384 160
97 3300005438 Ga0070701_10000574 Ga0070701_100005743 160
98 3300005438 Ga0070701_10650231 Ga0070701_106502311 160
99 3300005439 Ga0070711_100001370 Ga0070711_1000013703 160
100 3300005439 Ga0070711_100009214 Ga0070711_1000092143 160
101 3300005440 Ga0070705_100096175 Ga0070705_1000961753 160
102 3300005441 Ga0070700_100009041 Ga0070700_1000090414 160
103 3300005441 Ga0070700_100059079 Ga0070700_1000590793 160
104 3300005441 Ga0070700_100125173 Ga0070700_1001251732 160
105 3300005444 Ga0070694_100017618 Ga0070694_1000176182 160
106 3300005444 Ga0070694_100569900 Ga0070694_1005699001 160
107 3300005455 Ga0070663_100028239 Ga0070663_1000282393 160
108 3300005455 Ga0070663_100064115 Ga0070663_1000641153 160
109 3300005456 Ga0070678_100007637 Ga0070678_1000076376 160
110 3300005456 Ga0070678_100573657 Ga0070678_1005736572 160
111 3300005457 Ga0070662_100002522 Ga0070662_1000025228 160
112 3300005457 Ga0070662_100336214 Ga0070662_1003362142 160
113 3300005459 Ga0068867_100002753 Ga0068867_1000027535 160
114 3300005459 Ga0068867_100105904 Ga0068867_1001059043 160
115 3300005466 Ga0070685_10277155 Ga0070685_102771552 160
116 3300005468 Ga0070707_100921757 Ga0070707_1009217572 160
117 3300005535 Ga0070684_100184190 Ga0070684_1001841903 160
118 3300005539 Ga0068853_100007969 Ga0068853_1000079694 160
119 3300005539 Ga0068853_101338667 Ga0068853_1013386672 160
120 3300005543 Ga0070672_100016053 Ga0070672_1000160532 160
121 3300005544 Ga0070686_100127240 Ga0070686_1001272402 160
122 3300005544 Ga0070686_101493950 Ga0070686_1014939501 160
123 3300005545 Ga0070695_100017923 Ga0070695_1000179232 160
124 3300005545 Ga0070695_100103188 Ga0070695_1001031882 160
125 3300005546 Ga0070696_100002819 Ga0070696_1000028195 160
126 3300005546 Ga0070696_100091608 Ga0070696_1000916083 160
127 3300005547 Ga0070693_100030732 Ga0070693_1000307323 160
128 3300005548 Ga0070665_100006270 Ga0070665_1000062709 160
129 3300005548 Ga0070665_100106009 Ga0070665_1001060092 160
130 3300005548 Ga0070665_101212700 Ga0070665_1012127002 160
131 3300005548 Ga0070665_101864143 Ga0070665_1018641431 160
132 3300005549 Ga0070704_100000324 Ga0070704_1000003243 160
133 3300005549 Ga0070704_100149875 Ga0070704_1001498752 160
134 3300005549 Ga0070704_100701865 Ga0070704_1007018652 160
135 3300005563 Ga0068855_100028591 Ga0068855_1000285912 160
136 3300005563 Ga0068855_100243442 Ga0068855_1002434422 160
137 3300005578 Ga0068854_100005612 Ga0068854_1000056123 160
138 3300005615 Ga0070702_100134713 Ga0070702_1001347133 160
139 3300005615 Ga0070702_101307367 Ga0070702_1013073671 160
140 3300005617 Ga0068859_100007033 Ga0068859_10000703310 160
141 3300005617 Ga0068859_100072184 Ga0068859_1000721842 160
142 3300005617 Ga0068859_100250774 Ga0068859_1002507742 160
143 3300005618 Ga0068864_100101488 Ga0068864_1001014883 160
144 3300005618 Ga0068864_100141541 Ga0068864_1001415412 160
145 3300005618 Ga0068864_101681394 Ga0068864_1016813941 160
146 3300005718 Ga0068866_10000937 Ga0068866_100009378 160
147 3300005718 Ga0068866_10117836 Ga0068866_101178362 160
148 3300005719 Ga0068861_100006110 Ga0068861_1000061106 160
149 3300005719 Ga0068861_100087465 Ga0068861_1000874652 160
150 3300005834 Ga0068851_10071868 Ga0068851_100718682 160
151 3300005834 Ga0068851_10103170 Ga0068851_101031702 160
152 3300005840 Ga0068870_10181439 Ga0068870_101814392 160
153 3300005841 Ga0068863_100118854 Ga0068863_1001188542 160
154 3300005841 Ga0068863_100125657 Ga0068863_1001256573 160
155 3300005842 Ga0068858_100040452 Ga0068858_1000404522 160
156 3300005842 Ga0068858_100282183 Ga0068858_1002821832 160
157 3300005843 Ga0068860_100006774 Ga0068860_10000677410 160
158 3300005843 Ga0068860_100193726 Ga0068860_1001937262 160
159 3300005844 Ga0068862_100000958 Ga0068862_10000095811 160
160 3300005844 Ga0068862_100116575 Ga0068862_1001165752 160
161 3300005937 Ga0081455_10148508 Ga0081455_101485082 160
162 3300006038 Ga0075365_10111430 Ga0075365_101114302 160
163 3300006038 Ga0075365_10302580 Ga0075365_103025802 160
164 3300006038 Ga0075365_10312323 Ga0075365_103123232 160
165 3300006038 Ga0075365_10323755 Ga0075365_103237552 160
166 3300006038 Ga0075365_10599454 Ga0075365_105994542 160
167 3300006038 Ga0075365_10688057 Ga0075365_106880572 160
168 3300006042 Ga0075368_10261286 Ga0075368_102612861 160
169 3300006048 Ga0075363_100005917 Ga0075363_1000059172 160
170 3300006048 Ga0075363_100007024 Ga0075363_1000070247 160
171 3300006048 Ga0075363_100008869 Ga0075363_1000088692 160
172 3300006048 Ga0075363_100018022 Ga0075363_1000180223 160
173 3300006048 Ga0075363_100033601 Ga0075363_1000336013 160
174 3300006048 Ga0075363_100101785 Ga0075363_1001017852 160
175 3300006048 Ga0075363_100209879 Ga0075363_1002098792 160
176 3300006048 Ga0075363_100250334 Ga0075363_1002503342 160
177 3300006051 Ga0075364_10009147 Ga0075364_100091473 160
178 3300006051 Ga0075364_10118431 Ga0075364_101184312 160
179 3300006051 Ga0075364_10169707 Ga0075364_101697072 160
180 3300006051 Ga0075364_10189817 Ga0075364_101898172 160
181 3300006051 Ga0075364_10268338 Ga0075364_102683382 160
182 3300006051 Ga0075364_10329849 Ga0075364_103298492 160
183 3300006051 Ga0075364_10964050 Ga0075364_109640501 160
184 3300006163 Ga0070715_10043152 Ga0070715_100431522 160
185 3300006173 Ga0070716_100007252 Ga0070716_1000072522 160
186 3300006175 Ga0070712_100002027 Ga0070712_1000020278 160
187 3300006175 Ga0070712_100048808 Ga0070712_1000488083 160
188 3300006175 Ga0070712_100892180 Ga0070712_1008921801 160
189 3300006177 Ga0075362_10008884 Ga0075362_100088845 160
190 3300006177 Ga0075362_10104827 Ga0075362_101048272 160
191 3300006178 Ga0075367_10294888 Ga0075367_102948882 160
192 3300006178 Ga0075367_10367520 Ga0075367_103675202 160
193 3300006186 Ga0075369_10014637 Ga0075369_100146374 160
194 3300006186 Ga0075369_10017408 Ga0075369_100174083 160
195 3300006186 Ga0075369_10018470 Ga0075369_100184702 160
196 3300006186 Ga0075369_10026514 Ga0075369_100265144 160
197 3300006186 Ga0075369_10049891 Ga0075369_100498912 160
198 3300006186 Ga0075369_10090995 Ga0075369_100909951 160
199 3300006237 Ga0097621_100188583 Ga0097621_1001885832 160
200 3300006237 Ga0097621_101248651 Ga0097621_1012486512 160
201 3300006353 Ga0075370_10005807 Ga0075370_100058077 160
202 3300006353 Ga0075370_10007772 Ga0075370_100077727 160
203 3300006353 Ga0075370_10042561 Ga0075370_100425611 160
204 3300006353 Ga0075370_10227946 Ga0075370_102279462 160
205 3300006353 Ga0075370_10356929 Ga0075370_103569292 160
206 3300006353 Ga0075370_10365921 Ga0075370_103659212 160
207 3300006358 Ga0068871_100142331 Ga0068871_1001423313 160
208 3300006358 Ga0068871_100260723 Ga0068871_1002607232 160
209 3300006844 Ga0075428_100000609 Ga0075428_10000060921 160
210 3300006846 Ga0075430_100003543 Ga0075430_1000035438 160
211 3300006881 Ga0068865_100002876 Ga0068865_1000028765 160
212 3300006881 Ga0068865_100497927 Ga0068865_1004979273 160
213 3300006931 Ga0097620_100007032 Ga0097620_1000070321 160
214 3300006931 Ga0097620_100072185 Ga0097620_1000721852 160
215 3300006931 Ga0097620_100250783 Ga0097620_1002507832 160
216 3300007788 Ga0099795_10048313 Ga0099795_100483132 160
217 3300009092 Ga0105250_10062121 Ga0105250_100621211 160
218 3300009092 Ga0105250_10076367 Ga0105250_100763672 160
219 3300009094 Ga0111539_10157924 Ga0111539_101579242 160
220 3300009094 Ga0111539_11158659 Ga0111539_111586592 160
221 3300009098 Ga0105245_10020964 Ga0105245_100209644 160
222 3300009098 Ga0105245_10076235 Ga0105245_100762353 160
223 3300009098 Ga0105245_10222886 Ga0105245_102228862 160
224 3300009101 Ga0105247_10000265 Ga0105247_1000026541 160
225 3300009101 Ga0105247_10072267 Ga0105247_100722672 160
226 3300009101 Ga0105247_10206165 Ga0105247_102061652 160
227 3300009147 Ga0114129_11088237 Ga0114129_110882372 160
228 3300009148 Ga0105243_10006348 Ga0105243_100063482 160
229 3300009148 Ga0105243_10039788 Ga0105243_100397882 160
230 3300009174 Ga0105241_10022698 Ga0105241_100226984 160
231 3300009174 Ga0105241_10104366 Ga0105241_101043662 160
232 3300009176 Ga0105242_10011028 Ga0105242_100110283 160
233 3300009177 Ga0105248_10006313 Ga0105248_100063138 160
234 3300009177 Ga0105248_10074541 Ga0105248_100745413 160
235 3300009177 Ga0105248_10808142 Ga0105248_108081422 160
236 3300009545 Ga0105237_10239378 Ga0105237_102393782 160
237 3300009551 Ga0105238_10042957 Ga0105238_100429575 160
238 3300009551 Ga0105238_10249529 Ga0105238_102495292 160
239 3300009551 Ga0105238_10554161 Ga0105238_105541612 160
240 3300009551 Ga0105238_11673199 Ga0105238_116731991 160
241 3300009553 Ga0105249_10000892 Ga0105249_100008928 160
242 3300009553 Ga0105249_10337860 Ga0105249_103378602 160
243 3300009553 Ga0105249_11480305 Ga0105249_114803051 160
244 3300009553 Ga0105249_11510893 Ga0105249_115108932 160
245 3300010159 Ga0099796_10014124 Ga0099796_100141243 160
246 3300010375 Ga0105239_10022038 Ga0105239_100220387 160
247 3300010375 Ga0105239_10308829 Ga0105239_103088293 160
248 3300010375 Ga0105239_10615076 Ga0105239_106150762 160
249 3300010375 Ga0105239_11368181 Ga0105239_113681811 160
250 3300010375 Ga0105239_12142236 Ga0105239_121422361 160
251 3300011119 Ga0105246_10021209 Ga0105246_100212093 160
252 3300011119 Ga0105246_10348744 Ga0105246_103487442 160
253 3300013105 Ga0157369_10290005 Ga0157369_102900053 160
254 3300013296 Ga0157374_10015517 Ga0157374_100155172 160
255 3300013296 Ga0157374_11302228 Ga0157374_113022282 160
256 3300013297 Ga0157378_10165038 Ga0157378_101650381 160
257 3300013306 Ga0163162_10031742 Ga0163162_100317421 160
258 3300013306 Ga0163162_10177198 Ga0163162_101771982 160
259 3300013306 Ga0163162_10445777 Ga0163162_104457772 160
260 3300013306 Ga0163162_11500884 Ga0163162_115008841 160
261 3300013307 Ga0157372_10005825 Ga0157372_1000582511 160
262 3300013307 Ga0157372_10147416 Ga0157372_101474163 160
263 3300013307 Ga0157372_11988702 Ga0157372_119887021 160
264 3300013308 Ga0157375_10000760 Ga0157375_1000076010 160
265 3300013308 Ga0157375_10211227 Ga0157375_102112272 160
266 3300014325 Ga0163163_10018765 Ga0163163_100187652 160
267 3300014325 Ga0163163_10126290 Ga0163163_101262903 160
268 3300014325 Ga0163163_10313420 Ga0163163_103134202 160
269 3300014325 Ga0163163_11082338 Ga0163163_110823381 160
270 3300014325 Ga0163163_11686046 Ga0163163_116860461 160
271 3300014326 Ga0157380_10001880 Ga0157380_100018805 160
272 3300014326 Ga0157380_10325200 Ga0157380_103252002 160
273 3300014745 Ga0157377_10021301 Ga0157377_100213012 160
274 3300014968 Ga0157379_10019019 Ga0157379_100190196 160
275 3300014968 Ga0157379_10078111 Ga0157379_100781112 160
276 3300014968 Ga0157379_10466483 Ga0157379_104664832 160
277 3300014968 Ga0157379_10628703 Ga0157379_106287032 160
278 3300014969 Ga0157376_10374608 Ga0157376_103746082 160
279 3300017792 Ga0163161_10071957 Ga0163161_100719572 160
280 3300017792 Ga0163161_10091342 Ga0163161_100913422 160
281 3300017792 Ga0163161_10248836 Ga0163161_102488362 160
282 3300025885 Ga0207653_10091696 Ga0207653_100916961 160
283 3300025898 Ga0207692_10033528 Ga0207692_100335282 160
284 3300025898 Ga0207692_10080193 Ga0207692_100801931 160
285 3300025899 Ga0207642_10000396 Ga0207642_100003962 160
286 3300025900 Ga0207710_10008666 Ga0207710_100086662 160
287 3300025901 Ga0207688_10000235 Ga0207688_1000023518 160
288 3300025901 Ga0207688_10001781 Ga0207688_100017813 160
289 3300025903 Ga0207680_10043619 Ga0207680_100436193 160
290 3300025904 Ga0207647_10043635 Ga0207647_100436352 160
291 3300025904 Ga0207647_10264413 Ga0207647_102644132 160
292 3300025905 Ga0207685_10025585 Ga0207685_100255852 160
293 3300025906 Ga0207699_10051379 Ga0207699_100513793 160
294 3300025906 Ga0207699_10300252 Ga0207699_103002522 160
295 3300025907 Ga0207645_10166151 Ga0207645_101661512 160
296 3300025907 Ga0207645_10706260 Ga0207645_107062602 160
297 3300025908 Ga0207643_10099514 Ga0207643_100995142 160
298 3300025911 Ga0207654_10063031 Ga0207654_100630312 160
299 3300025914 Ga0207671_10124618 Ga0207671_101246181 160
300 3300025915 Ga0207693_10002003 Ga0207693_100020038 160
301 3300025915 Ga0207693_10009436 Ga0207693_100094362 160
302 3300025916 Ga0207663_10176942 Ga0207663_101769422 160
303 3300025918 Ga0207662_10276285 Ga0207662_102762852 160
304 3300025919 Ga0207657_10066138 Ga0207657_100661383 160
305 3300025919 Ga0207657_10302676 Ga0207657_103026762 160
306 3300025920 Ga0207649_10281743 Ga0207649_102817432 160
307 3300025920 Ga0207649_11055989 Ga0207649_110559891 160
308 3300025922 Ga0207646_10632289 Ga0207646_106322892 160
309 3300025923 Ga0207681_10021138 Ga0207681_100211383 160
310 3300025924 Ga0207694_10039624 Ga0207694_100396245 160
311 3300025924 Ga0207694_10532576 Ga0207694_105325762 160
312 3300025924 Ga0207694_11235836 Ga0207694_112358361 160
313 3300025927 Ga0207687_10203889 Ga0207687_102038892 160
314 3300025927 Ga0207687_10509076 Ga0207687_105090761 160
315 3300025928 Ga0207700_11026274 Ga0207700_110262742 160
316 3300025931 Ga0207644_10211797 Ga0207644_102117973 160
317 3300025931 Ga0207644_10260170 Ga0207644_102601702 160
318 3300025931 Ga0207644_10520824 Ga0207644_105208242 160
319 3300025932 Ga0207690_10473766 Ga0207690_104737662 160
320 3300025933 Ga0207706_10004218 Ga0207706_100042186 160
321 3300025934 Ga0207686_10082090 Ga0207686_100820902 160
322 3300025935 Ga0207709_10001915 Ga0207709_100019155 160
323 3300025935 Ga0207709_10043270 Ga0207709_100432703 160
324 3300025936 Ga0207670_10038174 Ga0207670_100381742 160
325 3300025937 Ga0207669_10057741 Ga0207669_100577412 160
326 3300025937 Ga0207669_10093064 Ga0207669_100930642 160
327 3300025937 Ga0207669_10818566 Ga0207669_108185661 160
328 3300025938 Ga0207704_10014473 Ga0207704_100144732 160
329 3300025938 Ga0207704_10318723 Ga0207704_103187232 160
330 3300025939 Ga0207665_10002735 Ga0207665_1000273511 160
331 3300025939 Ga0207665_10019187 Ga0207665_100191872 160
332 3300025940 Ga0207691_10038812 Ga0207691_100388126 160
333 3300025941 Ga0207711_10588181 Ga0207711_105881811 160
334 3300025941 Ga0207711_10748616 Ga0207711_107486161 160
335 3300025942 Ga0207689_10009672 Ga0207689_100096726 160
336 3300025942 Ga0207689_10018530 Ga0207689_100185303 160
337 3300025949 Ga0207667_10264003 Ga0207667_102640032 160
338 3300025960 Ga0207651_10108230 Ga0207651_101082303 160
339 3300025961 Ga0207712_10024596 Ga0207712_100245964 160
340 3300025961 Ga0207712_10273195 Ga0207712_102731952 160
341 3300025972 Ga0207668_10016700 Ga0207668_100167002 160
342 3300025972 Ga0207668_10280482 Ga0207668_102804821 160
343 3300025972 Ga0207668_10511930 Ga0207668_105119301 160
344 3300025972 Ga0207668_10595705 Ga0207668_105957052 160
345 3300025981 Ga0207640_10147328 Ga0207640_101473283 160
346 3300025986 Ga0207658_10007021 Ga0207658_100070212 160
347 3300025986 Ga0207658_10097389 Ga0207658_100973892 160
348 3300025986 Ga0207658_10442166 Ga0207658_104421661 160
349 3300025986 Ga0207658_11132288 Ga0207658_111322881 160
350 3300026035 Ga0207703_10121918 Ga0207703_101219182 160
351 3300026041 Ga0207639_10034325 Ga0207639_100343255 160
352 3300026041 Ga0207639_10063197 Ga0207639_100631972 160
353 3300026067 Ga0207678_10006719 Ga0207678_100067197 160
354 3300026067 Ga0207678_10010674 Ga0207678_100106745 160
355 3300026067 Ga0207678_10029794 Ga0207678_100297944 160
356 3300026067 Ga0207678_10462565 Ga0207678_104625652 160
357 3300026075 Ga0207708_10001625 Ga0207708_1000162514 160
358 3300026075 Ga0207708_10021001 Ga0207708_100210012 160
359 3300026075 Ga0207708_10124926 Ga0207708_101249262 160
360 3300026088 Ga0207641_10177202 Ga0207641_101772022 160
361 3300026088 Ga0207641_10220024 Ga0207641_102200242 160
362 3300026089 Ga0207648_10003286 Ga0207648_100032868 160
363 3300026089 Ga0207648_10013165 Ga0207648_100131655 160
364 3300026095 Ga0207676_11474149 Ga0207676_114741491 160
365 3300026118 Ga0207675_100000865 Ga0207675_10000086520 160
366 3300026118 Ga0207675_100046529 Ga0207675_1000465295 160
367 3300026121 Ga0207683_10000809 Ga0207683_1000080911 160
368 3300026121 Ga0207683_10026106 Ga0207683_100261065 160
369 3300026142 Ga0207698_10115899 Ga0207698_101158992 160
370 3300027866 Ga0209813_10070972 Ga0209813_100709722 160
371 3300027907 Ga0207428_10444578 Ga0207428_104445781 160
372 3300028379 Ga0268266_10110122 Ga0268266_101101222 160
373 3300028379 Ga0268266_10178427 Ga0268266_101784272 160
374 3300028380 Ga0268265_10039940 Ga0268265_100399404 160
375 3300028380 Ga0268265_10057367 Ga0268265_100573672 160
376 3300028380 Ga0268265_10499969 Ga0268265_104999692 160
377 3300028381 Ga0268264_10147808 Ga0268264_101478083 160
378 3300031731 Ga0307405_10117143 Ga0307405_101171432 160
379 3300031901 Ga0307406_10659314 Ga0307406_106593142 160
380 3300031995 Ga0307409_100032487 Ga0307409_1000324873 160
381 3300031995 Ga0307409_100174892 Ga0307409_1001748923 160
382 3300032002 Ga0307416_100265404 Ga0307416_1002654043 160
383 3300032126 Ga0307415_100177607 Ga0307415_1001776073 160
384 3300035091 Ga0373951_0058952 Ga0373951_0058952_206_688 160
385 3300035114 Ga0373939_0022785 Ga0373939_0022785_890_1372 160
386 3300035115 Ga0373941_0069973 Ga0373941_0069973_13_495 160
387 3300035691 Ga0373931_0047646 Ga0373931_0047646_1503_1985 160
388 3300035691 Ga0373931_0282662 Ga0373931_0282662_260_742 160
389 3300041410 Ga0439461_0000467 Ga0439461_0000467_1399_1881 160
390 3300041411 Ga0439466_0010698 Ga0439466_0010698_195_677 160
391 3300041411 Ga0439466_0015202 Ga0439466_0015202_1803_2285 160
392 3300041411 Ga0439466_0032917 Ga0439466_0032917_318_800 160
393 3300041413 Ga0439465_0003631 Ga0439465_0003631_909_1391 160
394 3300041413 Ga0439465_0005880 Ga0439465_0005880_381_863 160
395 3300041413 Ga0439465_0014870 Ga0439465_0014870_1141_1623 160
396 3300041443 Ga0451789_0514195 Ga0451789_0514195_112_594 160
397 3300041997 Ga0439431_0017060 Ga0439431_0017060_1163_1645 160
398 3300041997 Ga0439431_0155220 Ga0439431_0155220_148_630 160
399 3300042002 Ga0439442_015874 Ga0439442_015874_966_1448 160
400 3300042002 Ga0439442_103041 Ga0439442_103041_74_556 160
401 3300042004 Ga0439445_0006614 Ga0439445_0006614_1419_1901 160
402 3300042004 Ga0439445_0042833 Ga0439445_0042833_507_989 160
403 3300042004 Ga0439445_0052436 Ga0439445_0052436_79_561 160
404 3300042013 Ga0439456_031921 Ga0439456_031921_195_677 160
405 3300042435 Ga0439434_0042362 Ga0439434_0042362_639_1121 160
406 3300044658 Ga0466972_0004347 Ga0466972_0004347_3327_3809 160
407 3300044658 Ga0466972_0031476 Ga0466972_0031476_611_1093 160
408 3300044658 Ga0466972_0051934 Ga0466972_0051934_1345_1827 160
409 3300044658 Ga0466972_0060518 Ga0466972_0060518_662_1144 160
410 3300044658 Ga0466972_0125285 Ga0466972_0125285_279_761 160
411 3300044683 Ga0466965_0000919 Ga0466965_0000919_3159_3641 160
412 3300044683 Ga0466965_0001880 Ga0466965_0001880_2707_3189 160
413 3300044683 Ga0466965_0082069 Ga0466965_0082069_796_1278 160
414 3300044684 Ga0466966_0080762 Ga0466966_0080762_48_530 160
415 3300044694 Ga0466963_0760679 Ga0466963_0760679_185_667 160
416 3300044719 Ga0466971_0080261 Ga0466971_0080261_144_626 160
417 3300044735 Ga0466968_0003050 Ga0466968_0003050_2385_2867 160
418 3300044735 Ga0466968_0090149 Ga0466968_0090149_248_730 160
419 3300044765 Ga0466970_0023720 Ga0466970_0023720_1003_1485 160
420 3300044765 Ga0466970_0050590 Ga0466970_0050590_1193_1675 160
421 3300044842 Ga0466957_0002631 Ga0466957_0002631_2385_2867 160
422 3300044842 Ga0466957_0195713 Ga0466957_0195713_778_1260 160
423 3300044901 Ga0466960_0002634 Ga0466960_0002634_4872_5354 160
424 3300044901 Ga0466960_0139675 Ga0466960_0139675_377_859 160
425 3300044901 Ga0466960_0552108 Ga0466960_0552108_143_625 160
426 3300045049 Ga0466959_0055480 Ga0466959_0055480_1855_2337 160
427 3300045049 Ga0466959_0062672 Ga0466959_0062672_1279_1761 160
428 3300045836 Ga0466958_0166164 Ga0466958_0166164_65_547 160
429 3300045976 Ga0466967_0050122 Ga0466967_0050122_2740_3222 160
430 3300045976 Ga0466967_0133115 Ga0466967_0133115_695_1177 160
431 3300045976 Ga0466967_0270439 Ga0466967_0270439_651_1133 160
432 3300045976 Ga0466967_0536814 Ga0466967_0536814_411_893 160
433 3300045976 Ga0466967_1300660 Ga0466967_1300660_65_547 160
434 3300045976 Ga0466967_1813665 Ga0466967_1813665_65_547 160
435 3300046694 Ga0495649_0106131 Ga0495649_0106131_347_829 160
436 3300047320 Ga0495672_0305970 Ga0495672_0305970_133_615 160
437 3300048903 Ga0496100_0010375 Ga0496100_0010375_3522_4004 160
438 3300048903 Ga0496100_0325317 Ga0496100_0325317_212_694 160
439 3300048903 Ga0496100_0421494 Ga0496100_0421494_244_726 160
440 3300048904 Ga0496101_0001680 Ga0496101_0001680_11046_11528 160
441 3300048904 Ga0496101_0020787 Ga0496101_0020787_233_715 160
442 3300048904 Ga0496101_0053557 Ga0496101_0053557_2096_2578 160
443 3300048904 Ga0496101_0081136 Ga0496101_0081136_238_720 160
444 3300048904 Ga0496101_0305920 Ga0496101_0305920_424_951 160
445 3300048905 Ga0496102_0006724 Ga0496102_0006724_7066_7548 160
446 3300048905 Ga0496102_0108779 Ga0496102_0108779_1462_1944 160
447 3300048905 Ga0496102_0187821 Ga0496102_0187821_1314_1796 160
448 3300048905 Ga0496102_0511346 Ga0496102_0511346_418_912 160
449 3300048906 Ga0496103_0001002 Ga0496103_0001002_9460_9942 160
450 3300048907 Ga0496104_0027137 Ga0496104_0027137_2186_2668 160
451 3300048907 Ga0496104_0334999 Ga0496104_0334999_105_587 160
452 3300048907 Ga0496104_0352322 Ga0496104_0352322_79_561 160
453 3300048908 Ga0496105_0058475 Ga0496105_0058475_1839_2321 160
454 3300048908 Ga0496105_0449509 Ga0496105_0449509_290_772 160
455 3300048909 Ga0496106_0000506 Ga0496106_0000506_25151_25633 160
456 3300048909 Ga0496106_0044144 Ga0496106_0044144_1179_1661 160
457 3300048909 Ga0496106_1520919 Ga0496106_1520919_19_501 160
458 3300048910 Ga0496107_0007237 Ga0496107_0007237_583_1065 160
459 3300048910 Ga0496107_0154391 Ga0496107_0154391_563_1045 160
460 3300048910 Ga0496107_0503604 Ga0496107_0503604_386_868 160
461 3300048910 Ga0496107_0604094 Ga0496107_0604094_70_552 160
462 3300048911 Ga0496108_0000189 Ga0496108_0000189_29483_29965 160
463 3300048911 Ga0496108_0007870 Ga0496108_0007870_1114_1596 160
464 3300048911 Ga0496108_0012395 Ga0496108_0012395_4588_5115 160
465 3300048911 Ga0496108_0120843 Ga0496108_0120843_213_695 160
466 3300048912 Ga0496109_0016352 Ga0496109_0016352_392_874 160
467 3300048912 Ga0496109_0025441 Ga0496109_0025441_1843_2325 160
468 3300048912 Ga0496109_0392989 Ga0496109_0392989_99_581 160
469 3300048913 Ga0496110_0039908 Ga0496110_0039908_3419_3901 160
470 3300048913 Ga0496110_0054698 Ga0496110_0054698_2697_3179 160
471 3300048913 Ga0496110_0129296 Ga0496110_0129296_237_719 160
472 3300048913 Ga0496110_0749954 Ga0496110_0749954_301_783 160
473 3300048914 Ga0496111_0037288 Ga0496111_0037288_2245_2727 160
474 3300048915 Ga0496112_0024551 Ga0496112_0024551_2841_3323 160
475 3300048915 Ga0496112_0031220 Ga0496112_0031220_4549_5031 160
476 3300048915 Ga0496112_0075939 Ga0496112_0075939_1406_1888 160
477 3300048915 Ga0496112_0111644 Ga0496112_0111644_1774_2256 160
478 3300048915 Ga0496112_0230938 Ga0496112_0230938_1055_1537 160
479 3300048916 Ga0496113_0299034 Ga0496113_0299034_289_771 160
480 3300048916 Ga0496113_0655846 Ga0496113_0655846_15_497 160
481 3300048917 Ga0496114_0005432 Ga0496114_0005432_337_819 160
482 3300048917 Ga0496114_0381502 Ga0496114_0381502_312_839 160
483 3300048918 Ga0496115_0002308 Ga0496115_0002308_3171_3653 160
484 3300048925 Ga0496122_0009690 Ga0496122_0009690_5154_5636 160
485 3300048926 Ga0496123_0114746 Ga0496123_0114746_927_1409 160
486 3300048929 Ga0496126_0007614 Ga0496126_0007614_10767_11249 160
487 3300049571 Ga0501034_0036205 Ga0501034_0036205_2701_3183 160
488 3300049571 Ga0501034_0320971 Ga0501034_0320971_50_532 160
489 3300049581 Ga0501047_0339953 Ga0501047_0339953_772_1254 160
490 3300049584 Ga0501068_0406000 Ga0501068_0406000_138_620 160
491 3300049586 Ga0501070_0025856 Ga0501070_0025856_3237_3719 160
492 3300049588 Ga0501072_0956058 Ga0501072_0956058_66_548 160
493 3300049823 Ga0501044_0707112 Ga0501044_0707112_74_556 160
494 3300050489 nmdc:mga03683_28646_c1 nmdc:mga03683_28646_c1_467_949 160
495 3300050489 nmdc:mga03683_418569_c1 nmdc:mga03683_418569_c1_14_496 160
496 3300050490 nmdc:mga03n38_10208_c1 nmdc:mga03n38_10208_c1_1699_2181 160
497 3300050490 nmdc:mga03n38_119322_c1 nmdc:mga03n38_119322_c1_440_922 160
498 3300050490 nmdc:mga03n38_132275_c1 nmdc:mga03n38_132275_c1_137_619 160
499 3300050490 nmdc:mga03n38_165275_c1 nmdc:mga03n38_165275_c1_134_637 160
500 3300050490 nmdc:mga03n38_17766_c1 nmdc:mga03n38_17766_c1_2127_2609 160
501 3300050490 nmdc:mga03n38_184758_c1 nmdc:mga03n38_184758_c1_347_829 160
502 3300050490 nmdc:mga03n38_240177_c1 nmdc:mga03n38_240177_c1_345_827 160
503 3300050490 nmdc:mga03n38_65725_c1 nmdc:mga03n38_65725_c1_509_991 160
504 3300050490 nmdc:mga03n38_6860_c1 nmdc:mga03n38_6860_c1_2738_3220 160
505 3300050490 nmdc:mga03n38_75393_c1 nmdc:mga03n38_75393_c1_442_924 160
506 3300050490 nmdc:mga03n38_82061_c1 nmdc:mga03n38_82061_c1_875_1357 160
507 3300050491 nmdc:mga00v17_10756_c1 nmdc:mga00v17_10756_c1_4247_4729 160
508 3300050491 nmdc:mga00v17_19691_c1 nmdc:mga00v17_19691_c1_1402_1884 160
509 3300050491 nmdc:mga00v17_53901_c1 nmdc:mga00v17_53901_c1_1599_2081 160
510 3300050491 nmdc:mga00v17_7018_c1 nmdc:mga00v17_7018_c1_1530_2012 160
511 3300050491 nmdc:mga00v17_771781_c1 nmdc:mga00v17_771781_c1_31_513 160
512 3300050491 nmdc:mga00v17_787169_c1 nmdc:mga00v17_787169_c1_19_501 160
513 3300050492 nmdc:mga0yw44_133195_c1 nmdc:mga0yw44_133195_c1_271_753 160
514 3300050492 nmdc:mga0yw44_24242_c1 nmdc:mga0yw44_24242_c1_2721_3203 160
515 3300050492 nmdc:mga0yw44_38854_c1 nmdc:mga0yw44_38854_c1_1688_2170 160
516 3300050492 nmdc:mga0yw44_46010_c1 nmdc:mga0yw44_46010_c1_1991_2473 160
517 3300050492 nmdc:mga0yw44_93720_c1 nmdc:mga0yw44_93720_c1_603_1085 160
518 3300050494 nmdc:mga06z11_163669_c1 nmdc:mga06z11_163669_c1_776_1258 160
519 3300050494 nmdc:mga06z11_166843_c1 nmdc:mga06z11_166843_c1_107_589 160
520 3300050494 nmdc:mga06z11_256609_c1 nmdc:mga06z11_256609_c1_261_743 160
521 3300050494 nmdc:mga06z11_290878_c1 nmdc:mga06z11_290878_c1_36_518 160
522 3300050495 nmdc:mga04h51_116870_c1 nmdc:mga04h51_116870_c1_335_817 160
523 3300050496 nmdc:mga07m45_149607_c1 nmdc:mga07m45_149607_c1_179_661 160
524 3300050496 nmdc:mga07m45_23734_c1 nmdc:mga07m45_23734_c1_177_659 160
525 3300050496 nmdc:mga07m45_29879_c1 nmdc:mga07m45_29879_c1_548_1030 160
526 3300050496 nmdc:mga07m45_410588_c1 nmdc:mga07m45_410588_c1_250_732 160
527 3300050507 nmdc:mga05p37_550920_c1 nmdc:mga05p37_550920_c1_60_542 160
528 3300050509 nmdc:mga0qj67_157913_c1 nmdc:mga0qj67_157913_c1_771_1253 160
529 3300050509 nmdc:mga0qj67_71871_c1 nmdc:mga0qj67_71871_c1_233_715 160
530 3300050516 nmdc:mga0sz30_135478_c1 nmdc:mga0sz30_135478_c1_358_840 160
531 3300050516 nmdc:mga0sz30_144825_c1 nmdc:mga0sz30_144825_c1_290_772 160
532 3300050516 nmdc:mga0sz30_8036_c2 nmdc:mga0sz30_8036_c2_1512_1994 160
533 3300050516 nmdc:mga0sz30_8890_c1 nmdc:mga0sz30_8890_c1_2933_3415 160
534 3300053083 Ga0495655_0006375 Ga0495655_0006375_283_765 160

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vdu-assembly3.cif.gz_D structure of trm8-trm82, the yeast trna m7g methylation complex 0.5093 59 108
2vdu-assembly2.cif.gz_B structure of trm8-trm82, the yeast trna m7g methylation complex 0.509 59 108
5g04-assembly1.cif.gz_A structure of the human apc-cdc20-hsl1 complex 0.5029 56 107
6wxu-assembly1.cif.gz_D cryoem structure of mouse duox1-duoxa1 complex in the dimer-of-dimer state 0.502 34 86
6wxv-assembly1.cif.gz_B cryoem structure of mouse duox1-duoxa1 complex in the presence of nadph 0.4924 34 86
ID Description Score Start End Superfamily
af_O07234_1_160_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9561 1 160 2.30.29.30
af_Q58949_16_254_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5336 59 107 2.130.10.10
af_A0A0G2K9M5_145_249_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5056 14 134 2.30.29.30
af_K7MHP5_99_389_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.5004 12 107 2.120.10.80
af_Q18966_3_89_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.4978 23 90 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A7W5SQ28-F1-model_v4 deleted 0.9919 2 160
AF-A0A7I9XW54-F1-model_v4 DUF4166 domain-containing protein 0.9868 1 160
AF-A0A7I9XW54-F1-model_v4 DUF4166 domain-containing protein 0.9807 1 160
AF-A0A7W5SQ28-F1-model_v4 deleted 0.9796 2 160
AF-A0A1C2B9A5-F1-model_v4 deleted 0.9791 9 159

Feature Viewer

pLDDT pTM Quality
93.19 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map