F460552
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 534 | 236 | 504 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300032126|Ga0307415_100177607|Ga0307415_1001776073 |
| Length | 194 |
| Sequence | MSWRVSVAHAGFRCPAEVRLQRPSDPSRLSYGACMAVFLRKLLRIGGLPAELRAEVEAEGVIYVAEYVPVTRRFSGKIPGKRAHGNVASYVGALALTNQRILGTLSTVPKLAGRTIDQPWSAPQSGTVNADISEAGLHLEVNISAVDPRCQGQLSLQYKTPIPPEVLTRVPRRSLAFDVPPEYVFRAVGVPYHP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 2 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 3 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 4 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 179 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 180 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 181 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 183 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 184 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 185 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 186 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 218 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 227 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 228 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 229 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 230 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 231 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 232 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 236 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0 |
| Isolates | 0.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.28 |
| Nodule | 0 |
| Rhizoplane | 8.99 |
| Rhizosphere | 67.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1010399 | 3300002073 | Bacteria | 1058 |
| 2 | JGI24748J21848_1008174 | 3300002074 | Bacteria | 1229 |
| 3 | JGI24738J21930_10054665 | 3300002075 | Bacteria | 815 |
| 4 | JGI24744J21845_10001674 | 3300002077 | Bacteria | 4437 |
| 5 | JGI24744J21845_10035231 | 3300002077 | Bacteria | 947 |
| 6 | JGI24034J26672_10031307 | 3300002239 | Bacteria | 868 |
| 7 | Ga0070676_10054780 | 3300005328 | Bacteria | 2352 |
| 8 | Ga0070690_100125084 | 3300005330 | Bacteria | 1730 |
| 9 | Ga0070670_100287200 | 3300005331 | Bacteria | 1437 |
| 10 | Ga0070677_10115618 | 3300005333 | Bacteria | 1204 |
| 11 | Ga0068869_100006215 | 3300005334 | Bacteria | 7561 |
| 12 | Ga0068869_101388847 | 3300005334 | Bacteria | 621 |
| 13 | Ga0070666_10052095 | 3300005335 | Bacteria | 2758 |
| 14 | Ga0070666_10182197 | 3300005335 | Bacteria | 1473 |
| 15 | Ga0070680_100460917 | 3300005336 | Bacteria | 1086 |
| 16 | Ga0070682_100114675 | 3300005337 | Bacteria | 1801 |
| 17 | Ga0068868_100006676 | 3300005338 | Bacteria | 8189 |
| 18 | Ga0070660_100106718 | 3300005339 | Bacteria | 2224 |
| 19 | Ga0070689_100003095 | 3300005340 | Bacteria | 10976 |
| 20 | Ga0070687_100417257 | 3300005343 | Bacteria | 884 |
| 21 | Ga0070661_100471877 | 3300005344 | Bacteria | 1001 |
| 22 | Ga0070692_11140604 | 3300005345 | Bacteria | 552 |
| 23 | Ga0070668_100050371 | 3300005347 | Bacteria | 3206 |
| 24 | Ga0070668_100171388 | 3300005347 | Bacteria | 1767 |
| 25 | Ga0070668_100290762 | 3300005347 | Bacteria | 1368 |
| 26 | Ga0070668_100355870 | 3300005347 | Bacteria | 1240 |
| 27 | Ga0070669_100037509 | 3300005353 | Bacteria | 3516 |
| 28 | Ga0070675_100014586 | 3300005354 | Bacteria | 6196 |
| 29 | Ga0070671_100004325 | 3300005355 | Bacteria | 11237 |
| 30 | Ga0070671_100113477 | 3300005355 | Bacteria | 2277 |
| 31 | Ga0070671_100412113 | 3300005355 | Bacteria | 1157 |
| 32 | Ga0070674_100031357 | 3300005356 | Bacteria | 3522 |
| 33 | Ga0070674_100246759 | 3300005356 | Bacteria | 1400 |
| 34 | Ga0070674_100251921 | 3300005356 | Unclassified | 1387 |
| 35 | Ga0070673_100122317 | 3300005364 | Bacteria | 2173 |
| 36 | Ga0070673_100201049 | 3300005364 | Bacteria | 1716 |
| 37 | Ga0070659_100180920 | 3300005366 | Bacteria | 1730 |
| 38 | Ga0070659_100850684 | 3300005366 | Bacteria | 795 |
| 39 | Ga0070667_100020189 | 3300005367 | Bacteria | 5531 |
| 40 | Ga0070667_100137782 | 3300005367 | Bacteria | 2135 |
| 41 | Ga0070667_100145764 | 3300005367 | Bacteria | 2076 |
| 42 | Ga0070709_10001138 | 3300005434 | Bacteria | 14658 |
| 43 | Ga0070709_10099956 | 3300005434 | Bacteria | 1931 |
| 44 | Ga0070714_100125074 | 3300005435 | Bacteria | 2291 |
| 45 | Ga0070710_10008017 | 3300005437 | Bacteria | 5134 |
| 46 | Ga0070710_10010338 | 3300005437 | Bacteria | 4583 |
| 47 | Ga0070701_10000574 | 3300005438 | Bacteria | 12789 |
| 48 | Ga0070701_10650231 | 3300005438 | Bacteria | 704 |
| 49 | Ga0070711_100001370 | 3300005439 | Bacteria | 13312 |
| 50 | Ga0070711_100009214 | 3300005439 | Bacteria | 6069 |
| 51 | Ga0070705_100096175 | 3300005440 | Bacteria | 1859 |
| 52 | Ga0070700_100009041 | 3300005441 | Bacteria | 5458 |
| 53 | Ga0070700_100059079 | 3300005441 | Bacteria | 2412 |
| 54 | Ga0070700_100125173 | 3300005441 | Bacteria | 1727 |
| 55 | Ga0070694_100017618 | 3300005444 | Bacteria | 4517 |
| 56 | Ga0070694_100569900 | 3300005444 | Bacteria | 909 |
| 57 | Ga0070663_100028239 | 3300005455 | Bacteria | 3818 |
| 58 | Ga0070663_100064115 | 3300005455 | Bacteria | 2655 |
| 59 | Ga0070678_100007637 | 3300005456 | Bacteria | 6426 |
| 60 | Ga0070678_100573657 | 3300005456 | Bacteria | 1004 |
| 61 | Ga0070662_100002522 | 3300005457 | Bacteria | 11280 |
| 62 | Ga0070662_100336214 | 3300005457 | Bacteria | 1234 |
| 63 | Ga0068867_100002753 | 3300005459 | Bacteria | 12389 |
| 64 | Ga0068867_100105904 | 3300005459 | Bacteria | 2154 |
| 65 | Ga0070685_10277155 | 3300005466 | Bacteria | 1121 |
| 66 | Ga0070707_100921757 | 3300005468 | Bacteria | 838 |
| 67 | Ga0070684_100184190 | 3300005535 | Bacteria | 1899 |
| 68 | Ga0068853_100007969 | 3300005539 | Bacteria | 8494 |
| 69 | Ga0068853_101338667 | 3300005539 | Bacteria | 692 |
| 70 | Ga0070672_100016053 | 3300005543 | Bacteria | 5353 |
| 71 | Ga0070686_100127240 | 3300005544 | Bacteria | 1757 |
| 72 | Ga0070686_101493950 | 3300005544 | Bacteria | 569 |
| 73 | Ga0070695_100017923 | 3300005545 | Bacteria | 4296 |
| 74 | Ga0070695_100103188 | 3300005545 | Bacteria | 1924 |
| 75 | Ga0070696_100002819 | 3300005546 | Bacteria | 11548 |
| 76 | Ga0070696_100091608 | 3300005546 | Bacteria | 2165 |
| 77 | Ga0070693_100030732 | 3300005547 | Bacteria | 2939 |
| 78 | Ga0070665_100006270 | 3300005548 | Bacteria | 12155 |
| 79 | Ga0070665_100106009 | 3300005548 | Bacteria | 2813 |
| 80 | Ga0070665_101212700 | 3300005548 | Bacteria | 765 |
| 81 | Ga0070665_101864143 | 3300005548 | Bacteria | 607 |
| 82 | Ga0070704_100000324 | 3300005549 | Bacteria | 21508 |
| 83 | Ga0070704_100149875 | 3300005549 | Bacteria | 1832 |
| 84 | Ga0070704_100701865 | 3300005549 | Bacteria | 897 |
| 85 | Ga0068855_100028591 | 3300005563 | Bacteria | 6671 |
| 86 | Ga0068855_100243442 | 3300005563 | Bacteria | 2009 |
| 87 | Ga0068854_100005612 | 3300005578 | Bacteria | 7930 |
| 88 | Ga0070702_100134713 | 3300005615 | Bacteria | 1565 |
| 89 | Ga0070702_101307367 | 3300005615 | Bacteria | 589 |
| 90 | Ga0068859_100007033 | 3300005617 | Bacteria | 11425 |
| 91 | Ga0068859_100072184 | 3300005617 | Bacteria | 3488 |
| 92 | Ga0068859_100250774 | 3300005617 | Bacteria | 1861 |
| 93 | Ga0068864_100101488 | 3300005618 | Bacteria | 2552 |
| 94 | Ga0068864_100141541 | 3300005618 | Bacteria | 2170 |
| 95 | Ga0068864_101681394 | 3300005618 | Bacteria | 639 |
| 96 | Ga0068866_10000937 | 3300005718 | Bacteria | 12824 |
| 97 | Ga0068866_10117836 | 3300005718 | Bacteria | 1491 |
| 98 | Ga0068861_100006110 | 3300005719 | Bacteria | 8195 |
| 99 | Ga0068861_100087465 | 3300005719 | Bacteria | 2452 |
| 100 | Ga0068851_10071868 | 3300005834 | Bacteria | 1791 |
| 101 | Ga0068851_10103170 | 3300005834 | Bacteria | 1515 |
| 102 | Ga0068870_10181439 | 3300005840 | Bacteria | 1264 |
| 103 | Ga0068863_100118854 | 3300005841 | Bacteria | 2519 |
| 104 | Ga0068863_100125657 | 3300005841 | Bacteria | 2447 |
| 105 | Ga0068858_100040452 | 3300005842 | Bacteria | 4323 |
| 106 | Ga0068858_100282183 | 3300005842 | Bacteria | 1582 |
| 107 | Ga0068860_100006774 | 3300005843 | Bacteria | 11490 |
| 108 | Ga0068860_100193726 | 3300005843 | Bacteria | 1967 |
| 109 | Ga0068862_100000958 | 3300005844 | Bacteria | 27782 |
| 110 | Ga0068862_100116575 | 3300005844 | Bacteria | 2350 |
| 111 | Ga0081455_10148508 | 3300005937 | Bacteria | 1810 |
| 112 | Ga0075365_10111430 | 3300006038 | Bacteria | 1881 |
| 113 | Ga0075365_10302580 | 3300006038 | Bacteria | 1126 |
| 114 | Ga0075365_10312323 | 3300006038 | Bacteria | 1106 |
| 115 | Ga0075365_10323755 | 3300006038 | Bacteria | 1086 |
| 116 | Ga0075365_10599454 | 3300006038 | Bacteria | 779 |
| 117 | Ga0075365_10688057 | 3300006038 | Bacteria | 722 |
| 118 | Ga0075368_10261286 | 3300006042 | Bacteria | 741 |
| 119 | Ga0075363_100005917 | 3300006048 | Bacteria | 5509 |
| 120 | Ga0075363_100007024 | 3300006048 | Bacteria | 5148 |
| 121 | Ga0075363_100008869 | 3300006048 | Bacteria | 4706 |
| 122 | Ga0075363_100018022 | 3300006048 | Bacteria | 3511 |
| 123 | Ga0075363_100033601 | 3300006048 | Bacteria | 2672 |
| 124 | Ga0075363_100101785 | 3300006048 | Bacteria | 1590 |
| 125 | Ga0075363_100209879 | 3300006048 | Bacteria | 1114 |
| 126 | Ga0075363_100215068 | 3300006048 | Bacteria | 1101 |
| 127 | Ga0075363_100250334 | 3300006048 | Bacteria | 1020 |
| 128 | Ga0075363_100346034 | 3300006048 | Bacteria | 868 |
| 129 | Ga0075363_100385522 | 3300006048 | Bacteria | 822 |
| 130 | Ga0075364_10009147 | 3300006051 | Bacteria | 5933 |
| 131 | Ga0075364_10104238 | 3300006051 | Bacteria | 1889 |
| 132 | Ga0075364_10118431 | 3300006051 | Bacteria | 1771 |
| 133 | Ga0075364_10157154 | 3300006051 | Bacteria | 1534 |
| 134 | Ga0075364_10169707 | 3300006051 | Bacteria | 1475 |
| 135 | Ga0075364_10189817 | 3300006051 | Bacteria | 1391 |
| 136 | Ga0075364_10268338 | 3300006051 | Bacteria | 1160 |
| 137 | Ga0075364_10329849 | 3300006051 | Bacteria | 1039 |
| 138 | Ga0075364_10964050 | 3300006051 | Bacteria | 580 |
| 139 | Ga0070715_10043152 | 3300006163 | Bacteria | 1900 |
| 140 | Ga0070716_100007252 | 3300006173 | Bacteria | 5452 |
| 141 | Ga0070712_100002027 | 3300006175 | Bacteria | 12411 |
| 142 | Ga0070712_100048808 | 3300006175 | Bacteria | 2936 |
| 143 | Ga0070712_100892180 | 3300006175 | Bacteria | 766 |
| 144 | Ga0075362_10008884 | 3300006177 | Bacteria | 3862 |
| 145 | Ga0075362_10027289 | 3300006177 | Bacteria | 2444 |
| 146 | Ga0075362_10104827 | 3300006177 | Bacteria | 1326 |
| 147 | Ga0075362_10401649 | 3300006177 | Bacteria | 691 |
| 148 | Ga0075367_10294888 | 3300006178 | Bacteria | 1020 |
| 149 | Ga0075367_10367520 | 3300006178 | Bacteria | 908 |
| 150 | Ga0075369_10014637 | 3300006186 | Bacteria | 3137 |
| 151 | Ga0075369_10017408 | 3300006186 | Bacteria | 2912 |
| 152 | Ga0075369_10018470 | 3300006186 | Bacteria | 2839 |
| 153 | Ga0075369_10026514 | 3300006186 | Bacteria | 2416 |
| 154 | Ga0075369_10049891 | 3300006186 | Bacteria | 1808 |
| 155 | Ga0075369_10090995 | 3300006186 | Bacteria | 1361 |
| 156 | Ga0075369_10269615 | 3300006186 | Bacteria | 792 |
| 157 | Ga0097621_100188583 | 3300006237 | Bacteria | 1785 |
| 158 | Ga0097621_101248651 | 3300006237 | Bacteria | 701 |
| 159 | Ga0075370_10005807 | 3300006353 | Bacteria | 6165 |
| 160 | Ga0075370_10007772 | 3300006353 | Bacteria | 5478 |
| 161 | Ga0075370_10042561 | 3300006353 | Bacteria | 2566 |
| 162 | Ga0075370_10227946 | 3300006353 | Bacteria | 1102 |
| 163 | Ga0075370_10356929 | 3300006353 | Bacteria | 873 |
| 164 | Ga0075370_10365921 | 3300006353 | Bacteria | 863 |
| 165 | Ga0075370_10838574 | 3300006353 | Bacteria | 561 |
| 166 | Ga0068871_100142331 | 3300006358 | Bacteria | 2040 |
| 167 | Ga0068871_100260723 | 3300006358 | Bacteria | 1512 |
| 168 | Ga0075428_100000609 | 3300006844 | Bacteria | 36516 |
| 169 | Ga0075430_100003543 | 3300006846 | Bacteria | 13073 |
| 170 | Ga0068865_100002876 | 3300006881 | Bacteria | 10258 |
| 171 | Ga0068865_100497927 | 3300006881 | Bacteria | 1015 |
| 172 | Ga0097620_100007032 | 3300006931 | Bacteria | 11425 |
| 173 | Ga0097620_100072185 | 3300006931 | Bacteria | 3488 |
| 174 | Ga0097620_100250783 | 3300006931 | Bacteria | 1861 |
| 175 | Ga0099795_10048313 | 3300007788 | Bacteria | 1540 |
| 176 | Ga0105250_10062121 | 3300009092 | Bacteria | 1502 |
| 177 | Ga0105250_10076367 | 3300009092 | Bacteria | 1355 |
| 178 | Ga0111539_10157924 | 3300009094 | Bacteria | 2653 |
| 179 | Ga0111539_11158659 | 3300009094 | Bacteria | 898 |
| 180 | Ga0105245_10020964 | 3300009098 | Bacteria | 5730 |
| 181 | Ga0105245_10076235 | 3300009098 | Bacteria | 3054 |
| 182 | Ga0105245_10222886 | 3300009098 | Bacteria | 1820 |
| 183 | Ga0105247_10000265 | 3300009101 | Bacteria | 48548 |
| 184 | Ga0105247_10072267 | 3300009101 | Bacteria | 2159 |
| 185 | Ga0105247_10206165 | 3300009101 | Bacteria | 1324 |
| 186 | Ga0114129_11088237 | 3300009147 | Bacteria | 1001 |
| 187 | Ga0105243_10006348 | 3300009148 | Bacteria | 9128 |
| 188 | Ga0105243_10039788 | 3300009148 | Bacteria | 3668 |
| 189 | Ga0105241_10022698 | 3300009174 | Bacteria | 4650 |
| 190 | Ga0105241_10104366 | 3300009174 | Bacteria | 2258 |
| 191 | Ga0105242_10011028 | 3300009176 | Bacteria | 6942 |
| 192 | Ga0105248_10006313 | 3300009177 | Bacteria | 13005 |
| 193 | Ga0105248_10074541 | 3300009177 | Bacteria | 3814 |
| 194 | Ga0105248_10808142 | 3300009177 | Bacteria | 1058 |
| 195 | Ga0105237_10239378 | 3300009545 | Bacteria | 1816 |
| 196 | Ga0105238_10042957 | 3300009551 | Bacteria | 4575 |
| 197 | Ga0105238_10249529 | 3300009551 | Bacteria | 1753 |
| 198 | Ga0105238_10554161 | 3300009551 | Bacteria | 1154 |
| 199 | Ga0105238_11673199 | 3300009551 | Bacteria | 667 |
| 200 | Ga0105249_10000892 | 3300009553 | Bacteria | 26445 |
| 201 | Ga0105249_10055358 | 3300009553 | Bacteria | 3628 |
| 202 | Ga0105249_10337860 | 3300009553 | Bacteria | 1522 |
| 203 | Ga0105249_11480305 | 3300009553 | Bacteria | 751 |
| 204 | Ga0105249_11510893 | 3300009553 | Bacteria | 744 |
| 205 | Ga0099796_10014124 | 3300010159 | Bacteria | 2299 |
| 206 | Ga0105239_10022038 | 3300010375 | Bacteria | 7023 |
| 207 | Ga0105239_10308829 | 3300010375 | Bacteria | 1782 |
| 208 | Ga0105239_10615076 | 3300010375 | Bacteria | 1240 |
| 209 | Ga0105239_11368181 | 3300010375 | Bacteria | 817 |
| 210 | Ga0105239_12142236 | 3300010375 | Bacteria | 650 |
| 211 | Ga0105246_10021209 | 3300011119 | Bacteria | 4178 |
| 212 | Ga0105246_10348744 | 3300011119 | Unclassified | 1212 |
| 213 | Ga0157369_10290005 | 3300013105 | Bacteria | 1704 |
| 214 | Ga0157374_10015517 | 3300013296 | Bacteria | 6682 |
| 215 | Ga0157374_11302228 | 3300013296 | Bacteria | 749 |
| 216 | Ga0157378_10165038 | 3300013297 | Bacteria | 2074 |
| 217 | Ga0163162_10031742 | 3300013306 | Bacteria | 5241 |
| 218 | Ga0163162_10177198 | 3300013306 | Bacteria | 2257 |
| 219 | Ga0163162_10445777 | 3300013306 | Bacteria | 1426 |
| 220 | Ga0163162_11500884 | 3300013306 | Bacteria | 768 |
| 221 | Ga0157372_10005825 | 3300013307 | Bacteria | 13128 |
| 222 | Ga0157372_10147416 | 3300013307 | Bacteria | 2714 |
| 223 | Ga0157372_11988702 | 3300013307 | Bacteria | 668 |
| 224 | Ga0157375_10000760 | 3300013308 | Bacteria | 28299 |
| 225 | Ga0157375_10211227 | 3300013308 | Bacteria | 2098 |
| 226 | Ga0163163_10018765 | 3300014325 | Bacteria | 6483 |
| 227 | Ga0163163_10126290 | 3300014325 | Bacteria | 2596 |
| 228 | Ga0163163_10313420 | 3300014325 | Bacteria | 1622 |
| 229 | Ga0163163_11082338 | 3300014325 | Bacteria | 865 |
| 230 | Ga0163163_11686046 | 3300014325 | Bacteria | 694 |
| 231 | Ga0157380_10001880 | 3300014326 | Bacteria | 13915 |
| 232 | Ga0157380_10325200 | 3300014326 | Bacteria | 1427 |
| 233 | Ga0157377_10021301 | 3300014745 | Bacteria | 3409 |
| 234 | Ga0157379_10019019 | 3300014968 | Bacteria | 6064 |
| 235 | Ga0157379_10078111 | 3300014968 | Bacteria | 2964 |
| 236 | Ga0157379_10466483 | 3300014968 | Bacteria | 1167 |
| 237 | Ga0157379_10628703 | 3300014968 | Unclassified | 1004 |
| 238 | Ga0157376_10374608 | 3300014969 | Bacteria | 1369 |
| 239 | Ga0163161_10071957 | 3300017792 | Bacteria | 2531 |
| 240 | Ga0163161_10091342 | 3300017792 | Bacteria | 2253 |
| 241 | Ga0163161_10248836 | 3300017792 | Bacteria | 1385 |
| 242 | Ga0207653_10091696 | 3300025885 | Bacteria | 1065 |
| 243 | Ga0207692_10033528 | 3300025898 | Bacteria | 2478 |
| 244 | Ga0207692_10080193 | 3300025898 | Bacteria | 1743 |
| 245 | Ga0207642_10000396 | 3300025899 | Bacteria | 13057 |
| 246 | Ga0207710_10008666 | 3300025900 | Bacteria | 4289 |
| 247 | Ga0207688_10000235 | 3300025901 | Bacteria | 25164 |
| 248 | Ga0207688_10001781 | 3300025901 | Bacteria | 11436 |
| 249 | Ga0207680_10043619 | 3300025903 | Bacteria | 2632 |
| 250 | Ga0207647_10043635 | 3300025904 | Bacteria | 2805 |
| 251 | Ga0207647_10264413 | 3300025904 | Bacteria | 984 |
| 252 | Ga0207685_10025585 | 3300025905 | Bacteria | 2040 |
| 253 | Ga0207699_10051379 | 3300025906 | Bacteria | 2435 |
| 254 | Ga0207699_10300252 | 3300025906 | Bacteria | 1121 |
| 255 | Ga0207645_10166151 | 3300025907 | Bacteria | 1445 |
| 256 | Ga0207645_10706260 | 3300025907 | Bacteria | 685 |
| 257 | Ga0207643_10099514 | 3300025908 | Bacteria | 1704 |
| 258 | Ga0207654_10063031 | 3300025911 | Bacteria | 2174 |
| 259 | Ga0207671_10124618 | 3300025914 | Bacteria | 1972 |
| 260 | Ga0207693_10002003 | 3300025915 | Bacteria | 17881 |
| 261 | Ga0207693_10009436 | 3300025915 | Bacteria | 7951 |
| 262 | Ga0207663_10176942 | 3300025916 | Bacteria | 1520 |
| 263 | Ga0207662_10276285 | 3300025918 | Bacteria | 1110 |
| 264 | Ga0207657_10066138 | 3300025919 | Bacteria | 3078 |
| 265 | Ga0207657_10302676 | 3300025919 | Bacteria | 1266 |
| 266 | Ga0207649_10281743 | 3300025920 | Bacteria | 1209 |
| 267 | Ga0207649_11055989 | 3300025920 | Bacteria | 640 |
| 268 | Ga0207646_10632289 | 3300025922 | Bacteria | 959 |
| 269 | Ga0207681_10021138 | 3300025923 | Bacteria | 4132 |
| 270 | Ga0207694_10039624 | 3300025924 | Bacteria | 3626 |
| 271 | Ga0207694_10532576 | 3300025924 | Bacteria | 985 |
| 272 | Ga0207694_11235836 | 3300025924 | Bacteria | 632 |
| 273 | Ga0207687_10203889 | 3300025927 | Bacteria | 1548 |
| 274 | Ga0207687_10509076 | 3300025927 | Bacteria | 1006 |
| 275 | Ga0207700_11026274 | 3300025928 | Bacteria | 738 |
| 276 | Ga0207644_10211797 | 3300025931 | Bacteria | 1533 |
| 277 | Ga0207644_10260170 | 3300025931 | Bacteria | 1387 |
| 278 | Ga0207644_10520824 | 3300025931 | Bacteria | 982 |
| 279 | Ga0207690_10473766 | 3300025932 | Bacteria | 1010 |
| 280 | Ga0207706_10004218 | 3300025933 | Bacteria | 13539 |
| 281 | Ga0207686_10082090 | 3300025934 | Bacteria | 2106 |
| 282 | Ga0207709_10001915 | 3300025935 | Bacteria | 13707 |
| 283 | Ga0207709_10043270 | 3300025935 | Bacteria | 2714 |
| 284 | Ga0207670_10038174 | 3300025936 | Bacteria | 3135 |
| 285 | Ga0207669_10057741 | 3300025937 | Bacteria | 2364 |
| 286 | Ga0207669_10093064 | 3300025937 | Bacteria | 1968 |
| 287 | Ga0207669_10818566 | 3300025937 | Unclassified | 773 |
| 288 | Ga0207704_10014473 | 3300025938 | Bacteria | 3983 |
| 289 | Ga0207704_10318723 | 3300025938 | Bacteria | 1198 |
| 290 | Ga0207665_10002735 | 3300025939 | Bacteria | 11828 |
| 291 | Ga0207665_10019187 | 3300025939 | Bacteria | 4493 |
| 292 | Ga0207691_10038812 | 3300025940 | Bacteria | 4407 |
| 293 | Ga0207711_10588181 | 3300025941 | Bacteria | 1038 |
| 294 | Ga0207711_10748616 | 3300025941 | Bacteria | 911 |
| 295 | Ga0207689_10009672 | 3300025942 | Bacteria | 8307 |
| 296 | Ga0207689_10018530 | 3300025942 | Bacteria | 5873 |
| 297 | Ga0207667_10264003 | 3300025949 | Bacteria | 1761 |
| 298 | Ga0207651_10108230 | 3300025960 | Bacteria | 2080 |
| 299 | Ga0207712_10024596 | 3300025961 | Bacteria | 3991 |
| 300 | Ga0207712_10273195 | 3300025961 | Bacteria | 1376 |
| 301 | Ga0207668_10016700 | 3300025972 | Bacteria | 4586 |
| 302 | Ga0207668_10280482 | 3300025972 | Bacteria | 1366 |
| 303 | Ga0207668_10511930 | 3300025972 | Bacteria | 1034 |
| 304 | Ga0207668_10595705 | 3300025972 | Bacteria | 962 |
| 305 | Ga0207640_10147328 | 3300025981 | Bacteria | 1724 |
| 306 | Ga0207658_10007021 | 3300025986 | Bacteria | 7668 |
| 307 | Ga0207658_10097389 | 3300025986 | Bacteria | 2296 |
| 308 | Ga0207658_10442166 | 3300025986 | Bacteria | 1150 |
| 309 | Ga0207658_11132288 | 3300025986 | Bacteria | 715 |
| 310 | Ga0207703_10121918 | 3300026035 | Bacteria | 2239 |
| 311 | Ga0207639_10034325 | 3300026041 | Bacteria | 3749 |
| 312 | Ga0207639_10063197 | 3300026041 | Bacteria | 2865 |
| 313 | Ga0207678_10006719 | 3300026067 | Bacteria | 10202 |
| 314 | Ga0207678_10010674 | 3300026067 | Bacteria | 8067 |
| 315 | Ga0207678_10029794 | 3300026067 | Bacteria | 4765 |
| 316 | Ga0207678_10462565 | 3300026067 | Bacteria | 1103 |
| 317 | Ga0207708_10001625 | 3300026075 | Bacteria | 16716 |
| 318 | Ga0207708_10021001 | 3300026075 | Bacteria | 4927 |
| 319 | Ga0207708_10124926 | 3300026075 | Bacteria | 2007 |
| 320 | Ga0207641_10177202 | 3300026088 | Bacteria | 1950 |
| 321 | Ga0207641_10220024 | 3300026088 | Bacteria | 1760 |
| 322 | Ga0207648_10003286 | 3300026089 | Bacteria | 17005 |
| 323 | Ga0207648_10013165 | 3300026089 | Bacteria | 7710 |
| 324 | Ga0207676_11474149 | 3300026095 | Bacteria | 677 |
| 325 | Ga0207675_100000865 | 3300026118 | Bacteria | 30240 |
| 326 | Ga0207675_100046529 | 3300026118 | Bacteria | 4054 |
| 327 | Ga0207683_10000809 | 3300026121 | Bacteria | 28622 |
| 328 | Ga0207683_10026106 | 3300026121 | Bacteria | 5042 |
| 329 | Ga0207698_10115899 | 3300026142 | Bacteria | 2257 |
| 330 | Ga0209813_10070972 | 3300027866 | Bacteria | 1132 |
| 331 | Ga0207428_10444578 | 3300027907 | Bacteria | 946 |
| 332 | Ga0268266_10110122 | 3300028379 | Bacteria | 2439 |
| 333 | Ga0268266_10178427 | 3300028379 | Bacteria | 1932 |
| 334 | Ga0268265_10039940 | 3300028380 | Bacteria | 3462 |
| 335 | Ga0268265_10057367 | 3300028380 | Bacteria | 2967 |
| 336 | Ga0268265_10499969 | 3300028380 | Bacteria | 1145 |
| 337 | Ga0268264_10147808 | 3300028381 | Bacteria | 2103 |
| 338 | Ga0268264_12161744 | 3300028381 | Bacteria | 565 |
| 339 | Ga0307405_10117143 | 3300031731 | Bacteria | 1816 |
| 340 | Ga0307406_10659314 | 3300031901 | Bacteria | 869 |
| 341 | Ga0307409_100032487 | 3300031995 | Bacteria | 3785 |
| 342 | Ga0307409_100174892 | 3300031995 | Bacteria | 1894 |
| 343 | Ga0307416_100265404 | 3300032002 | Bacteria | 1681 |
| 344 | Ga0307415_100177607 | 3300032126 | Bacteria | 1667 |
| 345 | Ga0373951_0058952 | 3300035091 | Bacteria | 958 |
| 346 | Ga0373939_0022785 | 3300035114 | Bacteria | 1729 |
| 347 | Ga0373941_0069973 | 3300035115 | Bacteria | 1163 |
| 348 | Ga0373931_0047646 | 3300035691 | Bacteria | 2269 |
| 349 | Ga0373931_0282662 | 3300035691 | Bacteria | 1019 |
| 350 | Ga0439461_0000467 | 3300041410 | Bacteria | 5828 |
| 351 | Ga0439466_0010698 | 3300041411 | Bacteria | 3408 |
| 352 | Ga0439466_0015202 | 3300041411 | Bacteria | 2797 |
| 353 | Ga0439466_0032917 | 3300041411 | Bacteria | 1764 |
| 354 | Ga0439465_0003631 | 3300041413 | Bacteria | 5031 |
| 355 | Ga0439465_0005880 | 3300041413 | Bacteria | 3902 |
| 356 | Ga0439465_0014870 | 3300041413 | Bacteria | 2427 |
| 357 | Ga0451789_0514195 | 3300041443 | Bacteria | 688 |
| 358 | Ga0439431_0017060 | 3300041997 | Bacteria | 1704 |
| 359 | Ga0439431_0155220 | 3300041997 | Bacteria | 652 |
| 360 | Ga0439442_015874 | 3300042002 | Bacteria | 1552 |
| 361 | Ga0439442_103041 | 3300042002 | Bacteria | 619 |
| 362 | Ga0439445_0006614 | 3300042004 | Bacteria | 2667 |
| 363 | Ga0439445_0042833 | 3300042004 | Bacteria | 1207 |
| 364 | Ga0439445_0052436 | 3300042004 | Bacteria | 1103 |
| 365 | Ga0439456_031921 | 3300042013 | Bacteria | 1130 |
| 366 | Ga0439434_0042362 | 3300042435 | Bacteria | 1400 |
| 367 | Ga0466972_0004347 | 3300044658 | Bacteria | 7082 |
| 368 | Ga0466972_0031476 | 3300044658 | Bacteria | 2609 |
| 369 | Ga0466972_0051934 | 3300044658 | Bacteria | 1977 |
| 370 | Ga0466972_0060518 | 3300044658 | Bacteria | 1816 |
| 371 | Ga0466972_0125285 | 3300044658 | Bacteria | 1211 |
| 372 | Ga0466965_0000919 | 3300044683 | Bacteria | 11292 |
| 373 | Ga0466965_0001880 | 3300044683 | Bacteria | 8748 |
| 374 | Ga0466965_0082069 | 3300044683 | Bacteria | 1630 |
| 375 | Ga0466966_0080762 | 3300044684 | Bacteria | 2025 |
| 376 | Ga0466963_0760679 | 3300044694 | Bacteria | 683 |
| 377 | Ga0466971_0080261 | 3300044719 | Bacteria | 1487 |
| 378 | Ga0466968_0003050 | 3300044735 | Bacteria | 6192 |
| 379 | Ga0466968_0090149 | 3300044735 | Bacteria | 1357 |
| 380 | Ga0466970_0023720 | 3300044765 | Bacteria | 3207 |
| 381 | Ga0466970_0050590 | 3300044765 | Bacteria | 2216 |
| 382 | Ga0466957_0002631 | 3300044842 | Bacteria | 9691 |
| 383 | Ga0466957_0195713 | 3300044842 | Bacteria | 1326 |
| 384 | Ga0466960_0002634 | 3300044901 | Bacteria | 6763 |
| 385 | Ga0466960_0139675 | 3300044901 | Bacteria | 1286 |
| 386 | Ga0466960_0552108 | 3300044901 | Bacteria | 679 |
| 387 | Ga0466959_0055480 | 3300045049 | Bacteria | 2892 |
| 388 | Ga0466959_0062672 | 3300045049 | Bacteria | 2701 |
| 389 | Ga0466958_0166164 | 3300045836 | Bacteria | 1396 |
| 390 | Ga0466967_0050122 | 3300045976 | Bacteria | 3655 |
| 391 | Ga0466967_0133115 | 3300045976 | Bacteria | 2310 |
| 392 | Ga0466967_0270439 | 3300045976 | Bacteria | 1628 |
| 393 | Ga0466967_0536814 | 3300045976 | Bacteria | 1150 |
| 394 | Ga0466967_1300660 | 3300045976 | Bacteria | 724 |
| 395 | Ga0466967_1813665 | 3300045976 | Bacteria | 607 |
| 396 | Ga0495649_0106131 | 3300046694 | Bacteria | 1491 |
| 397 | Ga0495672_0305970 | 3300047320 | Bacteria | 751 |
| 398 | Ga0496100_0010375 | 3300048903 | Bacteria | 5270 |
| 399 | Ga0496100_0325317 | 3300048903 | Bacteria | 1156 |
| 400 | Ga0496100_0421494 | 3300048903 | Bacteria | 1019 |
| 401 | Ga0496101_0001680 | 3300048904 | Bacteria | 13263 |
| 402 | Ga0496101_0020787 | 3300048904 | Bacteria | 4502 |
| 403 | Ga0496101_0053557 | 3300048904 | Bacteria | 2912 |
| 404 | Ga0496101_0081136 | 3300048904 | Bacteria | 2398 |
| 405 | Ga0496101_0305920 | 3300048904 | Bacteria | 1246 |
| 406 | Ga0496102_0006724 | 3300048905 | Bacteria | 9821 |
| 407 | Ga0496102_0108779 | 3300048905 | Bacteria | 2582 |
| 408 | Ga0496102_0187821 | 3300048905 | Bacteria | 1947 |
| 409 | Ga0496102_0511346 | 3300048905 | Unclassified | 1123 |
| 410 | Ga0496103_0001002 | 3300048906 | Bacteria | 19780 |
| 411 | Ga0496104_0027137 | 3300048907 | Bacteria | 5297 |
| 412 | Ga0496104_0334999 | 3300048907 | Bacteria | 1426 |
| 413 | Ga0496104_0352322 | 3300048907 | Bacteria | 1385 |
| 414 | Ga0496105_0058475 | 3300048908 | Bacteria | 3182 |
| 415 | Ga0496105_0449509 | 3300048908 | Bacteria | 1017 |
| 416 | Ga0496106_0000506 | 3300048909 | Bacteria | 27628 |
| 417 | Ga0496106_0044144 | 3300048909 | Bacteria | 3345 |
| 418 | Ga0496106_1520919 | 3300048909 | Bacteria | 514 |
| 419 | Ga0496107_0007237 | 3300048910 | Bacteria | 7646 |
| 420 | Ga0496107_0154391 | 3300048910 | Bacteria | 1699 |
| 421 | Ga0496107_0503604 | 3300048910 | Bacteria | 898 |
| 422 | Ga0496107_0604094 | 3300048910 | Bacteria | 811 |
| 423 | Ga0496108_0000189 | 3300048911 | Bacteria | 57428 |
| 424 | Ga0496108_0007870 | 3300048911 | Bacteria | 8640 |
| 425 | Ga0496108_0012395 | 3300048911 | Bacteria | 6937 |
| 426 | Ga0496108_0120843 | 3300048911 | Bacteria | 2247 |
| 427 | Ga0496109_0016352 | 3300048912 | Bacteria | 6484 |
| 428 | Ga0496109_0025441 | 3300048912 | Bacteria | 5275 |
| 429 | Ga0496109_0392989 | 3300048912 | Bacteria | 1310 |
| 430 | Ga0496110_0039908 | 3300048913 | Bacteria | 4090 |
| 431 | Ga0496110_0054698 | 3300048913 | Bacteria | 3511 |
| 432 | Ga0496110_0129296 | 3300048913 | Bacteria | 2280 |
| 433 | Ga0496110_0749954 | 3300048913 | Unclassified | 879 |
| 434 | Ga0496111_0037288 | 3300048914 | Bacteria | 3479 |
| 435 | Ga0496112_0024551 | 3300048915 | Bacteria | 5775 |
| 436 | Ga0496112_0031220 | 3300048915 | Bacteria | 5165 |
| 437 | Ga0496112_0075939 | 3300048915 | Bacteria | 3323 |
| 438 | Ga0496112_0111644 | 3300048915 | Bacteria | 2703 |
| 439 | Ga0496112_0230938 | 3300048915 | Bacteria | 1805 |
| 440 | Ga0496113_0299034 | 3300048916 | Bacteria | 1288 |
| 441 | Ga0496113_0655846 | 3300048916 | Bacteria | 839 |
| 442 | Ga0496114_0005432 | 3300048917 | Bacteria | 9970 |
| 443 | Ga0496114_0381502 | 3300048917 | Bacteria | 1248 |
| 444 | Ga0496115_0002308 | 3300048918 | Bacteria | 13662 |
| 445 | Ga0496122_0009690 | 3300048925 | Bacteria | 10077 |
| 446 | Ga0496123_0114746 | 3300048926 | Bacteria | 1530 |
| 447 | Ga0496126_0007614 | 3300048929 | Bacteria | 11826 |
| 448 | Ga0501034_0036205 | 3300049571 | Bacteria | 5001 |
| 449 | Ga0501034_0320971 | 3300049571 | Bacteria | 1482 |
| 450 | Ga0501047_0339953 | 3300049581 | Bacteria | 1339 |
| 451 | Ga0501068_0406000 | 3300049584 | Bacteria | 879 |
| 452 | Ga0501070_0025856 | 3300049586 | Bacteria | 4925 |
| 453 | Ga0501072_0956058 | 3300049588 | Bacteria | 668 |
| 454 | Ga0501044_0707112 | 3300049823 | Bacteria | 893 |
| 455 | nmdc:mga03683_27262_c1 | 3300050489 | Bacteria | 2260 |
| 456 | nmdc:mga03683_28646_c1 | 3300050489 | Bacteria | 2216 |
| 457 | nmdc:mga03683_358424_c1 | 3300050489 | Bacteria | 691 |
| 458 | nmdc:mga03683_418569_c1 | 3300050489 | Bacteria | 642 |
| 459 | nmdc:mga03n38_10208_c1 | 3300050490 | Bacteria | 3446 |
| 460 | nmdc:mga03n38_119322_c1 | 3300050490 | Bacteria | 1294 |
| 461 | nmdc:mga03n38_132275_c1 | 3300050490 | Bacteria | 1238 |
| 462 | nmdc:mga03n38_165275_c1 | 3300050490 | Bacteria | 1123 |
| 463 | nmdc:mga03n38_17766_c1 | 3300050490 | Bacteria | 2792 |
| 464 | nmdc:mga03n38_184758_c1 | 3300050490 | Bacteria | 1070 |
| 465 | nmdc:mga03n38_202551_c1 | 3300050490 | Bacteria | 1028 |
| 466 | nmdc:mga03n38_240177_c1 | 3300050490 | Bacteria | 953 |
| 467 | nmdc:mga03n38_370313_c1 | 3300050490 | Bacteria | 783 |
| 468 | nmdc:mga03n38_65725_c1 | 3300050490 | Bacteria | 1664 |
| 469 | nmdc:mga03n38_6860_c1 | 3300050490 | Bacteria | 3992 |
| 470 | nmdc:mga03n38_75393_c1 | 3300050490 | Bacteria | 1571 |
| 471 | nmdc:mga03n38_82061_c1 | 3300050490 | Bacteria | 1517 |
| 472 | nmdc:mga03n38_90262_c1 | 3300050490 | Bacteria | 1457 |
| 473 | nmdc:mga00v17_10756_c1 | 3300050491 | Bacteria | 5012 |
| 474 | nmdc:mga00v17_167929_c1 | 3300050491 | Bacteria | 1414 |
| 475 | nmdc:mga00v17_19691_c1 | 3300050491 | Bacteria | 3858 |
| 476 | nmdc:mga00v17_53901_c1 | 3300050491 | Bacteria | 2453 |
| 477 | nmdc:mga00v17_7018_c1 | 3300050491 | Bacteria | 5996 |
| 478 | nmdc:mga00v17_7288_c1 | 3300050491 | Bacteria | 5894 |
| 479 | nmdc:mga00v17_771781_c1 | 3300050491 | Bacteria | 614 |
| 480 | nmdc:mga00v17_787169_c1 | 3300050491 | Bacteria | 606 |
| 481 | nmdc:mga0yw44_133195_c1 | 3300050492 | Bacteria | 1610 |
| 482 | nmdc:mga0yw44_24242_c1 | 3300050492 | Bacteria | 3431 |
| 483 | nmdc:mga0yw44_38854_c1 | 3300050492 | Bacteria | 2818 |
| 484 | nmdc:mga0yw44_46010_c1 | 3300050492 | Bacteria | 2619 |
| 485 | nmdc:mga0yw44_93720_c1 | 3300050492 | Bacteria | 1902 |
| 486 | nmdc:mga06z11_163669_c1 | 3300050494 | Bacteria | 1273 |
| 487 | nmdc:mga06z11_166843_c1 | 3300050494 | Bacteria | 1262 |
| 488 | nmdc:mga06z11_217004_c1 | 3300050494 | Bacteria | 1116 |
| 489 | nmdc:mga06z11_256609_c1 | 3300050494 | Bacteria | 1031 |
| 490 | nmdc:mga06z11_290878_c1 | 3300050494 | Bacteria | 969 |
| 491 | nmdc:mga04h51_116870_c1 | 3300050495 | Bacteria | 989 |
| 492 | nmdc:mga07m45_149607_c1 | 3300050496 | Bacteria | 1354 |
| 493 | nmdc:mga07m45_23734_c1 | 3300050496 | Bacteria | 3355 |
| 494 | nmdc:mga07m45_29879_c1 | 3300050496 | Bacteria | 3017 |
| 495 | nmdc:mga07m45_410588_c1 | 3300050496 | Bacteria | 786 |
| 496 | nmdc:mga07m45_414073_c1 | 3300050496 | Bacteria | 782 |
| 497 | nmdc:mga05p37_550920_c1 | 3300050507 | Bacteria | 1313 |
| 498 | nmdc:mga0qj67_157913_c1 | 3300050509 | Bacteria | 1841 |
| 499 | nmdc:mga0qj67_71871_c1 | 3300050509 | Bacteria | 2761 |
| 500 | nmdc:mga0sz30_135478_c1 | 3300050516 | Bacteria | 1086 |
| 501 | nmdc:mga0sz30_144825_c1 | 3300050516 | Bacteria | 1050 |
| 502 | nmdc:mga0sz30_8036_c2 | 3300050516 | Bacteria | 3328 |
| 503 | nmdc:mga0sz30_8890_c1 | 3300050516 | Bacteria | 3808 |
| 504 | Ga0495655_0006375 | 3300053083 | Bacteria | 2140 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221715 | 2644639231 | 156 |
| 2 | iso_pu_bacteria | 2902810491 | 2902816061 | 156 |
| 3 | iso_pu_bacteria | 2929212328 | 2929212915 | 156 |
| 4 | 3300028381 | Ga0268264_12161744 | Ga0268264_121617441 | 158 |
| 5 | 3300006038 | Ga0075365_10111430 | Ga0075365_101114303 | 159 |
| 6 | 3300006048 | Ga0075363_100005917 | Ga0075363_1000059173 | 159 |
| 7 | 3300006048 | Ga0075363_100007024 | Ga0075363_1000070246 | 159 |
| 8 | 3300006048 | Ga0075363_100215068 | Ga0075363_1002150682 | 159 |
| 9 | 3300006048 | Ga0075363_100346034 | Ga0075363_1003460341 | 159 |
| 10 | 3300006048 | Ga0075363_100385522 | Ga0075363_1003855222 | 159 |
| 11 | 3300006051 | Ga0075364_10104238 | Ga0075364_101042383 | 159 |
| 12 | 3300006051 | Ga0075364_10118431 | Ga0075364_101184313 | 159 |
| 13 | 3300006051 | Ga0075364_10157154 | Ga0075364_101571542 | 159 |
| 14 | 3300006051 | Ga0075364_10268338 | Ga0075364_102683381 | 159 |
| 15 | 3300006177 | Ga0075362_10008884 | Ga0075362_100088844 | 159 |
| 16 | 3300006177 | Ga0075362_10027289 | Ga0075362_100272892 | 159 |
| 17 | 3300006177 | Ga0075362_10401649 | Ga0075362_104016491 | 159 |
| 18 | 3300006186 | Ga0075369_10014637 | Ga0075369_100146373 | 159 |
| 19 | 3300006186 | Ga0075369_10026514 | Ga0075369_100265143 | 159 |
| 20 | 3300006186 | Ga0075369_10090995 | Ga0075369_100909952 | 159 |
| 21 | 3300006186 | Ga0075369_10269615 | Ga0075369_102696152 | 159 |
| 22 | 3300006353 | Ga0075370_10005807 | Ga0075370_100058076 | 159 |
| 23 | 3300006353 | Ga0075370_10007772 | Ga0075370_100077726 | 159 |
| 24 | 3300006353 | Ga0075370_10042561 | Ga0075370_100425612 | 159 |
| 25 | 3300006353 | Ga0075370_10838574 | Ga0075370_108385741 | 159 |
| 26 | 3300009553 | Ga0105249_10055358 | Ga0105249_100553584 | 159 |
| 27 | 3300041413 | Ga0439465_0014870 | Ga0439465_0014870_1638_2120 | 159 |
| 28 | 3300042004 | Ga0439445_0052436 | Ga0439445_0052436_576_1058 | 159 |
| 29 | 3300050489 | nmdc:mga03683_27262_c1 | nmdc:mga03683_27262_c1_103_585 | 159 |
| 30 | 3300050489 | nmdc:mga03683_28646_c1 | nmdc:mga03683_28646_c1_964_1446 | 159 |
| 31 | 3300050489 | nmdc:mga03683_358424_c1 | nmdc:mga03683_358424_c1_116_598 | 159 |
| 32 | 3300050490 | nmdc:mga03n38_132275_c1 | nmdc:mga03n38_132275_c1_634_1116 | 159 |
| 33 | 3300050490 | nmdc:mga03n38_17766_c1 | nmdc:mga03n38_17766_c1_1630_2112 | 159 |
| 34 | 3300050490 | nmdc:mga03n38_202551_c1 | nmdc:mga03n38_202551_c1_142_624 | 159 |
| 35 | 3300050490 | nmdc:mga03n38_370313_c1 | nmdc:mga03n38_370313_c1_36_590 | 159 |
| 36 | 3300050490 | nmdc:mga03n38_6860_c1 | nmdc:mga03n38_6860_c1_2241_2723 | 159 |
| 37 | 3300050490 | nmdc:mga03n38_75393_c1 | nmdc:mga03n38_75393_c1_939_1421 | 159 |
| 38 | 3300050490 | nmdc:mga03n38_90262_c1 | nmdc:mga03n38_90262_c1_586_1068 | 159 |
| 39 | 3300050491 | nmdc:mga00v17_10756_c1 | nmdc:mga00v17_10756_c1_3750_4232 | 159 |
| 40 | 3300050491 | nmdc:mga00v17_167929_c1 | nmdc:mga00v17_167929_c1_576_1058 | 159 |
| 41 | 3300050491 | nmdc:mga00v17_7288_c1 | nmdc:mga00v17_7288_c1_500_982 | 159 |
| 42 | 3300050492 | nmdc:mga0yw44_24242_c1 | nmdc:mga0yw44_24242_c1_2224_2706 | 159 |
| 43 | 3300050492 | nmdc:mga0yw44_46010_c1 | nmdc:mga0yw44_46010_c1_1494_1976 | 159 |
| 44 | 3300050494 | nmdc:mga06z11_166843_c1 | nmdc:mga06z11_166843_c1_604_1086 | 159 |
| 45 | 3300050494 | nmdc:mga06z11_217004_c1 | nmdc:mga06z11_217004_c1_398_880 | 159 |
| 46 | 3300050496 | nmdc:mga07m45_149607_c1 | nmdc:mga07m45_149607_c1_676_1158 | 159 |
| 47 | 3300050496 | nmdc:mga07m45_23734_c1 | nmdc:mga07m45_23734_c1_674_1156 | 159 |
| 48 | 3300050496 | nmdc:mga07m45_29879_c1 | nmdc:mga07m45_29879_c1_1045_1527 | 159 |
| 49 | 3300050496 | nmdc:mga07m45_414073_c1 | nmdc:mga07m45_414073_c1_282_764 | 159 |
| 50 | 3300050516 | nmdc:mga0sz30_8036_c2 | nmdc:mga0sz30_8036_c2_1015_1497 | 159 |
| 51 | 3300002073 | JGI24745J21846_1010399 | JGI24745J21846_10103992 | 160 |
| 52 | 3300002074 | JGI24748J21848_1008174 | JGI24748J21848_10081742 | 160 |
| 53 | 3300002075 | JGI24738J21930_10054665 | JGI24738J21930_100546652 | 160 |
| 54 | 3300002077 | JGI24744J21845_10001674 | JGI24744J21845_100016743 | 160 |
| 55 | 3300002077 | JGI24744J21845_10035231 | JGI24744J21845_100352312 | 160 |
| 56 | 3300002239 | JGI24034J26672_10031307 | JGI24034J26672_100313072 | 160 |
| 57 | 3300005328 | Ga0070676_10054780 | Ga0070676_100547802 | 160 |
| 58 | 3300005330 | Ga0070690_100125084 | Ga0070690_1001250842 | 160 |
| 59 | 3300005331 | Ga0070670_100287200 | Ga0070670_1002872002 | 160 |
| 60 | 3300005333 | Ga0070677_10115618 | Ga0070677_101156182 | 160 |
| 61 | 3300005334 | Ga0068869_100006215 | Ga0068869_1000062154 | 160 |
| 62 | 3300005334 | Ga0068869_101388847 | Ga0068869_1013888471 | 160 |
| 63 | 3300005335 | Ga0070666_10052095 | Ga0070666_100520952 | 160 |
| 64 | 3300005335 | Ga0070666_10182197 | Ga0070666_101821971 | 160 |
| 65 | 3300005336 | Ga0070680_100460917 | Ga0070680_1004609172 | 160 |
| 66 | 3300005337 | Ga0070682_100114675 | Ga0070682_1001146753 | 160 |
| 67 | 3300005338 | Ga0068868_100006676 | Ga0068868_1000066766 | 160 |
| 68 | 3300005339 | Ga0070660_100106718 | Ga0070660_1001067182 | 160 |
| 69 | 3300005340 | Ga0070689_100003095 | Ga0070689_1000030953 | 160 |
| 70 | 3300005343 | Ga0070687_100417257 | Ga0070687_1004172572 | 160 |
| 71 | 3300005344 | Ga0070661_100471877 | Ga0070661_1004718772 | 160 |
| 72 | 3300005345 | Ga0070692_11140604 | Ga0070692_111406041 | 160 |
| 73 | 3300005347 | Ga0070668_100050371 | Ga0070668_1000503713 | 160 |
| 74 | 3300005347 | Ga0070668_100171388 | Ga0070668_1001713883 | 160 |
| 75 | 3300005347 | Ga0070668_100290762 | Ga0070668_1002907622 | 160 |
| 76 | 3300005347 | Ga0070668_100355870 | Ga0070668_1003558702 | 160 |
| 77 | 3300005353 | Ga0070669_100037509 | Ga0070669_1000375092 | 160 |
| 78 | 3300005354 | Ga0070675_100014586 | Ga0070675_1000145862 | 160 |
| 79 | 3300005355 | Ga0070671_100004325 | Ga0070671_10000432511 | 160 |
| 80 | 3300005355 | Ga0070671_100113477 | Ga0070671_1001134772 | 160 |
| 81 | 3300005355 | Ga0070671_100412113 | Ga0070671_1004121131 | 160 |
| 82 | 3300005356 | Ga0070674_100031357 | Ga0070674_1000313574 | 160 |
| 83 | 3300005356 | Ga0070674_100246759 | Ga0070674_1002467592 | 160 |
| 84 | 3300005356 | Ga0070674_100251921 | Ga0070674_1002519213 | 160 |
| 85 | 3300005364 | Ga0070673_100122317 | Ga0070673_1001223173 | 160 |
| 86 | 3300005364 | Ga0070673_100201049 | Ga0070673_1002010492 | 160 |
| 87 | 3300005366 | Ga0070659_100180920 | Ga0070659_1001809202 | 160 |
| 88 | 3300005366 | Ga0070659_100850684 | Ga0070659_1008506841 | 160 |
| 89 | 3300005367 | Ga0070667_100020189 | Ga0070667_1000201893 | 160 |
| 90 | 3300005367 | Ga0070667_100137782 | Ga0070667_1001377823 | 160 |
| 91 | 3300005367 | Ga0070667_100145764 | Ga0070667_1001457643 | 160 |
| 92 | 3300005434 | Ga0070709_10001138 | Ga0070709_100011387 | 160 |
| 93 | 3300005434 | Ga0070709_10099956 | Ga0070709_100999562 | 160 |
| 94 | 3300005435 | Ga0070714_100125074 | Ga0070714_1001250743 | 160 |
| 95 | 3300005437 | Ga0070710_10008017 | Ga0070710_100080173 | 160 |
| 96 | 3300005437 | Ga0070710_10010338 | Ga0070710_100103384 | 160 |
| 97 | 3300005438 | Ga0070701_10000574 | Ga0070701_100005743 | 160 |
| 98 | 3300005438 | Ga0070701_10650231 | Ga0070701_106502311 | 160 |
| 99 | 3300005439 | Ga0070711_100001370 | Ga0070711_1000013703 | 160 |
| 100 | 3300005439 | Ga0070711_100009214 | Ga0070711_1000092143 | 160 |
| 101 | 3300005440 | Ga0070705_100096175 | Ga0070705_1000961753 | 160 |
| 102 | 3300005441 | Ga0070700_100009041 | Ga0070700_1000090414 | 160 |
| 103 | 3300005441 | Ga0070700_100059079 | Ga0070700_1000590793 | 160 |
| 104 | 3300005441 | Ga0070700_100125173 | Ga0070700_1001251732 | 160 |
| 105 | 3300005444 | Ga0070694_100017618 | Ga0070694_1000176182 | 160 |
| 106 | 3300005444 | Ga0070694_100569900 | Ga0070694_1005699001 | 160 |
| 107 | 3300005455 | Ga0070663_100028239 | Ga0070663_1000282393 | 160 |
| 108 | 3300005455 | Ga0070663_100064115 | Ga0070663_1000641153 | 160 |
| 109 | 3300005456 | Ga0070678_100007637 | Ga0070678_1000076376 | 160 |
| 110 | 3300005456 | Ga0070678_100573657 | Ga0070678_1005736572 | 160 |
| 111 | 3300005457 | Ga0070662_100002522 | Ga0070662_1000025228 | 160 |
| 112 | 3300005457 | Ga0070662_100336214 | Ga0070662_1003362142 | 160 |
| 113 | 3300005459 | Ga0068867_100002753 | Ga0068867_1000027535 | 160 |
| 114 | 3300005459 | Ga0068867_100105904 | Ga0068867_1001059043 | 160 |
| 115 | 3300005466 | Ga0070685_10277155 | Ga0070685_102771552 | 160 |
| 116 | 3300005468 | Ga0070707_100921757 | Ga0070707_1009217572 | 160 |
| 117 | 3300005535 | Ga0070684_100184190 | Ga0070684_1001841903 | 160 |
| 118 | 3300005539 | Ga0068853_100007969 | Ga0068853_1000079694 | 160 |
| 119 | 3300005539 | Ga0068853_101338667 | Ga0068853_1013386672 | 160 |
| 120 | 3300005543 | Ga0070672_100016053 | Ga0070672_1000160532 | 160 |
| 121 | 3300005544 | Ga0070686_100127240 | Ga0070686_1001272402 | 160 |
| 122 | 3300005544 | Ga0070686_101493950 | Ga0070686_1014939501 | 160 |
| 123 | 3300005545 | Ga0070695_100017923 | Ga0070695_1000179232 | 160 |
| 124 | 3300005545 | Ga0070695_100103188 | Ga0070695_1001031882 | 160 |
| 125 | 3300005546 | Ga0070696_100002819 | Ga0070696_1000028195 | 160 |
| 126 | 3300005546 | Ga0070696_100091608 | Ga0070696_1000916083 | 160 |
| 127 | 3300005547 | Ga0070693_100030732 | Ga0070693_1000307323 | 160 |
| 128 | 3300005548 | Ga0070665_100006270 | Ga0070665_1000062709 | 160 |
| 129 | 3300005548 | Ga0070665_100106009 | Ga0070665_1001060092 | 160 |
| 130 | 3300005548 | Ga0070665_101212700 | Ga0070665_1012127002 | 160 |
| 131 | 3300005548 | Ga0070665_101864143 | Ga0070665_1018641431 | 160 |
| 132 | 3300005549 | Ga0070704_100000324 | Ga0070704_1000003243 | 160 |
| 133 | 3300005549 | Ga0070704_100149875 | Ga0070704_1001498752 | 160 |
| 134 | 3300005549 | Ga0070704_100701865 | Ga0070704_1007018652 | 160 |
| 135 | 3300005563 | Ga0068855_100028591 | Ga0068855_1000285912 | 160 |
| 136 | 3300005563 | Ga0068855_100243442 | Ga0068855_1002434422 | 160 |
| 137 | 3300005578 | Ga0068854_100005612 | Ga0068854_1000056123 | 160 |
| 138 | 3300005615 | Ga0070702_100134713 | Ga0070702_1001347133 | 160 |
| 139 | 3300005615 | Ga0070702_101307367 | Ga0070702_1013073671 | 160 |
| 140 | 3300005617 | Ga0068859_100007033 | Ga0068859_10000703310 | 160 |
| 141 | 3300005617 | Ga0068859_100072184 | Ga0068859_1000721842 | 160 |
| 142 | 3300005617 | Ga0068859_100250774 | Ga0068859_1002507742 | 160 |
| 143 | 3300005618 | Ga0068864_100101488 | Ga0068864_1001014883 | 160 |
| 144 | 3300005618 | Ga0068864_100141541 | Ga0068864_1001415412 | 160 |
| 145 | 3300005618 | Ga0068864_101681394 | Ga0068864_1016813941 | 160 |
| 146 | 3300005718 | Ga0068866_10000937 | Ga0068866_100009378 | 160 |
| 147 | 3300005718 | Ga0068866_10117836 | Ga0068866_101178362 | 160 |
| 148 | 3300005719 | Ga0068861_100006110 | Ga0068861_1000061106 | 160 |
| 149 | 3300005719 | Ga0068861_100087465 | Ga0068861_1000874652 | 160 |
| 150 | 3300005834 | Ga0068851_10071868 | Ga0068851_100718682 | 160 |
| 151 | 3300005834 | Ga0068851_10103170 | Ga0068851_101031702 | 160 |
| 152 | 3300005840 | Ga0068870_10181439 | Ga0068870_101814392 | 160 |
| 153 | 3300005841 | Ga0068863_100118854 | Ga0068863_1001188542 | 160 |
| 154 | 3300005841 | Ga0068863_100125657 | Ga0068863_1001256573 | 160 |
| 155 | 3300005842 | Ga0068858_100040452 | Ga0068858_1000404522 | 160 |
| 156 | 3300005842 | Ga0068858_100282183 | Ga0068858_1002821832 | 160 |
| 157 | 3300005843 | Ga0068860_100006774 | Ga0068860_10000677410 | 160 |
| 158 | 3300005843 | Ga0068860_100193726 | Ga0068860_1001937262 | 160 |
| 159 | 3300005844 | Ga0068862_100000958 | Ga0068862_10000095811 | 160 |
| 160 | 3300005844 | Ga0068862_100116575 | Ga0068862_1001165752 | 160 |
| 161 | 3300005937 | Ga0081455_10148508 | Ga0081455_101485082 | 160 |
| 162 | 3300006038 | Ga0075365_10111430 | Ga0075365_101114302 | 160 |
| 163 | 3300006038 | Ga0075365_10302580 | Ga0075365_103025802 | 160 |
| 164 | 3300006038 | Ga0075365_10312323 | Ga0075365_103123232 | 160 |
| 165 | 3300006038 | Ga0075365_10323755 | Ga0075365_103237552 | 160 |
| 166 | 3300006038 | Ga0075365_10599454 | Ga0075365_105994542 | 160 |
| 167 | 3300006038 | Ga0075365_10688057 | Ga0075365_106880572 | 160 |
| 168 | 3300006042 | Ga0075368_10261286 | Ga0075368_102612861 | 160 |
| 169 | 3300006048 | Ga0075363_100005917 | Ga0075363_1000059172 | 160 |
| 170 | 3300006048 | Ga0075363_100007024 | Ga0075363_1000070247 | 160 |
| 171 | 3300006048 | Ga0075363_100008869 | Ga0075363_1000088692 | 160 |
| 172 | 3300006048 | Ga0075363_100018022 | Ga0075363_1000180223 | 160 |
| 173 | 3300006048 | Ga0075363_100033601 | Ga0075363_1000336013 | 160 |
| 174 | 3300006048 | Ga0075363_100101785 | Ga0075363_1001017852 | 160 |
| 175 | 3300006048 | Ga0075363_100209879 | Ga0075363_1002098792 | 160 |
| 176 | 3300006048 | Ga0075363_100250334 | Ga0075363_1002503342 | 160 |
| 177 | 3300006051 | Ga0075364_10009147 | Ga0075364_100091473 | 160 |
| 178 | 3300006051 | Ga0075364_10118431 | Ga0075364_101184312 | 160 |
| 179 | 3300006051 | Ga0075364_10169707 | Ga0075364_101697072 | 160 |
| 180 | 3300006051 | Ga0075364_10189817 | Ga0075364_101898172 | 160 |
| 181 | 3300006051 | Ga0075364_10268338 | Ga0075364_102683382 | 160 |
| 182 | 3300006051 | Ga0075364_10329849 | Ga0075364_103298492 | 160 |
| 183 | 3300006051 | Ga0075364_10964050 | Ga0075364_109640501 | 160 |
| 184 | 3300006163 | Ga0070715_10043152 | Ga0070715_100431522 | 160 |
| 185 | 3300006173 | Ga0070716_100007252 | Ga0070716_1000072522 | 160 |
| 186 | 3300006175 | Ga0070712_100002027 | Ga0070712_1000020278 | 160 |
| 187 | 3300006175 | Ga0070712_100048808 | Ga0070712_1000488083 | 160 |
| 188 | 3300006175 | Ga0070712_100892180 | Ga0070712_1008921801 | 160 |
| 189 | 3300006177 | Ga0075362_10008884 | Ga0075362_100088845 | 160 |
| 190 | 3300006177 | Ga0075362_10104827 | Ga0075362_101048272 | 160 |
| 191 | 3300006178 | Ga0075367_10294888 | Ga0075367_102948882 | 160 |
| 192 | 3300006178 | Ga0075367_10367520 | Ga0075367_103675202 | 160 |
| 193 | 3300006186 | Ga0075369_10014637 | Ga0075369_100146374 | 160 |
| 194 | 3300006186 | Ga0075369_10017408 | Ga0075369_100174083 | 160 |
| 195 | 3300006186 | Ga0075369_10018470 | Ga0075369_100184702 | 160 |
| 196 | 3300006186 | Ga0075369_10026514 | Ga0075369_100265144 | 160 |
| 197 | 3300006186 | Ga0075369_10049891 | Ga0075369_100498912 | 160 |
| 198 | 3300006186 | Ga0075369_10090995 | Ga0075369_100909951 | 160 |
| 199 | 3300006237 | Ga0097621_100188583 | Ga0097621_1001885832 | 160 |
| 200 | 3300006237 | Ga0097621_101248651 | Ga0097621_1012486512 | 160 |
| 201 | 3300006353 | Ga0075370_10005807 | Ga0075370_100058077 | 160 |
| 202 | 3300006353 | Ga0075370_10007772 | Ga0075370_100077727 | 160 |
| 203 | 3300006353 | Ga0075370_10042561 | Ga0075370_100425611 | 160 |
| 204 | 3300006353 | Ga0075370_10227946 | Ga0075370_102279462 | 160 |
| 205 | 3300006353 | Ga0075370_10356929 | Ga0075370_103569292 | 160 |
| 206 | 3300006353 | Ga0075370_10365921 | Ga0075370_103659212 | 160 |
| 207 | 3300006358 | Ga0068871_100142331 | Ga0068871_1001423313 | 160 |
| 208 | 3300006358 | Ga0068871_100260723 | Ga0068871_1002607232 | 160 |
| 209 | 3300006844 | Ga0075428_100000609 | Ga0075428_10000060921 | 160 |
| 210 | 3300006846 | Ga0075430_100003543 | Ga0075430_1000035438 | 160 |
| 211 | 3300006881 | Ga0068865_100002876 | Ga0068865_1000028765 | 160 |
| 212 | 3300006881 | Ga0068865_100497927 | Ga0068865_1004979273 | 160 |
| 213 | 3300006931 | Ga0097620_100007032 | Ga0097620_1000070321 | 160 |
| 214 | 3300006931 | Ga0097620_100072185 | Ga0097620_1000721852 | 160 |
| 215 | 3300006931 | Ga0097620_100250783 | Ga0097620_1002507832 | 160 |
| 216 | 3300007788 | Ga0099795_10048313 | Ga0099795_100483132 | 160 |
| 217 | 3300009092 | Ga0105250_10062121 | Ga0105250_100621211 | 160 |
| 218 | 3300009092 | Ga0105250_10076367 | Ga0105250_100763672 | 160 |
| 219 | 3300009094 | Ga0111539_10157924 | Ga0111539_101579242 | 160 |
| 220 | 3300009094 | Ga0111539_11158659 | Ga0111539_111586592 | 160 |
| 221 | 3300009098 | Ga0105245_10020964 | Ga0105245_100209644 | 160 |
| 222 | 3300009098 | Ga0105245_10076235 | Ga0105245_100762353 | 160 |
| 223 | 3300009098 | Ga0105245_10222886 | Ga0105245_102228862 | 160 |
| 224 | 3300009101 | Ga0105247_10000265 | Ga0105247_1000026541 | 160 |
| 225 | 3300009101 | Ga0105247_10072267 | Ga0105247_100722672 | 160 |
| 226 | 3300009101 | Ga0105247_10206165 | Ga0105247_102061652 | 160 |
| 227 | 3300009147 | Ga0114129_11088237 | Ga0114129_110882372 | 160 |
| 228 | 3300009148 | Ga0105243_10006348 | Ga0105243_100063482 | 160 |
| 229 | 3300009148 | Ga0105243_10039788 | Ga0105243_100397882 | 160 |
| 230 | 3300009174 | Ga0105241_10022698 | Ga0105241_100226984 | 160 |
| 231 | 3300009174 | Ga0105241_10104366 | Ga0105241_101043662 | 160 |
| 232 | 3300009176 | Ga0105242_10011028 | Ga0105242_100110283 | 160 |
| 233 | 3300009177 | Ga0105248_10006313 | Ga0105248_100063138 | 160 |
| 234 | 3300009177 | Ga0105248_10074541 | Ga0105248_100745413 | 160 |
| 235 | 3300009177 | Ga0105248_10808142 | Ga0105248_108081422 | 160 |
| 236 | 3300009545 | Ga0105237_10239378 | Ga0105237_102393782 | 160 |
| 237 | 3300009551 | Ga0105238_10042957 | Ga0105238_100429575 | 160 |
| 238 | 3300009551 | Ga0105238_10249529 | Ga0105238_102495292 | 160 |
| 239 | 3300009551 | Ga0105238_10554161 | Ga0105238_105541612 | 160 |
| 240 | 3300009551 | Ga0105238_11673199 | Ga0105238_116731991 | 160 |
| 241 | 3300009553 | Ga0105249_10000892 | Ga0105249_100008928 | 160 |
| 242 | 3300009553 | Ga0105249_10337860 | Ga0105249_103378602 | 160 |
| 243 | 3300009553 | Ga0105249_11480305 | Ga0105249_114803051 | 160 |
| 244 | 3300009553 | Ga0105249_11510893 | Ga0105249_115108932 | 160 |
| 245 | 3300010159 | Ga0099796_10014124 | Ga0099796_100141243 | 160 |
| 246 | 3300010375 | Ga0105239_10022038 | Ga0105239_100220387 | 160 |
| 247 | 3300010375 | Ga0105239_10308829 | Ga0105239_103088293 | 160 |
| 248 | 3300010375 | Ga0105239_10615076 | Ga0105239_106150762 | 160 |
| 249 | 3300010375 | Ga0105239_11368181 | Ga0105239_113681811 | 160 |
| 250 | 3300010375 | Ga0105239_12142236 | Ga0105239_121422361 | 160 |
| 251 | 3300011119 | Ga0105246_10021209 | Ga0105246_100212093 | 160 |
| 252 | 3300011119 | Ga0105246_10348744 | Ga0105246_103487442 | 160 |
| 253 | 3300013105 | Ga0157369_10290005 | Ga0157369_102900053 | 160 |
| 254 | 3300013296 | Ga0157374_10015517 | Ga0157374_100155172 | 160 |
| 255 | 3300013296 | Ga0157374_11302228 | Ga0157374_113022282 | 160 |
| 256 | 3300013297 | Ga0157378_10165038 | Ga0157378_101650381 | 160 |
| 257 | 3300013306 | Ga0163162_10031742 | Ga0163162_100317421 | 160 |
| 258 | 3300013306 | Ga0163162_10177198 | Ga0163162_101771982 | 160 |
| 259 | 3300013306 | Ga0163162_10445777 | Ga0163162_104457772 | 160 |
| 260 | 3300013306 | Ga0163162_11500884 | Ga0163162_115008841 | 160 |
| 261 | 3300013307 | Ga0157372_10005825 | Ga0157372_1000582511 | 160 |
| 262 | 3300013307 | Ga0157372_10147416 | Ga0157372_101474163 | 160 |
| 263 | 3300013307 | Ga0157372_11988702 | Ga0157372_119887021 | 160 |
| 264 | 3300013308 | Ga0157375_10000760 | Ga0157375_1000076010 | 160 |
| 265 | 3300013308 | Ga0157375_10211227 | Ga0157375_102112272 | 160 |
| 266 | 3300014325 | Ga0163163_10018765 | Ga0163163_100187652 | 160 |
| 267 | 3300014325 | Ga0163163_10126290 | Ga0163163_101262903 | 160 |
| 268 | 3300014325 | Ga0163163_10313420 | Ga0163163_103134202 | 160 |
| 269 | 3300014325 | Ga0163163_11082338 | Ga0163163_110823381 | 160 |
| 270 | 3300014325 | Ga0163163_11686046 | Ga0163163_116860461 | 160 |
| 271 | 3300014326 | Ga0157380_10001880 | Ga0157380_100018805 | 160 |
| 272 | 3300014326 | Ga0157380_10325200 | Ga0157380_103252002 | 160 |
| 273 | 3300014745 | Ga0157377_10021301 | Ga0157377_100213012 | 160 |
| 274 | 3300014968 | Ga0157379_10019019 | Ga0157379_100190196 | 160 |
| 275 | 3300014968 | Ga0157379_10078111 | Ga0157379_100781112 | 160 |
| 276 | 3300014968 | Ga0157379_10466483 | Ga0157379_104664832 | 160 |
| 277 | 3300014968 | Ga0157379_10628703 | Ga0157379_106287032 | 160 |
| 278 | 3300014969 | Ga0157376_10374608 | Ga0157376_103746082 | 160 |
| 279 | 3300017792 | Ga0163161_10071957 | Ga0163161_100719572 | 160 |
| 280 | 3300017792 | Ga0163161_10091342 | Ga0163161_100913422 | 160 |
| 281 | 3300017792 | Ga0163161_10248836 | Ga0163161_102488362 | 160 |
| 282 | 3300025885 | Ga0207653_10091696 | Ga0207653_100916961 | 160 |
| 283 | 3300025898 | Ga0207692_10033528 | Ga0207692_100335282 | 160 |
| 284 | 3300025898 | Ga0207692_10080193 | Ga0207692_100801931 | 160 |
| 285 | 3300025899 | Ga0207642_10000396 | Ga0207642_100003962 | 160 |
| 286 | 3300025900 | Ga0207710_10008666 | Ga0207710_100086662 | 160 |
| 287 | 3300025901 | Ga0207688_10000235 | Ga0207688_1000023518 | 160 |
| 288 | 3300025901 | Ga0207688_10001781 | Ga0207688_100017813 | 160 |
| 289 | 3300025903 | Ga0207680_10043619 | Ga0207680_100436193 | 160 |
| 290 | 3300025904 | Ga0207647_10043635 | Ga0207647_100436352 | 160 |
| 291 | 3300025904 | Ga0207647_10264413 | Ga0207647_102644132 | 160 |
| 292 | 3300025905 | Ga0207685_10025585 | Ga0207685_100255852 | 160 |
| 293 | 3300025906 | Ga0207699_10051379 | Ga0207699_100513793 | 160 |
| 294 | 3300025906 | Ga0207699_10300252 | Ga0207699_103002522 | 160 |
| 295 | 3300025907 | Ga0207645_10166151 | Ga0207645_101661512 | 160 |
| 296 | 3300025907 | Ga0207645_10706260 | Ga0207645_107062602 | 160 |
| 297 | 3300025908 | Ga0207643_10099514 | Ga0207643_100995142 | 160 |
| 298 | 3300025911 | Ga0207654_10063031 | Ga0207654_100630312 | 160 |
| 299 | 3300025914 | Ga0207671_10124618 | Ga0207671_101246181 | 160 |
| 300 | 3300025915 | Ga0207693_10002003 | Ga0207693_100020038 | 160 |
| 301 | 3300025915 | Ga0207693_10009436 | Ga0207693_100094362 | 160 |
| 302 | 3300025916 | Ga0207663_10176942 | Ga0207663_101769422 | 160 |
| 303 | 3300025918 | Ga0207662_10276285 | Ga0207662_102762852 | 160 |
| 304 | 3300025919 | Ga0207657_10066138 | Ga0207657_100661383 | 160 |
| 305 | 3300025919 | Ga0207657_10302676 | Ga0207657_103026762 | 160 |
| 306 | 3300025920 | Ga0207649_10281743 | Ga0207649_102817432 | 160 |
| 307 | 3300025920 | Ga0207649_11055989 | Ga0207649_110559891 | 160 |
| 308 | 3300025922 | Ga0207646_10632289 | Ga0207646_106322892 | 160 |
| 309 | 3300025923 | Ga0207681_10021138 | Ga0207681_100211383 | 160 |
| 310 | 3300025924 | Ga0207694_10039624 | Ga0207694_100396245 | 160 |
| 311 | 3300025924 | Ga0207694_10532576 | Ga0207694_105325762 | 160 |
| 312 | 3300025924 | Ga0207694_11235836 | Ga0207694_112358361 | 160 |
| 313 | 3300025927 | Ga0207687_10203889 | Ga0207687_102038892 | 160 |
| 314 | 3300025927 | Ga0207687_10509076 | Ga0207687_105090761 | 160 |
| 315 | 3300025928 | Ga0207700_11026274 | Ga0207700_110262742 | 160 |
| 316 | 3300025931 | Ga0207644_10211797 | Ga0207644_102117973 | 160 |
| 317 | 3300025931 | Ga0207644_10260170 | Ga0207644_102601702 | 160 |
| 318 | 3300025931 | Ga0207644_10520824 | Ga0207644_105208242 | 160 |
| 319 | 3300025932 | Ga0207690_10473766 | Ga0207690_104737662 | 160 |
| 320 | 3300025933 | Ga0207706_10004218 | Ga0207706_100042186 | 160 |
| 321 | 3300025934 | Ga0207686_10082090 | Ga0207686_100820902 | 160 |
| 322 | 3300025935 | Ga0207709_10001915 | Ga0207709_100019155 | 160 |
| 323 | 3300025935 | Ga0207709_10043270 | Ga0207709_100432703 | 160 |
| 324 | 3300025936 | Ga0207670_10038174 | Ga0207670_100381742 | 160 |
| 325 | 3300025937 | Ga0207669_10057741 | Ga0207669_100577412 | 160 |
| 326 | 3300025937 | Ga0207669_10093064 | Ga0207669_100930642 | 160 |
| 327 | 3300025937 | Ga0207669_10818566 | Ga0207669_108185661 | 160 |
| 328 | 3300025938 | Ga0207704_10014473 | Ga0207704_100144732 | 160 |
| 329 | 3300025938 | Ga0207704_10318723 | Ga0207704_103187232 | 160 |
| 330 | 3300025939 | Ga0207665_10002735 | Ga0207665_1000273511 | 160 |
| 331 | 3300025939 | Ga0207665_10019187 | Ga0207665_100191872 | 160 |
| 332 | 3300025940 | Ga0207691_10038812 | Ga0207691_100388126 | 160 |
| 333 | 3300025941 | Ga0207711_10588181 | Ga0207711_105881811 | 160 |
| 334 | 3300025941 | Ga0207711_10748616 | Ga0207711_107486161 | 160 |
| 335 | 3300025942 | Ga0207689_10009672 | Ga0207689_100096726 | 160 |
| 336 | 3300025942 | Ga0207689_10018530 | Ga0207689_100185303 | 160 |
| 337 | 3300025949 | Ga0207667_10264003 | Ga0207667_102640032 | 160 |
| 338 | 3300025960 | Ga0207651_10108230 | Ga0207651_101082303 | 160 |
| 339 | 3300025961 | Ga0207712_10024596 | Ga0207712_100245964 | 160 |
| 340 | 3300025961 | Ga0207712_10273195 | Ga0207712_102731952 | 160 |
| 341 | 3300025972 | Ga0207668_10016700 | Ga0207668_100167002 | 160 |
| 342 | 3300025972 | Ga0207668_10280482 | Ga0207668_102804821 | 160 |
| 343 | 3300025972 | Ga0207668_10511930 | Ga0207668_105119301 | 160 |
| 344 | 3300025972 | Ga0207668_10595705 | Ga0207668_105957052 | 160 |
| 345 | 3300025981 | Ga0207640_10147328 | Ga0207640_101473283 | 160 |
| 346 | 3300025986 | Ga0207658_10007021 | Ga0207658_100070212 | 160 |
| 347 | 3300025986 | Ga0207658_10097389 | Ga0207658_100973892 | 160 |
| 348 | 3300025986 | Ga0207658_10442166 | Ga0207658_104421661 | 160 |
| 349 | 3300025986 | Ga0207658_11132288 | Ga0207658_111322881 | 160 |
| 350 | 3300026035 | Ga0207703_10121918 | Ga0207703_101219182 | 160 |
| 351 | 3300026041 | Ga0207639_10034325 | Ga0207639_100343255 | 160 |
| 352 | 3300026041 | Ga0207639_10063197 | Ga0207639_100631972 | 160 |
| 353 | 3300026067 | Ga0207678_10006719 | Ga0207678_100067197 | 160 |
| 354 | 3300026067 | Ga0207678_10010674 | Ga0207678_100106745 | 160 |
| 355 | 3300026067 | Ga0207678_10029794 | Ga0207678_100297944 | 160 |
| 356 | 3300026067 | Ga0207678_10462565 | Ga0207678_104625652 | 160 |
| 357 | 3300026075 | Ga0207708_10001625 | Ga0207708_1000162514 | 160 |
| 358 | 3300026075 | Ga0207708_10021001 | Ga0207708_100210012 | 160 |
| 359 | 3300026075 | Ga0207708_10124926 | Ga0207708_101249262 | 160 |
| 360 | 3300026088 | Ga0207641_10177202 | Ga0207641_101772022 | 160 |
| 361 | 3300026088 | Ga0207641_10220024 | Ga0207641_102200242 | 160 |
| 362 | 3300026089 | Ga0207648_10003286 | Ga0207648_100032868 | 160 |
| 363 | 3300026089 | Ga0207648_10013165 | Ga0207648_100131655 | 160 |
| 364 | 3300026095 | Ga0207676_11474149 | Ga0207676_114741491 | 160 |
| 365 | 3300026118 | Ga0207675_100000865 | Ga0207675_10000086520 | 160 |
| 366 | 3300026118 | Ga0207675_100046529 | Ga0207675_1000465295 | 160 |
| 367 | 3300026121 | Ga0207683_10000809 | Ga0207683_1000080911 | 160 |
| 368 | 3300026121 | Ga0207683_10026106 | Ga0207683_100261065 | 160 |
| 369 | 3300026142 | Ga0207698_10115899 | Ga0207698_101158992 | 160 |
| 370 | 3300027866 | Ga0209813_10070972 | Ga0209813_100709722 | 160 |
| 371 | 3300027907 | Ga0207428_10444578 | Ga0207428_104445781 | 160 |
| 372 | 3300028379 | Ga0268266_10110122 | Ga0268266_101101222 | 160 |
| 373 | 3300028379 | Ga0268266_10178427 | Ga0268266_101784272 | 160 |
| 374 | 3300028380 | Ga0268265_10039940 | Ga0268265_100399404 | 160 |
| 375 | 3300028380 | Ga0268265_10057367 | Ga0268265_100573672 | 160 |
| 376 | 3300028380 | Ga0268265_10499969 | Ga0268265_104999692 | 160 |
| 377 | 3300028381 | Ga0268264_10147808 | Ga0268264_101478083 | 160 |
| 378 | 3300031731 | Ga0307405_10117143 | Ga0307405_101171432 | 160 |
| 379 | 3300031901 | Ga0307406_10659314 | Ga0307406_106593142 | 160 |
| 380 | 3300031995 | Ga0307409_100032487 | Ga0307409_1000324873 | 160 |
| 381 | 3300031995 | Ga0307409_100174892 | Ga0307409_1001748923 | 160 |
| 382 | 3300032002 | Ga0307416_100265404 | Ga0307416_1002654043 | 160 |
| 383 | 3300032126 | Ga0307415_100177607 | Ga0307415_1001776073 | 160 |
| 384 | 3300035091 | Ga0373951_0058952 | Ga0373951_0058952_206_688 | 160 |
| 385 | 3300035114 | Ga0373939_0022785 | Ga0373939_0022785_890_1372 | 160 |
| 386 | 3300035115 | Ga0373941_0069973 | Ga0373941_0069973_13_495 | 160 |
| 387 | 3300035691 | Ga0373931_0047646 | Ga0373931_0047646_1503_1985 | 160 |
| 388 | 3300035691 | Ga0373931_0282662 | Ga0373931_0282662_260_742 | 160 |
| 389 | 3300041410 | Ga0439461_0000467 | Ga0439461_0000467_1399_1881 | 160 |
| 390 | 3300041411 | Ga0439466_0010698 | Ga0439466_0010698_195_677 | 160 |
| 391 | 3300041411 | Ga0439466_0015202 | Ga0439466_0015202_1803_2285 | 160 |
| 392 | 3300041411 | Ga0439466_0032917 | Ga0439466_0032917_318_800 | 160 |
| 393 | 3300041413 | Ga0439465_0003631 | Ga0439465_0003631_909_1391 | 160 |
| 394 | 3300041413 | Ga0439465_0005880 | Ga0439465_0005880_381_863 | 160 |
| 395 | 3300041413 | Ga0439465_0014870 | Ga0439465_0014870_1141_1623 | 160 |
| 396 | 3300041443 | Ga0451789_0514195 | Ga0451789_0514195_112_594 | 160 |
| 397 | 3300041997 | Ga0439431_0017060 | Ga0439431_0017060_1163_1645 | 160 |
| 398 | 3300041997 | Ga0439431_0155220 | Ga0439431_0155220_148_630 | 160 |
| 399 | 3300042002 | Ga0439442_015874 | Ga0439442_015874_966_1448 | 160 |
| 400 | 3300042002 | Ga0439442_103041 | Ga0439442_103041_74_556 | 160 |
| 401 | 3300042004 | Ga0439445_0006614 | Ga0439445_0006614_1419_1901 | 160 |
| 402 | 3300042004 | Ga0439445_0042833 | Ga0439445_0042833_507_989 | 160 |
| 403 | 3300042004 | Ga0439445_0052436 | Ga0439445_0052436_79_561 | 160 |
| 404 | 3300042013 | Ga0439456_031921 | Ga0439456_031921_195_677 | 160 |
| 405 | 3300042435 | Ga0439434_0042362 | Ga0439434_0042362_639_1121 | 160 |
| 406 | 3300044658 | Ga0466972_0004347 | Ga0466972_0004347_3327_3809 | 160 |
| 407 | 3300044658 | Ga0466972_0031476 | Ga0466972_0031476_611_1093 | 160 |
| 408 | 3300044658 | Ga0466972_0051934 | Ga0466972_0051934_1345_1827 | 160 |
| 409 | 3300044658 | Ga0466972_0060518 | Ga0466972_0060518_662_1144 | 160 |
| 410 | 3300044658 | Ga0466972_0125285 | Ga0466972_0125285_279_761 | 160 |
| 411 | 3300044683 | Ga0466965_0000919 | Ga0466965_0000919_3159_3641 | 160 |
| 412 | 3300044683 | Ga0466965_0001880 | Ga0466965_0001880_2707_3189 | 160 |
| 413 | 3300044683 | Ga0466965_0082069 | Ga0466965_0082069_796_1278 | 160 |
| 414 | 3300044684 | Ga0466966_0080762 | Ga0466966_0080762_48_530 | 160 |
| 415 | 3300044694 | Ga0466963_0760679 | Ga0466963_0760679_185_667 | 160 |
| 416 | 3300044719 | Ga0466971_0080261 | Ga0466971_0080261_144_626 | 160 |
| 417 | 3300044735 | Ga0466968_0003050 | Ga0466968_0003050_2385_2867 | 160 |
| 418 | 3300044735 | Ga0466968_0090149 | Ga0466968_0090149_248_730 | 160 |
| 419 | 3300044765 | Ga0466970_0023720 | Ga0466970_0023720_1003_1485 | 160 |
| 420 | 3300044765 | Ga0466970_0050590 | Ga0466970_0050590_1193_1675 | 160 |
| 421 | 3300044842 | Ga0466957_0002631 | Ga0466957_0002631_2385_2867 | 160 |
| 422 | 3300044842 | Ga0466957_0195713 | Ga0466957_0195713_778_1260 | 160 |
| 423 | 3300044901 | Ga0466960_0002634 | Ga0466960_0002634_4872_5354 | 160 |
| 424 | 3300044901 | Ga0466960_0139675 | Ga0466960_0139675_377_859 | 160 |
| 425 | 3300044901 | Ga0466960_0552108 | Ga0466960_0552108_143_625 | 160 |
| 426 | 3300045049 | Ga0466959_0055480 | Ga0466959_0055480_1855_2337 | 160 |
| 427 | 3300045049 | Ga0466959_0062672 | Ga0466959_0062672_1279_1761 | 160 |
| 428 | 3300045836 | Ga0466958_0166164 | Ga0466958_0166164_65_547 | 160 |
| 429 | 3300045976 | Ga0466967_0050122 | Ga0466967_0050122_2740_3222 | 160 |
| 430 | 3300045976 | Ga0466967_0133115 | Ga0466967_0133115_695_1177 | 160 |
| 431 | 3300045976 | Ga0466967_0270439 | Ga0466967_0270439_651_1133 | 160 |
| 432 | 3300045976 | Ga0466967_0536814 | Ga0466967_0536814_411_893 | 160 |
| 433 | 3300045976 | Ga0466967_1300660 | Ga0466967_1300660_65_547 | 160 |
| 434 | 3300045976 | Ga0466967_1813665 | Ga0466967_1813665_65_547 | 160 |
| 435 | 3300046694 | Ga0495649_0106131 | Ga0495649_0106131_347_829 | 160 |
| 436 | 3300047320 | Ga0495672_0305970 | Ga0495672_0305970_133_615 | 160 |
| 437 | 3300048903 | Ga0496100_0010375 | Ga0496100_0010375_3522_4004 | 160 |
| 438 | 3300048903 | Ga0496100_0325317 | Ga0496100_0325317_212_694 | 160 |
| 439 | 3300048903 | Ga0496100_0421494 | Ga0496100_0421494_244_726 | 160 |
| 440 | 3300048904 | Ga0496101_0001680 | Ga0496101_0001680_11046_11528 | 160 |
| 441 | 3300048904 | Ga0496101_0020787 | Ga0496101_0020787_233_715 | 160 |
| 442 | 3300048904 | Ga0496101_0053557 | Ga0496101_0053557_2096_2578 | 160 |
| 443 | 3300048904 | Ga0496101_0081136 | Ga0496101_0081136_238_720 | 160 |
| 444 | 3300048904 | Ga0496101_0305920 | Ga0496101_0305920_424_951 | 160 |
| 445 | 3300048905 | Ga0496102_0006724 | Ga0496102_0006724_7066_7548 | 160 |
| 446 | 3300048905 | Ga0496102_0108779 | Ga0496102_0108779_1462_1944 | 160 |
| 447 | 3300048905 | Ga0496102_0187821 | Ga0496102_0187821_1314_1796 | 160 |
| 448 | 3300048905 | Ga0496102_0511346 | Ga0496102_0511346_418_912 | 160 |
| 449 | 3300048906 | Ga0496103_0001002 | Ga0496103_0001002_9460_9942 | 160 |
| 450 | 3300048907 | Ga0496104_0027137 | Ga0496104_0027137_2186_2668 | 160 |
| 451 | 3300048907 | Ga0496104_0334999 | Ga0496104_0334999_105_587 | 160 |
| 452 | 3300048907 | Ga0496104_0352322 | Ga0496104_0352322_79_561 | 160 |
| 453 | 3300048908 | Ga0496105_0058475 | Ga0496105_0058475_1839_2321 | 160 |
| 454 | 3300048908 | Ga0496105_0449509 | Ga0496105_0449509_290_772 | 160 |
| 455 | 3300048909 | Ga0496106_0000506 | Ga0496106_0000506_25151_25633 | 160 |
| 456 | 3300048909 | Ga0496106_0044144 | Ga0496106_0044144_1179_1661 | 160 |
| 457 | 3300048909 | Ga0496106_1520919 | Ga0496106_1520919_19_501 | 160 |
| 458 | 3300048910 | Ga0496107_0007237 | Ga0496107_0007237_583_1065 | 160 |
| 459 | 3300048910 | Ga0496107_0154391 | Ga0496107_0154391_563_1045 | 160 |
| 460 | 3300048910 | Ga0496107_0503604 | Ga0496107_0503604_386_868 | 160 |
| 461 | 3300048910 | Ga0496107_0604094 | Ga0496107_0604094_70_552 | 160 |
| 462 | 3300048911 | Ga0496108_0000189 | Ga0496108_0000189_29483_29965 | 160 |
| 463 | 3300048911 | Ga0496108_0007870 | Ga0496108_0007870_1114_1596 | 160 |
| 464 | 3300048911 | Ga0496108_0012395 | Ga0496108_0012395_4588_5115 | 160 |
| 465 | 3300048911 | Ga0496108_0120843 | Ga0496108_0120843_213_695 | 160 |
| 466 | 3300048912 | Ga0496109_0016352 | Ga0496109_0016352_392_874 | 160 |
| 467 | 3300048912 | Ga0496109_0025441 | Ga0496109_0025441_1843_2325 | 160 |
| 468 | 3300048912 | Ga0496109_0392989 | Ga0496109_0392989_99_581 | 160 |
| 469 | 3300048913 | Ga0496110_0039908 | Ga0496110_0039908_3419_3901 | 160 |
| 470 | 3300048913 | Ga0496110_0054698 | Ga0496110_0054698_2697_3179 | 160 |
| 471 | 3300048913 | Ga0496110_0129296 | Ga0496110_0129296_237_719 | 160 |
| 472 | 3300048913 | Ga0496110_0749954 | Ga0496110_0749954_301_783 | 160 |
| 473 | 3300048914 | Ga0496111_0037288 | Ga0496111_0037288_2245_2727 | 160 |
| 474 | 3300048915 | Ga0496112_0024551 | Ga0496112_0024551_2841_3323 | 160 |
| 475 | 3300048915 | Ga0496112_0031220 | Ga0496112_0031220_4549_5031 | 160 |
| 476 | 3300048915 | Ga0496112_0075939 | Ga0496112_0075939_1406_1888 | 160 |
| 477 | 3300048915 | Ga0496112_0111644 | Ga0496112_0111644_1774_2256 | 160 |
| 478 | 3300048915 | Ga0496112_0230938 | Ga0496112_0230938_1055_1537 | 160 |
| 479 | 3300048916 | Ga0496113_0299034 | Ga0496113_0299034_289_771 | 160 |
| 480 | 3300048916 | Ga0496113_0655846 | Ga0496113_0655846_15_497 | 160 |
| 481 | 3300048917 | Ga0496114_0005432 | Ga0496114_0005432_337_819 | 160 |
| 482 | 3300048917 | Ga0496114_0381502 | Ga0496114_0381502_312_839 | 160 |
| 483 | 3300048918 | Ga0496115_0002308 | Ga0496115_0002308_3171_3653 | 160 |
| 484 | 3300048925 | Ga0496122_0009690 | Ga0496122_0009690_5154_5636 | 160 |
| 485 | 3300048926 | Ga0496123_0114746 | Ga0496123_0114746_927_1409 | 160 |
| 486 | 3300048929 | Ga0496126_0007614 | Ga0496126_0007614_10767_11249 | 160 |
| 487 | 3300049571 | Ga0501034_0036205 | Ga0501034_0036205_2701_3183 | 160 |
| 488 | 3300049571 | Ga0501034_0320971 | Ga0501034_0320971_50_532 | 160 |
| 489 | 3300049581 | Ga0501047_0339953 | Ga0501047_0339953_772_1254 | 160 |
| 490 | 3300049584 | Ga0501068_0406000 | Ga0501068_0406000_138_620 | 160 |
| 491 | 3300049586 | Ga0501070_0025856 | Ga0501070_0025856_3237_3719 | 160 |
| 492 | 3300049588 | Ga0501072_0956058 | Ga0501072_0956058_66_548 | 160 |
| 493 | 3300049823 | Ga0501044_0707112 | Ga0501044_0707112_74_556 | 160 |
| 494 | 3300050489 | nmdc:mga03683_28646_c1 | nmdc:mga03683_28646_c1_467_949 | 160 |
| 495 | 3300050489 | nmdc:mga03683_418569_c1 | nmdc:mga03683_418569_c1_14_496 | 160 |
| 496 | 3300050490 | nmdc:mga03n38_10208_c1 | nmdc:mga03n38_10208_c1_1699_2181 | 160 |
| 497 | 3300050490 | nmdc:mga03n38_119322_c1 | nmdc:mga03n38_119322_c1_440_922 | 160 |
| 498 | 3300050490 | nmdc:mga03n38_132275_c1 | nmdc:mga03n38_132275_c1_137_619 | 160 |
| 499 | 3300050490 | nmdc:mga03n38_165275_c1 | nmdc:mga03n38_165275_c1_134_637 | 160 |
| 500 | 3300050490 | nmdc:mga03n38_17766_c1 | nmdc:mga03n38_17766_c1_2127_2609 | 160 |
| 501 | 3300050490 | nmdc:mga03n38_184758_c1 | nmdc:mga03n38_184758_c1_347_829 | 160 |
| 502 | 3300050490 | nmdc:mga03n38_240177_c1 | nmdc:mga03n38_240177_c1_345_827 | 160 |
| 503 | 3300050490 | nmdc:mga03n38_65725_c1 | nmdc:mga03n38_65725_c1_509_991 | 160 |
| 504 | 3300050490 | nmdc:mga03n38_6860_c1 | nmdc:mga03n38_6860_c1_2738_3220 | 160 |
| 505 | 3300050490 | nmdc:mga03n38_75393_c1 | nmdc:mga03n38_75393_c1_442_924 | 160 |
| 506 | 3300050490 | nmdc:mga03n38_82061_c1 | nmdc:mga03n38_82061_c1_875_1357 | 160 |
| 507 | 3300050491 | nmdc:mga00v17_10756_c1 | nmdc:mga00v17_10756_c1_4247_4729 | 160 |
| 508 | 3300050491 | nmdc:mga00v17_19691_c1 | nmdc:mga00v17_19691_c1_1402_1884 | 160 |
| 509 | 3300050491 | nmdc:mga00v17_53901_c1 | nmdc:mga00v17_53901_c1_1599_2081 | 160 |
| 510 | 3300050491 | nmdc:mga00v17_7018_c1 | nmdc:mga00v17_7018_c1_1530_2012 | 160 |
| 511 | 3300050491 | nmdc:mga00v17_771781_c1 | nmdc:mga00v17_771781_c1_31_513 | 160 |
| 512 | 3300050491 | nmdc:mga00v17_787169_c1 | nmdc:mga00v17_787169_c1_19_501 | 160 |
| 513 | 3300050492 | nmdc:mga0yw44_133195_c1 | nmdc:mga0yw44_133195_c1_271_753 | 160 |
| 514 | 3300050492 | nmdc:mga0yw44_24242_c1 | nmdc:mga0yw44_24242_c1_2721_3203 | 160 |
| 515 | 3300050492 | nmdc:mga0yw44_38854_c1 | nmdc:mga0yw44_38854_c1_1688_2170 | 160 |
| 516 | 3300050492 | nmdc:mga0yw44_46010_c1 | nmdc:mga0yw44_46010_c1_1991_2473 | 160 |
| 517 | 3300050492 | nmdc:mga0yw44_93720_c1 | nmdc:mga0yw44_93720_c1_603_1085 | 160 |
| 518 | 3300050494 | nmdc:mga06z11_163669_c1 | nmdc:mga06z11_163669_c1_776_1258 | 160 |
| 519 | 3300050494 | nmdc:mga06z11_166843_c1 | nmdc:mga06z11_166843_c1_107_589 | 160 |
| 520 | 3300050494 | nmdc:mga06z11_256609_c1 | nmdc:mga06z11_256609_c1_261_743 | 160 |
| 521 | 3300050494 | nmdc:mga06z11_290878_c1 | nmdc:mga06z11_290878_c1_36_518 | 160 |
| 522 | 3300050495 | nmdc:mga04h51_116870_c1 | nmdc:mga04h51_116870_c1_335_817 | 160 |
| 523 | 3300050496 | nmdc:mga07m45_149607_c1 | nmdc:mga07m45_149607_c1_179_661 | 160 |
| 524 | 3300050496 | nmdc:mga07m45_23734_c1 | nmdc:mga07m45_23734_c1_177_659 | 160 |
| 525 | 3300050496 | nmdc:mga07m45_29879_c1 | nmdc:mga07m45_29879_c1_548_1030 | 160 |
| 526 | 3300050496 | nmdc:mga07m45_410588_c1 | nmdc:mga07m45_410588_c1_250_732 | 160 |
| 527 | 3300050507 | nmdc:mga05p37_550920_c1 | nmdc:mga05p37_550920_c1_60_542 | 160 |
| 528 | 3300050509 | nmdc:mga0qj67_157913_c1 | nmdc:mga0qj67_157913_c1_771_1253 | 160 |
| 529 | 3300050509 | nmdc:mga0qj67_71871_c1 | nmdc:mga0qj67_71871_c1_233_715 | 160 |
| 530 | 3300050516 | nmdc:mga0sz30_135478_c1 | nmdc:mga0sz30_135478_c1_358_840 | 160 |
| 531 | 3300050516 | nmdc:mga0sz30_144825_c1 | nmdc:mga0sz30_144825_c1_290_772 | 160 |
| 532 | 3300050516 | nmdc:mga0sz30_8036_c2 | nmdc:mga0sz30_8036_c2_1512_1994 | 160 |
| 533 | 3300050516 | nmdc:mga0sz30_8890_c1 | nmdc:mga0sz30_8890_c1_2933_3415 | 160 |
| 534 | 3300053083 | Ga0495655_0006375 | Ga0495655_0006375_283_765 | 160 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vdu-assembly3.cif.gz_D | structure of trm8-trm82, the yeast trna m7g methylation complex | 0.5093 | 59 | 108 |
| 2vdu-assembly2.cif.gz_B | structure of trm8-trm82, the yeast trna m7g methylation complex | 0.509 | 59 | 108 |
| 5g04-assembly1.cif.gz_A | structure of the human apc-cdc20-hsl1 complex | 0.5029 | 56 | 107 |
| 6wxu-assembly1.cif.gz_D | cryoem structure of mouse duox1-duoxa1 complex in the dimer-of-dimer state | 0.502 | 34 | 86 |
| 6wxv-assembly1.cif.gz_B | cryoem structure of mouse duox1-duoxa1 complex in the presence of nadph | 0.4924 | 34 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07234_1_160_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.9561 | 1 | 160 | 2.30.29.30 |
| af_Q58949_16_254_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.5336 | 59 | 107 | 2.130.10.10 |
| af_A0A0G2K9M5_145_249_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.5056 | 14 | 134 | 2.30.29.30 |
| af_K7MHP5_99_389_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.5004 | 12 | 107 | 2.120.10.80 |
| af_Q18966_3_89_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.4978 | 23 | 90 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W5SQ28-F1-model_v4 | deleted | 0.9919 | 2 | 160 |
|
| AF-A0A7I9XW54-F1-model_v4 | DUF4166 domain-containing protein | 0.9868 | 1 | 160 |
|
| AF-A0A7I9XW54-F1-model_v4 | DUF4166 domain-containing protein | 0.9807 | 1 | 160 |
|
| AF-A0A7W5SQ28-F1-model_v4 | deleted | 0.9796 | 2 | 160 |
|
| AF-A0A1C2B9A5-F1-model_v4 | deleted | 0.9791 | 9 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar