F460300

General Info

Members Datasets Scaffolds Average Seq Length
532 222 532 234

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0440541|Ga0373925_0440541_195_902
Length 227
Sequence MTALPTFEIPTVPIHGGAERFPVRHVYCVGRNYAEHAKEMGGDASKEPPFFFTKAADSVVPVVPPAVGSIAYPLATKNFHHEIELVVAIGGRGARLPPERALSVVFGYAVGLDMTRRDLQSDMREKKRPWDIGKSFAGAAPIVGHLARGAIWVDVNGTRRQTGDLADMIWDVPHTLAFLSQYYELLPGDLVFTGTPSGVGPVVAGDRLDGGIDALGSLAVTVGPPIL

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.82
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1007012 3300001976 Bacteria 1472
2 JGI24746J21847_1020783 3300001977 Bacteria 920
3 JGI24749J21850_1002611 3300002076 Bacteria 2527
4 JGI24035J26624_1009658 3300002126 Bacteria 952
5 Ga0065715_10186585 3300005293 Bacteria 1441
6 Ga0070676_10002968 3300005328 Bacteria 8766
7 Ga0070676_10010362 3300005328 Bacteria 5056
8 Ga0070676_10038133 3300005328 Bacteria 2775
9 Ga0070676_10124284 3300005328 Bacteria 1623
10 Ga0070683_100064230 3300005329 Bacteria 3417
11 Ga0070683_100240109 3300005329 Bacteria 1723
12 Ga0070683_100563981 3300005329 Bacteria 1089
13 Ga0070690_100170974 3300005330 Bacteria 1495
14 Ga0070690_100363437 3300005330 Bacteria 1054
15 Ga0070670_100065001 3300005331 Bacteria 3130
16 Ga0070670_100120456 3300005331 Bacteria 2263
17 Ga0070670_100232967 3300005331 Bacteria 1603
18 Ga0070670_100311616 3300005331 Bacteria 1378
19 Ga0070677_10000399 3300005333 Bacteria 15153
20 Ga0070677_10002466 3300005333 Bacteria 5923
21 Ga0070677_10004021 3300005333 Bacteria 4775
22 Ga0068869_100000108 3300005334 Bacteria 39249
23 Ga0068869_100020312 3300005334 Bacteria 4553
24 Ga0070666_10001754 3300005335 Bacteria 13241
25 Ga0070666_10026451 3300005335 Bacteria 3791
26 Ga0070666_10038220 3300005335 Bacteria 3193
27 Ga0070680_100095133 3300005336 Bacteria 2469
28 Ga0070680_100135663 3300005336 Bacteria 2061
29 Ga0070680_100857832 3300005336 Bacteria 783
30 Ga0070682_100221197 3300005337 Bacteria 1348
31 Ga0068868_100006441 3300005338 Bacteria 8309
32 Ga0068868_100011862 3300005338 Bacteria 6355
33 Ga0068868_100056259 3300005338 Bacteria 3106
34 Ga0068868_100090852 3300005338 Bacteria 2460
35 Ga0068868_100181487 3300005338 Bacteria 1746
36 Ga0070660_100012123 3300005339 Bacteria 6154
37 Ga0070660_100066098 3300005339 Bacteria 2814
38 Ga0070660_100464495 3300005339 Bacteria 1051
39 Ga0070660_100468949 3300005339 Bacteria 1046
40 Ga0070689_100014335 3300005340 Bacteria 5756
41 Ga0070689_100114572 3300005340 Bacteria 2148
42 Ga0070689_100141774 3300005340 Bacteria 1933
43 Ga0070689_100658069 3300005340 Bacteria 912
44 Ga0070687_100384223 3300005343 Bacteria 916
45 Ga0070661_100005143 3300005344 Bacteria 9010
46 Ga0070661_100007131 3300005344 Bacteria 7706
47 Ga0070661_100016337 3300005344 Bacteria 5246
48 Ga0070661_100033352 3300005344 Bacteria 3729
49 Ga0070661_100057780 3300005344 Bacteria 2842
50 Ga0070661_100065403 3300005344 Bacteria 2672
51 Ga0070661_100351859 3300005344 Bacteria 1156
52 Ga0070661_100508687 3300005344 Bacteria 965
53 Ga0070668_100025885 3300005347 Bacteria 4449
54 Ga0070668_100031665 3300005347 Bacteria 4024
55 Ga0070668_100037182 3300005347 Bacteria 3717
56 Ga0070668_100090578 3300005347 Bacteria 2409
57 Ga0070668_100090767 3300005347 Bacteria 2407
58 Ga0070669_100000482 3300005353 Bacteria 30329
59 Ga0070669_100028863 3300005353 Bacteria 3996
60 Ga0070675_100005354 3300005354 Bacteria 9811
61 Ga0070675_100038658 3300005354 Bacteria 3890
62 Ga0070675_100120329 3300005354 Bacteria 2230
63 Ga0070671_100004778 3300005355 Bacteria 10770
64 Ga0070671_100005229 3300005355 Bacteria 10344
65 Ga0070671_100051697 3300005355 Bacteria 3418
66 Ga0070671_100749280 3300005355 Bacteria 849
67 Ga0070674_100004774 3300005356 Bacteria 7764
68 Ga0070674_100031998 3300005356 Bacteria 3491
69 Ga0070674_100193973 3300005356 Bacteria 1564
70 Ga0070674_100434996 3300005356 Bacteria 1079
71 Ga0070673_100001176 3300005364 Bacteria 15032
72 Ga0070673_100027742 3300005364 Bacteria 4200
73 Ga0070688_100016771 3300005365 Bacteria 4193
74 Ga0070688_100020439 3300005365 Bacteria 3851
75 Ga0070688_100199834 3300005365 Bacteria 1398
76 Ga0070659_100022667 3300005366 Bacteria 4795
77 Ga0070659_100075387 3300005366 Bacteria 2689
78 Ga0070659_100092659 3300005366 Bacteria 2423
79 Ga0070659_100120210 3300005366 Bacteria 2127
80 Ga0070667_100001817 3300005367 Bacteria 19009
81 Ga0070667_100003815 3300005367 Bacteria 12806
82 Ga0070667_100022212 3300005367 Bacteria 5264
83 Ga0070667_100041022 3300005367 Bacteria 3883
84 Ga0070667_100059966 3300005367 Bacteria 3220
85 Ga0070667_100100736 3300005367 Bacteria 2495
86 Ga0070667_100269379 3300005367 Bacteria 1527
87 Ga0070667_100426498 3300005367 Bacteria 1210
88 Ga0070709_10189103 3300005434 Bacteria 1451
89 Ga0070714_100004596 3300005435 Bacteria 10409
90 Ga0070714_100007506 3300005435 Bacteria 8487
91 Ga0070714_100022875 3300005435 Bacteria 5128
92 Ga0070713_100026589 3300005436 Bacteria 4546
93 Ga0070713_100318343 3300005436 Bacteria 1436
94 Ga0070710_10000687 3300005437 Bacteria 16064
95 Ga0070711_100030508 3300005439 Bacteria 3569
96 Ga0070711_100088699 3300005439 Bacteria 2223
97 Ga0070663_100008998 3300005455 Bacteria 6165
98 Ga0070663_100607683 3300005455 Bacteria 920
99 Ga0070678_100016839 3300005456 Bacteria 4687
100 Ga0070678_100020355 3300005456 Bacteria 4352
101 Ga0070678_100171756 3300005456 Bacteria 1766
102 Ga0070662_100095159 3300005457 Bacteria 2244
103 Ga0070662_100484910 3300005457 Bacteria 1030
104 Ga0070681_10012832 3300005458 Bacteria 8318
105 Ga0070681_10253132 3300005458 Bacteria 1673
106 Ga0068867_100001466 3300005459 Bacteria 16338
107 Ga0068867_100002533 3300005459 Bacteria 12859
108 Ga0068867_100009464 3300005459 Bacteria 6871
109 Ga0068867_100175113 3300005459 Bacteria 1702
110 Ga0068867_100851509 3300005459 Bacteria 817
111 Ga0070707_100881527 3300005468 Bacteria 859
112 Ga0070699_100039227 3300005518 Bacteria 4101
113 Ga0070679_100008089 3300005530 Bacteria 9883
114 Ga0070679_100012228 3300005530 Bacteria 8198
115 Ga0070679_100030058 3300005530 Bacteria 5362
116 Ga0070679_100057307 3300005530 Bacteria 3883
117 Ga0070679_100097318 3300005530 Bacteria 2930
118 Ga0070679_100206760 3300005530 Bacteria 1927
119 Ga0070684_100001542 3300005535 Bacteria 16627
120 Ga0070684_100033871 3300005535 Bacteria 4364
121 Ga0070684_100274283 3300005535 Bacteria 1544
122 Ga0070684_100385040 3300005535 Bacteria 1292
123 Ga0068853_100033222 3300005539 Bacteria 4375
124 Ga0068853_100080703 3300005539 Bacteria 2847
125 Ga0068853_100085998 3300005539 Bacteria 2757
126 Ga0068853_100373923 3300005539 Bacteria 1330
127 Ga0068853_100519419 3300005539 Bacteria 1126
128 Ga0070672_100001353 3300005543 Bacteria 15124
129 Ga0070672_100001874 3300005543 Bacteria 13152
130 Ga0070672_100156020 3300005543 Bacteria 1891
131 Ga0070672_100385641 3300005543 Bacteria 1199
132 Ga0070672_100484680 3300005543 Bacteria 1068
133 Ga0070696_100014222 3300005546 Bacteria 5340
134 Ga0070693_100318270 3300005547 Bacteria 1055
135 Ga0070665_100001984 3300005548 Bacteria 23024
136 Ga0070665_100063857 3300005548 Bacteria 3692
137 Ga0070665_100365677 3300005548 Bacteria 1449
138 Ga0068855_100019744 3300005563 Bacteria 8092
139 Ga0068855_100187278 3300005563 Bacteria 2337
140 Ga0070664_100002461 3300005564 Bacteria 14911
141 Ga0070664_100045817 3300005564 Bacteria 3693
142 Ga0070664_100057489 3300005564 Bacteria 3306
143 Ga0070664_100095464 3300005564 Bacteria 2579
144 Ga0070664_100181088 3300005564 Bacteria 1873
145 Ga0070664_100274808 3300005564 Bacteria 1518
146 Ga0068857_100002627 3300005577 Bacteria 14748
147 Ga0068857_100114401 3300005577 Bacteria 2426
148 Ga0068857_100153625 3300005577 Bacteria 2086
149 Ga0068854_100002763 3300005578 Bacteria 10903
150 Ga0068856_100003325 3300005614 Bacteria 16338
151 Ga0068856_100003654 3300005614 Bacteria 15456
152 Ga0068856_100012536 3300005614 Bacteria 8206
153 Ga0070702_100021708 3300005615 Bacteria 3383
154 Ga0068852_100004888 3300005616 Bacteria 9517
155 Ga0068852_100010061 3300005616 Bacteria 7039
156 Ga0068852_100017500 3300005616 Bacteria 5625
157 Ga0068852_100686830 3300005616 Bacteria 1033
158 Ga0068859_100000217 3300005617 Bacteria 56968
159 Ga0068859_100002842 3300005617 Bacteria 17566
160 Ga0068859_100087220 3300005617 Bacteria 3168
161 Ga0068859_100551534 3300005617 Bacteria 1247
162 Ga0068864_100015296 3300005618 Bacteria 6381
163 Ga0068864_100025290 3300005618 Bacteria 4999
164 Ga0068864_100066851 3300005618 Bacteria 3121
165 Ga0068864_100317733 3300005618 Bacteria 1462
166 Ga0068866_10033930 3300005718 Bacteria 2481
167 Ga0068861_100040936 3300005719 Bacteria 3468
168 Ga0068861_100691751 3300005719 Bacteria 946
169 Ga0068851_10000506 3300005834 Bacteria 17035
170 Ga0068851_10000682 3300005834 Bacteria 14458
171 Ga0068851_10009081 3300005834 Bacteria 4614
172 Ga0068851_10038811 3300005834 Bacteria 2390
173 Ga0068870_10005548 3300005840 Bacteria 5510
174 Ga0068863_100030801 3300005841 Bacteria 5123
175 Ga0068863_100127597 3300005841 Bacteria 2427
176 Ga0068863_100137327 3300005841 Bacteria 2336
177 Ga0068863_100616755 3300005841 Bacteria 1074
178 Ga0068858_100004830 3300005842 Bacteria 13204
179 Ga0068858_100016224 3300005842 Bacteria 6998
180 Ga0068858_100075295 3300005842 Bacteria 3135
181 Ga0068858_100134563 3300005842 Bacteria 2319
182 Ga0068858_100151332 3300005842 Bacteria 2182
183 Ga0068858_100154739 3300005842 Bacteria 2157
184 Ga0068858_100372346 3300005842 Bacteria 1370
185 Ga0068860_100011373 3300005843 Bacteria 8772
186 Ga0068860_100024360 3300005843 Bacteria 5848
187 Ga0068860_100323708 3300005843 Bacteria 1513
188 Ga0068862_100031836 3300005844 Bacteria 4454
189 Ga0068862_100068977 3300005844 Bacteria 3051
190 Ga0068862_100324696 3300005844 Bacteria 1422
191 Ga0068862_100973969 3300005844 Bacteria 838
192 Ga0097621_100000380 3300006237 Bacteria 30961
193 Ga0097621_100734776 3300006237 Unclassified 911
194 Ga0068871_100330931 3300006358 Bacteria 1343
195 Ga0075428_100027029 3300006844 Bacteria 6353
196 Ga0068865_100003738 3300006881 Bacteria 9139
197 Ga0068865_100253326 3300006881 Bacteria 1390
198 Ga0097620_100000217 3300006931 Bacteria 56968
199 Ga0097620_100002842 3300006931 Bacteria 17566
200 Ga0097620_100087224 3300006931 Bacteria 3168
201 Ga0097620_100551407 3300006931 Bacteria 1247
202 Ga0105240_10013105 3300009093 Bacteria 11409
203 Ga0105240_10021400 3300009093 Bacteria 8601
204 Ga0111539_10055286 3300009094 Bacteria 4718
205 Ga0105243_10202859 3300009148 Bacteria 1740
206 Ga0105241_10044414 3300009174 Bacteria 3367
207 Ga0105241_10089214 3300009174 Bacteria 2429
208 Ga0105242_10244688 3300009176 Bacteria 1614
209 Ga0105248_10002088 3300009177 Bacteria 22111
210 Ga0105248_10002614 3300009177 Bacteria 20045
211 Ga0105248_10245953 3300009177 Bacteria 2013
212 Ga0105248_10560600 3300009177 Bacteria 1289
213 Ga0105248_10736469 3300009177 Unclassified 1112
214 Ga0105237_10030494 3300009545 Bacteria 5476
215 Ga0105237_10193568 3300009545 Bacteria 2033
216 Ga0105237_10433164 3300009545 Bacteria 1321
217 Ga0105238_10010467 3300009551 Bacteria 9309
218 Ga0105249_10238954 3300009553 Bacteria 1795
219 Ga0105239_10099207 3300010375 Bacteria 3220
220 Ga0157373_10035784 3300013100 Bacteria 3563
221 Ga0157373_10077649 3300013100 Bacteria 2343
222 Ga0157371_10020786 3300013102 Bacteria 4828
223 Ga0157371_10118647 3300013102 Bacteria 1881
224 Ga0157371_10338601 3300013102 Bacteria 1094
225 Ga0157370_10000893 3300013104 Bacteria 37892
226 Ga0157370_10011952 3300013104 Bacteria 9048
227 Ga0157370_10038691 3300013104 Bacteria 4613
228 Ga0157370_10218720 3300013104 Bacteria 1764
229 Ga0157370_10381747 3300013104 Bacteria 1298
230 Ga0157369_10005334 3300013105 Bacteria 14979
231 Ga0157369_10006475 3300013105 Bacteria 13573
232 Ga0157369_10038630 3300013105 Bacteria 5219
233 Ga0157369_10095984 3300013105 Bacteria 3163
234 Ga0157369_10140396 3300013105 Bacteria 2557
235 Ga0157374_10026894 3300013296 Bacteria 5181
236 Ga0157374_10048901 3300013296 Bacteria 3925
237 Ga0157374_10052217 3300013296 Bacteria 3806
238 Ga0157374_10642424 3300013296 Bacteria 1073
239 Ga0157378_10471659 3300013297 Bacteria 1249
240 Ga0163162_10001723 3300013306 Bacteria 20486
241 Ga0163162_10268141 3300013306 Bacteria 1839
242 Ga0157372_10012901 3300013307 Bacteria 8908
243 Ga0157372_10063295 3300013307 Bacteria 4147
244 Ga0157372_10094978 3300013307 Bacteria 3396
245 Ga0157372_10142657 3300013307 Bacteria 2761
246 Ga0157372_10198419 3300013307 Bacteria 2324
247 Ga0157372_10259244 3300013307 Bacteria 2019
248 Ga0157372_10259930 3300013307 Bacteria 2016
249 Ga0157372_10734768 3300013307 Bacteria 1148
250 Ga0157372_10979218 3300013307 Bacteria 980
251 Ga0157375_10003757 3300013308 Bacteria 13163
252 Ga0157375_10009466 3300013308 Bacteria 8553
253 Ga0157375_10032850 3300013308 Bacteria 4925
254 Ga0157375_10265728 3300013308 Bacteria 1877
255 Ga0157375_10594153 3300013308 Bacteria 1266
256 Ga0163163_10027486 3300014325 Bacteria 5450
257 Ga0163163_10066448 3300014325 Bacteria 3581
258 Ga0157380_10047964 3300014326 Bacteria 3362
259 Ga0182008_10123840 3300014497 Bacteria 1286
260 Ga0157377_10004959 3300014745 Bacteria 6205
261 Ga0157379_10003822 3300014968 Bacteria 12838
262 Ga0157379_10015344 3300014968 Bacteria 6721
263 Ga0157379_10402239 3300014968 Bacteria 1259
264 Ga0157376_10033384 3300014969 Bacteria 4143
265 Ga0157376_10292704 3300014969 Bacteria 1538
266 Ga0163161_10021774 3300017792 Bacteria 4507
267 Ga0163161_10031650 3300017792 Bacteria 3771
268 Ga0206356_10593666 3300020070 Bacteria 1245
269 Ga0206354_11341275 3300020081 Bacteria 1404
270 Ga0207673_1003898 3300025290 Bacteria 1760
271 Ga0207697_10000319 3300025315 Bacteria 26864
272 Ga0207656_10004660 3300025321 Bacteria 4807
273 Ga0207656_10017184 3300025321 Bacteria 2829
274 Ga0207656_10037161 3300025321 Bacteria 2048
275 Ga0207682_10000075 3300025893 Bacteria 43404
276 Ga0207682_10002499 3300025893 Bacteria 8216
277 Ga0207692_10051069 3300025898 Bacteria 2095
278 Ga0207688_10070330 3300025901 Bacteria 1984
279 Ga0207688_10148368 3300025901 Bacteria 1384
280 Ga0207680_10000486 3300025903 Bacteria 18844
281 Ga0207680_10001434 3300025903 Bacteria 11296
282 Ga0207680_10267069 3300025903 Bacteria 1186
283 Ga0207699_10003665 3300025906 Bacteria 7336
284 Ga0207645_10000152 3300025907 Bacteria 54586
285 Ga0207645_10002330 3300025907 Bacteria 15002
286 Ga0207645_10012159 3300025907 Bacteria 5846
287 Ga0207645_10046452 3300025907 Bacteria 2774
288 Ga0207645_10073475 3300025907 Bacteria 2189
289 Ga0207643_10000851 3300025908 Bacteria 18500
290 Ga0207643_10144732 3300025908 Bacteria 1421
291 Ga0207705_10034967 3300025909 Bacteria 3594
292 Ga0207654_10025709 3300025911 Bacteria 3180
293 Ga0207707_10013313 3300025912 Bacteria 7169
294 Ga0207707_10019919 3300025912 Bacteria 5856
295 Ga0207707_10068931 3300025912 Bacteria 3082
296 Ga0207695_10026649 3300025913 Bacteria 6450
297 Ga0207695_10045749 3300025913 Bacteria 4644
298 Ga0207671_10200979 3300025914 Bacteria 1556
299 Ga0207693_10133207 3300025915 Bacteria 1953
300 Ga0207663_10113573 3300025916 Bacteria 1842
301 Ga0207663_10348085 3300025916 Bacteria 1121
302 Ga0207660_10002028 3300025917 Bacteria 13478
303 Ga0207662_10111056 3300025918 Bacteria 1709
304 Ga0207662_10507058 3300025918 Bacteria 831
305 Ga0207657_10000093 3300025919 Bacteria 85263
306 Ga0207657_10001139 3300025919 Bacteria 28216
307 Ga0207657_10006415 3300025919 Bacteria 12199
308 Ga0207657_10022789 3300025919 Bacteria 5848
309 Ga0207657_10150293 3300025919 Bacteria 1897
310 Ga0207657_10167995 3300025919 Bacteria 1778
311 Ga0207649_10004462 3300025920 Bacteria 7599
312 Ga0207649_10006859 3300025920 Bacteria 6185
313 Ga0207649_10016245 3300025920 Bacteria 4194
314 Ga0207649_10437260 3300025920 Bacteria 985
315 Ga0207652_10004714 3300025921 Bacteria 11056
316 Ga0207652_10009141 3300025921 Bacteria 7976
317 Ga0207652_10064338 3300025921 Bacteria 3174
318 Ga0207652_10138820 3300025921 Bacteria 2172
319 Ga0207652_10187597 3300025921 Bacteria 1859
320 Ga0207681_10003320 3300025923 Bacteria 10074
321 Ga0207681_10150652 3300025923 Bacteria 1742
322 Ga0207681_10169607 3300025923 Bacteria 1653
323 Ga0207694_10002004 3300025924 Bacteria 16854
324 Ga0207694_10011390 3300025924 Bacteria 6712
325 Ga0207650_10003684 3300025925 Bacteria 10477
326 Ga0207650_10006975 3300025925 Bacteria 7702
327 Ga0207650_10010136 3300025925 Bacteria 6458
328 Ga0207650_10054956 3300025925 Bacteria 2954
329 Ga0207650_10058669 3300025925 Bacteria 2866
330 Ga0207650_10092059 3300025925 Bacteria 2318
331 Ga0207650_10300226 3300025925 Bacteria 1311
332 Ga0207650_10484410 3300025925 Bacteria 1032
333 Ga0207659_10002569 3300025926 Bacteria 10806
334 Ga0207659_10003749 3300025926 Bacteria 9163
335 Ga0207659_10037947 3300025926 Bacteria 3348
336 Ga0207700_10000045 3300025928 Bacteria 88536
337 Ga0207700_10192761 3300025928 Bacteria 1713
338 Ga0207700_10401948 3300025928 Bacteria 1201
339 Ga0207664_10001519 3300025929 Bacteria 15217
340 Ga0207664_10015073 3300025929 Bacteria 5600
341 Ga0207664_10021433 3300025929 Bacteria 4805
342 Ga0207664_10556819 3300025929 Bacteria 1029
343 Ga0207644_10000862 3300025931 Bacteria 19192
344 Ga0207644_10018400 3300025931 Bacteria 4726
345 Ga0207644_10200671 3300025931 Bacteria 1573
346 Ga0207644_10207115 3300025931 Bacteria 1549
347 Ga0207690_10092775 3300025932 Bacteria 2138
348 Ga0207690_10167015 3300025932 Bacteria 1645
349 Ga0207690_10256461 3300025932 Bacteria 1353
350 Ga0207706_10007913 3300025933 Bacteria 9809
351 Ga0207706_10105624 3300025933 Bacteria 2478
352 Ga0207670_10131084 3300025936 Bacteria 1837
353 Ga0207670_10277682 3300025936 Bacteria 1304
354 Ga0207669_10001543 3300025937 Bacteria 9822
355 Ga0207669_10085108 3300025937 Bacteria 2040
356 Ga0207669_10116847 3300025937 Bacteria 1801
357 Ga0207704_10002721 3300025938 Bacteria 7973
358 Ga0207704_10127659 3300025938 Bacteria 1754
359 Ga0207691_10000006 3300025940 Bacteria 161922
360 Ga0207691_10009804 3300025940 Bacteria 9197
361 Ga0207691_10010195 3300025940 Bacteria 9014
362 Ga0207691_10040936 3300025940 Bacteria 4280
363 Ga0207691_10095166 3300025940 Bacteria 2664
364 Ga0207691_10665614 3300025940 Bacteria 879
365 Ga0207711_10026184 3300025941 Bacteria 4893
366 Ga0207711_10069173 3300025941 Bacteria 3059
367 Ga0207711_10187691 3300025941 Bacteria 1883
368 Ga0207711_10261159 3300025941 Bacteria 1592
369 Ga0207689_10000030 3300025942 Bacteria 97584
370 Ga0207689_10002080 3300025942 Bacteria 18880
371 Ga0207661_10082071 3300025944 Bacteria 2664
372 Ga0207661_10433289 3300025944 Bacteria 1195
373 Ga0207679_10008964 3300025945 Bacteria 6391
374 Ga0207679_10022620 3300025945 Bacteria 4283
375 Ga0207679_10048385 3300025945 Bacteria 3095
376 Ga0207679_10092208 3300025945 Bacteria 2346
377 Ga0207679_10832526 3300025945 Bacteria 842
378 Ga0207667_10000410 3300025949 Bacteria 58059
379 Ga0207667_10003249 3300025949 Bacteria 20059
380 Ga0207667_10088541 3300025949 Bacteria 3201
381 Ga0207667_10119726 3300025949 Bacteria 2713
382 Ga0207651_10003988 3300025960 Bacteria 7337
383 Ga0207651_10009648 3300025960 Bacteria 5301
384 Ga0207651_10344074 3300025960 Bacteria 1254
385 Ga0207712_10051920 3300025961 Bacteria 2869
386 Ga0207668_10009342 3300025972 Bacteria 5870
387 Ga0207668_10079566 3300025972 Bacteria 2371
388 Ga0207668_10212219 3300025972 Bacteria 1549
389 Ga0207668_10453904 3300025972 Bacteria 1094
390 Ga0207640_10034409 3300025981 Bacteria 3162
391 Ga0207640_10041560 3300025981 Bacteria 2925
392 Ga0207640_10103740 3300025981 Bacteria 2000
393 Ga0207640_10293905 3300025981 Bacteria 1282
394 Ga0207640_10525445 3300025981 Unclassified 990
395 Ga0207658_10002793 3300025986 Bacteria 12571
396 Ga0207658_10003664 3300025986 Bacteria 10837
397 Ga0207658_10010570 3300025986 Bacteria 6272
398 Ga0207658_10033513 3300025986 Bacteria 3665
399 Ga0207658_10076087 3300025986 Bacteria 2556
400 Ga0207658_10149631 3300025986 Bacteria 1900
401 Ga0207677_10010904 3300026023 Bacteria 5160
402 Ga0207677_10068808 3300026023 Bacteria 2487
403 Ga0207677_10271219 3300026023 Bacteria 1388
404 Ga0207677_10579480 3300026023 Bacteria 982
405 Ga0207703_10018924 3300026035 Bacteria 5380
406 Ga0207703_10039927 3300026035 Bacteria 3753
407 Ga0207703_10102256 3300026035 Bacteria 2431
408 Ga0207703_10429091 3300026035 Bacteria 1231
409 Ga0207639_10003283 3300026041 Bacteria 10888
410 Ga0207639_10032420 3300026041 Bacteria 3846
411 Ga0207639_10060361 3300026041 Bacteria 2925
412 Ga0207639_10282537 3300026041 Bacteria 1460
413 Ga0207678_10004977 3300026067 Bacteria 11917
414 Ga0207678_10008744 3300026067 Bacteria 8913
415 Ga0207678_10070138 3300026067 Bacteria 3005
416 Ga0207678_10283352 3300026067 Bacteria 1422
417 Ga0207708_10026820 3300026075 Bacteria 4361
418 Ga0207702_10002033 3300026078 Bacteria 19598
419 Ga0207702_10002576 3300026078 Bacteria 17051
420 Ga0207702_10013518 3300026078 Bacteria 6781
421 Ga0207641_10003854 3300026088 Bacteria 13135
422 Ga0207641_10026143 3300026088 Bacteria 4816
423 Ga0207641_10048697 3300026088 Bacteria 3578
424 Ga0207641_10177746 3300026088 Bacteria 1947
425 Ga0207648_10003534 3300026089 Bacteria 16341
426 Ga0207648_10006993 3300026089 Bacteria 11157
427 Ga0207648_10027992 3300026089 Bacteria 5000
428 Ga0207648_10226715 3300026089 Bacteria 1661
429 Ga0207676_10005417 3300026095 Bacteria 9032
430 Ga0207676_10015541 3300026095 Bacteria 5493
431 Ga0207676_10048815 3300026095 Bacteria 3288
432 Ga0207674_10000205 3300026116 Bacteria 73346
433 Ga0207674_10000749 3300026116 Bacteria 42581
434 Ga0207674_10012924 3300026116 Bacteria 9311
435 Ga0207674_10028634 3300026116 Bacteria 5876
436 Ga0207675_100000852 3300026118 Bacteria 30393
437 Ga0207675_100003107 3300026118 Bacteria 16280
438 Ga0207683_10000056 3300026121 Bacteria 84718
439 Ga0207683_10000700 3300026121 Bacteria 30630
440 Ga0207683_10044769 3300026121 Bacteria 3869
441 Ga0207683_10313336 3300026121 Bacteria 1437
442 Ga0207698_10000366 3300026142 Bacteria 26504
443 Ga0207698_10023043 3300026142 Bacteria 4343
444 Ga0207698_10081713 3300026142 Bacteria 2609
445 Ga0207698_10579271 3300026142 Bacteria 1104
446 Ga0209969_1009951 3300027360 Bacteria 1358
447 Ga0209981_1009038 3300027378 Bacteria 1359
448 Ga0209970_1014088 3300027614 Bacteria 1327
449 Ga0209983_1016009 3300027665 Bacteria 1547
450 Ga0209971_1001234 3300027682 Bacteria 6406
451 Ga0268266_10014129 3300028379 Bacteria 6874
452 Ga0268266_10014630 3300028379 Bacteria 6743
453 Ga0268266_10277589 3300028379 Bacteria 1557
454 Ga0268266_10567288 3300028379 Bacteria 1089
455 Ga0268265_10433055 3300028380 Bacteria 1224
456 Ga0268265_10440983 3300028380 Bacteria 1214
457 Ga0268265_10565708 3300028380 Bacteria 1081
458 Ga0268264_10003459 3300028381 Bacteria 13616
459 Ga0268264_10008098 3300028381 Bacteria 8742
460 Ga0268264_10170995 3300028381 Bacteria 1965
461 Ga0307408_100006423 3300031548 Bacteria 7795
462 Ga0307405_10021290 3300031731 Bacteria 3641
463 Ga0307413_10663931 3300031824 Bacteria 861
464 Ga0307410_10004248 3300031852 Bacteria 7370
465 Ga0307406_10053508 3300031901 Bacteria 2571
466 Ga0307407_10001704 3300031903 Bacteria 8175
467 Ga0307412_10007574 3300031911 Bacteria 6165
468 Ga0307409_100001026 3300031995 Bacteria 13083
469 Ga0307409_100561904 3300031995 Bacteria 1122
470 Ga0307416_100142446 3300032002 Bacteria 2181
471 Ga0307414_10770928 3300032004 Bacteria 875
472 Ga0307411_10000807 3300032005 Bacteria 11702
473 Ga0307415_100026473 3300032126 Bacteria 3659
474 Ga0373954_0124080 3300035118 Bacteria 1255
475 Ga0373956_0082341 3300035119 Bacteria 1478
476 Ga0373946_0123107 3300035171 Bacteria 1186
477 Ga0373955_0244910 3300035172 Bacteria 1074
478 Ga0373924_0004339 3300035410 Bacteria 4950
479 Ga0373927_0040790 3300035695 Bacteria 3011
480 Ga0373947_0267278 3300035725 Bacteria 1134
481 Ga0373937_0033401 3300036401 Bacteria 4672
482 Ga0373937_0878888 3300036401 Bacteria 845
483 Ga0373925_0271217 3300037068 Bacteria 1365
484 Ga0373925_0440541 3300037068 Bacteria 1066
485 Ga0373925_0942757 3300037068 Bacteria 711
486 Ga0395900_0048985 3300037418 Bacteria 4352
487 Ga0395898_0024992 3300037466 Bacteria 6022
488 Ga0395905_0261715 3300037471 Bacteria 1615
489 Ga0451845_0985314 3300041501 Bacteria 1280
490 Ga0466963_0068802 3300044694 Bacteria 2379
491 Ga0451576_0497140 3300045051 Bacteria 1281
492 Ga0495580_0023904 3300046472 Bacteria 4480
493 Ga0495580_0275544 3300046472 Bacteria 1148
494 Ga0495580_0503482 3300046472 Bacteria 808
495 Ga0495582_0428295 3300046473 Bacteria 763
496 Ga0495630_0532298 3300046517 Bacteria 901
497 Ga0495598_0034946 3300046537 Bacteria 1436
498 Ga0495658_0196516 3300046683 Bacteria 1256
499 Ga0495658_0199792 3300046683 Bacteria 1246
500 Ga0495604_0427283 3300047317 Bacteria 869
501 Ga0496104_0014540 3300048907 Bacteria 7109
502 Ga0496105_0381768 3300048908 Bacteria 1121
503 Ga0496106_0061640 3300048909 Bacteria 2846
504 Ga0496106_0441980 3300048909 Bacteria 1045
505 Ga0496107_0040743 3300048910 Bacteria 3335
506 Ga0496108_0034386 3300048911 Bacteria 4211
507 Ga0496108_0039168 3300048911 Bacteria 3952
508 Ga0496109_0120495 3300048912 Bacteria 2444
509 Ga0496109_0322347 3300048912 Bacteria 1458
510 Ga0496110_0063038 3300048913 Bacteria 3275
511 Ga0496110_0423288 3300048913 Bacteria 1214
512 Ga0496110_0741641 3300048913 Bacteria 885
513 Ga0496112_0001802 3300048915 Bacteria 16862
514 Ga0496113_0348320 3300048916 Bacteria 1188
515 Ga0496114_0138207 3300048917 Bacteria 2107
516 Ga0501034_0028364 3300049571 Bacteria 5696
517 Ga0501041_0132662 3300049577 Bacteria 1552
518 Ga0501042_0280679 3300049578 Bacteria 1203
519 Ga0501047_0105302 3300049581 Bacteria 2701
520 Ga0501048_0097229 3300049582 Bacteria 2077
521 Ga0501070_0011144 3300049586 Bacteria 7588
522 Ga0501070_0616242 3300049586 Bacteria 864
523 Ga0501071_0525767 3300049587 Bacteria 908
524 Ga0501072_0169526 3300049588 Bacteria 1742
525 Ga0501080_0000772 3300049742 Bacteria 26012
526 Ga0501081_0442986 3300049743 Bacteria 964
527 Ga0501083_0240904 3300049744 Bacteria 1177
528 Ga0501035_0143882 3300049822 Bacteria 2072
529 nmdc:mga08y16_38103_c1 3300050511 Bacteria 5048
530 nmdc:mga08x19_855708_c1 3300050514 Bacteria 646
531 Ga0501084_0145961 3300054114 Bacteria 1993
532 Ga0501082_0127999 3300060353 Bacteria 2203

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0503482 Ga0495580_0503482_186_764 192
2 3300050514 nmdc:mga08x19_855708_c1 nmdc:mga08x19_855708_c1_37_633 196
3 3300035725 Ga0373947_0267278 Ga0373947_0267278_32_643 203
4 3300046473 Ga0495582_0428295 Ga0495582_0428295_21_632 203
5 3300046517 Ga0495630_0532298 Ga0495630_0532298_26_637 203
6 3300037068 Ga0373925_0942757 Ga0373925_0942757_77_700 207
7 3300048916 Ga0496113_0348320 Ga0496113_0348320_29_652 207
8 3300049588 Ga0501072_0169526 Ga0501072_0169526_1050_1715 221
9 3300005328 Ga0070676_10038133 Ga0070676_100381331 224
10 3300005336 Ga0070680_100857832 Ga0070680_1008578321 226
11 3300005344 Ga0070661_100065403 Ga0070661_1000654033 226
12 3300005458 Ga0070681_10012832 Ga0070681_100128322 226
13 3300005530 Ga0070679_100008089 Ga0070679_10000808910 226
14 3300005547 Ga0070693_100318270 Ga0070693_1003182701 226
15 3300005564 Ga0070664_100181088 Ga0070664_1001810882 226
16 3300005614 Ga0068856_100003325 Ga0068856_1000033252 226
17 3300013307 Ga0157372_10063295 Ga0157372_100632953 226
18 3300025912 Ga0207707_10068931 Ga0207707_100689314 226
19 3300025920 Ga0207649_10437260 Ga0207649_104372602 226
20 3300025921 Ga0207652_10009141 Ga0207652_100091413 226
21 3300025945 Ga0207679_10832526 Ga0207679_108325261 226
22 3300026078 Ga0207702_10002576 Ga0207702_1000257617 226
23 3300037418 Ga0395900_0048985 Ga0395900_0048985_1745_2455 226
24 3300037466 Ga0395898_0024992 Ga0395898_0024992_1347_2057 226
25 3300005329 Ga0070683_100240109 Ga0070683_1002401092 227
26 3300005336 Ga0070680_100135663 Ga0070680_1001356633 227
27 3300005337 Ga0070682_100221197 Ga0070682_1002211972 227
28 3300005344 Ga0070661_100016337 Ga0070661_1000163374 227
29 3300005435 Ga0070714_100004596 Ga0070714_10000459611 227
30 3300005455 Ga0070663_100008998 Ga0070663_1000089982 227
31 3300005458 Ga0070681_10253132 Ga0070681_102531323 227
32 3300005530 Ga0070679_100206760 Ga0070679_1002067602 227
33 3300005535 Ga0070684_100274283 Ga0070684_1002742832 227
34 3300005539 Ga0068853_100085998 Ga0068853_1000859983 227
35 3300005564 Ga0070664_100274808 Ga0070664_1002748082 227
36 3300005577 Ga0068857_100153625 Ga0068857_1001536252 227
37 3300005578 Ga0068854_100002763 Ga0068854_1000027639 227
38 3300005614 Ga0068856_100003654 Ga0068856_10000365416 227
39 3300005616 Ga0068852_100017500 Ga0068852_1000175002 227
40 3300005834 Ga0068851_10000506 Ga0068851_1000050613 227
41 3300009093 Ga0105240_10021400 Ga0105240_100214009 227
42 3300009174 Ga0105241_10044414 Ga0105241_100444143 227
43 3300009545 Ga0105237_10030494 Ga0105237_100304947 227
44 3300013102 Ga0157371_10118647 Ga0157371_101186472 227
45 3300013104 Ga0157370_10218720 Ga0157370_102187203 227
46 3300013105 Ga0157369_10038630 Ga0157369_100386306 227
47 3300020070 Ga0206356_10593666 Ga0206356_105936662 227
48 3300020081 Ga0206354_11341275 Ga0206354_113412752 227
49 3300025321 Ga0207656_10017184 Ga0207656_100171842 227
50 3300025909 Ga0207705_10034967 Ga0207705_100349673 227
51 3300025911 Ga0207654_10025709 Ga0207654_100257093 227
52 3300025912 Ga0207707_10019919 Ga0207707_100199198 227
53 3300025913 Ga0207695_10045749 Ga0207695_100457493 227
54 3300025917 Ga0207660_10002028 Ga0207660_1000202814 227
55 3300025919 Ga0207657_10000093 Ga0207657_1000009341 227
56 3300025921 Ga0207652_10004714 Ga0207652_100047148 227
57 3300025924 Ga0207694_10011390 Ga0207694_100113902 227
58 3300025929 Ga0207664_10015073 Ga0207664_100150733 227
59 3300025944 Ga0207661_10082071 Ga0207661_100820713 227
60 3300025945 Ga0207679_10048385 Ga0207679_100483852 227
61 3300025949 Ga0207667_10000410 Ga0207667_1000041016 227
62 3300025981 Ga0207640_10041560 Ga0207640_100415601 227
63 3300026041 Ga0207639_10003283 Ga0207639_1000328310 227
64 3300026067 Ga0207678_10070138 Ga0207678_100701383 227
65 3300026078 Ga0207702_10013518 Ga0207702_100135185 227
66 3300026116 Ga0207674_10000749 Ga0207674_1000074932 227
67 3300026142 Ga0207698_10000366 Ga0207698_1000036616 227
68 3300037068 Ga0373925_0440541 Ga0373925_0440541_195_902 227
69 3300037471 Ga0395905_0261715 Ga0395905_0261715_864_1574 227
70 3300044694 Ga0466963_0068802 Ga0466963_0068802_1311_2042 227
71 3300005329 Ga0070683_100563981 Ga0070683_1005639812 228
72 3300005344 Ga0070661_100033352 Ga0070661_1000333523 228
73 3300005539 Ga0068853_100373923 Ga0068853_1003739232 228
74 3300013104 Ga0157370_10038691 Ga0157370_100386915 228
75 3300013307 Ga0157372_10198419 Ga0157372_101984193 228
76 3300025919 Ga0207657_10001139 Ga0207657_1000113918 228
77 3300025920 Ga0207649_10016245 Ga0207649_100162453 228
78 3300005293 Ga0065715_10186585 Ga0065715_101865852 232
79 3300005328 Ga0070676_10002968 Ga0070676_100029687 232
80 3300005328 Ga0070676_10010362 Ga0070676_100103625 232
81 3300005330 Ga0070690_100363437 Ga0070690_1003634371 232
82 3300005331 Ga0070670_100232967 Ga0070670_1002329672 232
83 3300005331 Ga0070670_100311616 Ga0070670_1003116162 232
84 3300005333 Ga0070677_10004021 Ga0070677_100040213 232
85 3300005334 Ga0068869_100000108 Ga0068869_1000001083 232
86 3300005335 Ga0070666_10026451 Ga0070666_100264514 232
87 3300005338 Ga0068868_100006441 Ga0068868_1000064415 232
88 3300005338 Ga0068868_100056259 Ga0068868_1000562593 232
89 3300005340 Ga0070689_100114572 Ga0070689_1001145722 232
90 3300005340 Ga0070689_100658069 Ga0070689_1006580692 232
91 3300005343 Ga0070687_100384223 Ga0070687_1003842231 232
92 3300005344 Ga0070661_100351859 Ga0070661_1003518591 232
93 3300005344 Ga0070661_100508687 Ga0070661_1005086872 232
94 3300005347 Ga0070668_100025885 Ga0070668_1000258853 232
95 3300005347 Ga0070668_100031665 Ga0070668_1000316653 232
96 3300005347 Ga0070668_100037182 Ga0070668_1000371823 232
97 3300005353 Ga0070669_100000482 Ga0070669_10000048223 232
98 3300005353 Ga0070669_100028863 Ga0070669_1000288634 232
99 3300005354 Ga0070675_100038658 Ga0070675_1000386581 232
100 3300005356 Ga0070674_100031998 Ga0070674_1000319982 232
101 3300005356 Ga0070674_100193973 Ga0070674_1001939731 232
102 3300005364 Ga0070673_100027742 Ga0070673_1000277425 232
103 3300005365 Ga0070688_100016771 Ga0070688_1000167713 232
104 3300005367 Ga0070667_100003815 Ga0070667_10000381513 232
105 3300005367 Ga0070667_100022212 Ga0070667_1000222124 232
106 3300005367 Ga0070667_100041022 Ga0070667_1000410223 232
107 3300005367 Ga0070667_100269379 Ga0070667_1002693792 232
108 3300005456 Ga0070678_100020355 Ga0070678_1000203552 232
109 3300005459 Ga0068867_100001466 Ga0068867_1000014666 232
110 3300005459 Ga0068867_100009464 Ga0068867_1000094645 232
111 3300005459 Ga0068867_100175113 Ga0068867_1001751133 232
112 3300005468 Ga0070707_100881527 Ga0070707_1008815271 232
113 3300005543 Ga0070672_100001874 Ga0070672_1000018746 232
114 3300005548 Ga0070665_100001984 Ga0070665_1000019847 232
115 3300005548 Ga0070665_100063857 Ga0070665_1000638573 232
116 3300005548 Ga0070665_100365677 Ga0070665_1003656772 232
117 3300005616 Ga0068852_100686830 Ga0068852_1006868302 232
118 3300005617 Ga0068859_100000217 Ga0068859_10000021754 232
119 3300005617 Ga0068859_100002842 Ga0068859_1000028426 232
120 3300005618 Ga0068864_100015296 Ga0068864_1000152966 232
121 3300005618 Ga0068864_100066851 Ga0068864_1000668513 232
122 3300005618 Ga0068864_100317733 Ga0068864_1003177331 232
123 3300005719 Ga0068861_100691751 Ga0068861_1006917511 232
124 3300005841 Ga0068863_100030801 Ga0068863_1000308014 232
125 3300005841 Ga0068863_100127597 Ga0068863_1001275972 232
126 3300005842 Ga0068858_100004830 Ga0068858_1000048306 232
127 3300005842 Ga0068858_100075295 Ga0068858_1000752953 232
128 3300005843 Ga0068860_100323708 Ga0068860_1003237081 232
129 3300005844 Ga0068862_100068977 Ga0068862_1000689774 232
130 3300005844 Ga0068862_100973969 Ga0068862_1009739691 232
131 3300006237 Ga0097621_100000380 Ga0097621_1000003803 232
132 3300006358 Ga0068871_100330931 Ga0068871_1003309312 232
133 3300006881 Ga0068865_100003738 Ga0068865_1000037385 232
134 3300006931 Ga0097620_100000217 Ga0097620_1000002172 232
135 3300006931 Ga0097620_100002842 Ga0097620_1000028426 232
136 3300009177 Ga0105248_10002614 Ga0105248_1000261417 232
137 3300013296 Ga0157374_10026894 Ga0157374_100268943 232
138 3300013306 Ga0163162_10001723 Ga0163162_1000172318 232
139 3300013308 Ga0157375_10009466 Ga0157375_100094663 232
140 3300013308 Ga0157375_10594153 Ga0157375_105941532 232
141 3300014325 Ga0163163_10027486 Ga0163163_100274865 232
142 3300014968 Ga0157379_10003822 Ga0157379_1000382210 232
143 3300014968 Ga0157379_10402239 Ga0157379_104022392 232
144 3300014969 Ga0157376_10033384 Ga0157376_100333842 232
145 3300017792 Ga0163161_10031650 Ga0163161_100316503 232
146 3300025903 Ga0207680_10000486 Ga0207680_1000048613 232
147 3300025903 Ga0207680_10267069 Ga0207680_102670692 232
148 3300025907 Ga0207645_10002330 Ga0207645_1000233013 232
149 3300025907 Ga0207645_10073475 Ga0207645_100734752 232
150 3300025908 Ga0207643_10144732 Ga0207643_101447322 232
151 3300025918 Ga0207662_10507058 Ga0207662_105070581 232
152 3300025923 Ga0207681_10003320 Ga0207681_100033207 232
153 3300025925 Ga0207650_10003684 Ga0207650_100036846 232
154 3300025925 Ga0207650_10006975 Ga0207650_100069752 232
155 3300025925 Ga0207650_10058669 Ga0207650_100586694 232
156 3300025926 Ga0207659_10002569 Ga0207659_1000256910 232
157 3300025936 Ga0207670_10131084 Ga0207670_101310842 232
158 3300025936 Ga0207670_10277682 Ga0207670_102776822 232
159 3300025937 Ga0207669_10116847 Ga0207669_101168472 232
160 3300025938 Ga0207704_10002721 Ga0207704_100027215 232
161 3300025940 Ga0207691_10009804 Ga0207691_100098043 232
162 3300025940 Ga0207691_10010195 Ga0207691_100101953 232
163 3300025941 Ga0207711_10026184 Ga0207711_100261845 232
164 3300025942 Ga0207689_10000030 Ga0207689_100000306 232
165 3300025960 Ga0207651_10009648 Ga0207651_100096483 232
166 3300025961 Ga0207712_10051920 Ga0207712_100519202 232
167 3300025972 Ga0207668_10009342 Ga0207668_100093425 232
168 3300025972 Ga0207668_10079566 Ga0207668_100795663 232
169 3300025972 Ga0207668_10212219 Ga0207668_102122192 232
170 3300025981 Ga0207640_10293905 Ga0207640_102939051 232
171 3300025986 Ga0207658_10002793 Ga0207658_100027937 232
172 3300025986 Ga0207658_10010570 Ga0207658_100105705 232
173 3300026023 Ga0207677_10010904 Ga0207677_100109046 232
174 3300026023 Ga0207677_10579480 Ga0207677_105794802 232
175 3300026035 Ga0207703_10102256 Ga0207703_101022563 232
176 3300026067 Ga0207678_10283352 Ga0207678_102833522 232
177 3300026088 Ga0207641_10003854 Ga0207641_100038545 232
178 3300026088 Ga0207641_10026143 Ga0207641_100261435 232
179 3300026089 Ga0207648_10003534 Ga0207648_100035348 232
180 3300026095 Ga0207676_10005417 Ga0207676_100054175 232
181 3300026095 Ga0207676_10048815 Ga0207676_100488153 232
182 3300026116 Ga0207674_10012924 Ga0207674_100129244 232
183 3300026118 Ga0207675_100000852 Ga0207675_10000085230 232
184 3300026121 Ga0207683_10000700 Ga0207683_100007009 232
185 3300026142 Ga0207698_10081713 Ga0207698_100817132 232
186 3300026142 Ga0207698_10579271 Ga0207698_105792712 232
187 3300028379 Ga0268266_10014129 Ga0268266_100141293 232
188 3300028379 Ga0268266_10014630 Ga0268266_100146304 232
189 3300028379 Ga0268266_10277589 Ga0268266_102775892 232
190 3300028380 Ga0268265_10565708 Ga0268265_105657082 232
191 3300028381 Ga0268264_10003459 Ga0268264_100034599 232
192 3300028381 Ga0268264_10008098 Ga0268264_100080984 232
193 3300031548 Ga0307408_100006423 Ga0307408_1000064233 232
194 3300031731 Ga0307405_10021290 Ga0307405_100212903 232
195 3300031824 Ga0307413_10663931 Ga0307413_106639311 232
196 3300031852 Ga0307410_10004248 Ga0307410_100042483 232
197 3300031901 Ga0307406_10053508 Ga0307406_100535083 232
198 3300031903 Ga0307407_10001704 Ga0307407_100017049 232
199 3300031911 Ga0307412_10007574 Ga0307412_100075745 232
200 3300031995 Ga0307409_100001026 Ga0307409_1000010264 232
201 3300031995 Ga0307409_100561904 Ga0307409_1005619042 232
202 3300032002 Ga0307416_100142446 Ga0307416_1001424462 232
203 3300032004 Ga0307414_10770928 Ga0307414_107709282 232
204 3300032005 Ga0307411_10000807 Ga0307411_100008075 232
205 3300032126 Ga0307415_100026473 Ga0307415_1000264734 232
206 3300048908 Ga0496105_0381768 Ga0496105_0381768_79_777 232
207 3300048909 Ga0496106_0441980 Ga0496106_0441980_129_827 232
208 3300048911 Ga0496108_0039168 Ga0496108_0039168_1894_2592 232
209 3300048912 Ga0496109_0120495 Ga0496109_0120495_286_984 232
210 3300049587 Ga0501071_0525767 Ga0501071_0525767_11_709 232
211 3300005347 Ga0070668_100090578 Ga0070668_1000905782 233
212 3300005365 Ga0070688_100199834 Ga0070688_1001998341 233
213 3300005530 Ga0070679_100012228 Ga0070679_1000122283 233
214 3300005530 Ga0070679_100097318 Ga0070679_1000973182 233
215 3300005539 Ga0068853_100033222 Ga0068853_1000332222 233
216 3300005841 Ga0068863_100137327 Ga0068863_1001373272 233
217 3300005844 Ga0068862_100324696 Ga0068862_1003246962 233
218 3300013100 Ga0157373_10077649 Ga0157373_100776492 233
219 3300013104 Ga0157370_10381747 Ga0157370_103817472 233
220 3300013307 Ga0157372_10259930 Ga0157372_102599303 233
221 3300013308 Ga0157375_10265728 Ga0157375_102657282 233
222 3300025912 Ga0207707_10013313 Ga0207707_100133132 233
223 3300025921 Ga0207652_10138820 Ga0207652_101388202 233
224 3300025921 Ga0207652_10187597 Ga0207652_101875972 233
225 3300025960 Ga0207651_10344074 Ga0207651_103440742 233
226 3300025972 Ga0207668_10453904 Ga0207668_104539042 233
227 3300026041 Ga0207639_10032420 Ga0207639_100324205 233
228 3300049571 Ga0501034_0028364 Ga0501034_0028364_2322_3023 233
229 3300049581 Ga0501047_0105302 Ga0501047_0105302_344_1045 233
230 3300049586 Ga0501070_0011144 Ga0501070_0011144_17_718 233
231 3300049586 Ga0501070_0616242 Ga0501070_0616242_14_715 233
232 3300049742 Ga0501080_0000772 Ga0501080_0000772_13805_14506 233
233 3300049744 Ga0501083_0240904 Ga0501083_0240904_248_949 233
234 3300049822 Ga0501035_0143882 Ga0501035_0143882_956_1657 233
235 3300054114 Ga0501084_0145961 Ga0501084_0145961_393_1094 233
236 3300005354 Ga0070675_100005354 Ga0070675_1000053543 234
237 3300005459 Ga0068867_100851509 Ga0068867_1008515091 234
238 3300005543 Ga0070672_100385641 Ga0070672_1003856411 234
239 3300025925 Ga0207650_10484410 Ga0207650_104844101 234
240 3300025926 Ga0207659_10037947 Ga0207659_100379472 234
241 3300025940 Ga0207691_10665614 Ga0207691_106656142 234
242 3300026089 Ga0207648_10226715 Ga0207648_102267152 234
243 3300028379 Ga0268266_10567288 Ga0268266_105672882 234
244 3300049577 Ga0501041_0132662 Ga0501041_0132662_62_766 234
245 3300049578 Ga0501042_0280679 Ga0501042_0280679_487_1191 234
246 3300049582 Ga0501048_0097229 Ga0501048_0097229_1025_1729 234
247 3300049743 Ga0501081_0442986 Ga0501081_0442986_94_798 234
248 3300060353 Ga0501082_0127999 Ga0501082_0127999_787_1491 234
249 3300006844 Ga0075428_100027029 Ga0075428_1000270297 235
250 3300013104 Ga0157370_10000893 Ga0157370_100008937 235
251 3300025928 Ga0207700_10000045 Ga0207700_1000004572 235
252 3300035119 Ga0373956_0082341 Ga0373956_0082341_38_745 235
253 3300035695 Ga0373927_0040790 Ga0373927_0040790_2050_2757 235
254 3300046472 Ga0495580_0023904 Ga0495580_0023904_323_1030 235
255 3300046472 Ga0495580_0275544 Ga0495580_0275544_208_915 235
256 3300046683 Ga0495658_0199792 Ga0495658_0199792_457_1164 235
257 3300005329 Ga0070683_100064230 Ga0070683_1000642303 236
258 3300005333 Ga0070677_10000399 Ga0070677_1000039915 236
259 3300005335 Ga0070666_10001754 Ga0070666_1000175410 236
260 3300005335 Ga0070666_10038220 Ga0070666_100382202 236
261 3300005336 Ga0070680_100095133 Ga0070680_1000951332 236
262 3300005338 Ga0068868_100011862 Ga0068868_1000118627 236
263 3300005338 Ga0068868_100090852 Ga0068868_1000908523 236
264 3300005339 Ga0070660_100012123 Ga0070660_1000121236 236
265 3300005339 Ga0070660_100468949 Ga0070660_1004689492 236
266 3300005340 Ga0070689_100141774 Ga0070689_1001417743 236
267 3300005344 Ga0070661_100005143 Ga0070661_1000051433 236
268 3300005347 Ga0070668_100090767 Ga0070668_1000907672 236
269 3300005354 Ga0070675_100120329 Ga0070675_1001203292 236
270 3300005355 Ga0070671_100004778 Ga0070671_1000047781 236
271 3300005355 Ga0070671_100005229 Ga0070671_1000052297 236
272 3300005355 Ga0070671_100051697 Ga0070671_1000516972 236
273 3300005356 Ga0070674_100004774 Ga0070674_1000047743 236
274 3300005356 Ga0070674_100434996 Ga0070674_1004349961 236
275 3300005364 Ga0070673_100001176 Ga0070673_1000011767 236
276 3300005366 Ga0070659_100075387 Ga0070659_1000753873 236
277 3300005366 Ga0070659_100092659 Ga0070659_1000926592 236
278 3300005367 Ga0070667_100001817 Ga0070667_1000018173 236
279 3300005367 Ga0070667_100059966 Ga0070667_1000599664 236
280 3300005367 Ga0070667_100100736 Ga0070667_1001007362 236
281 3300005367 Ga0070667_100426498 Ga0070667_1004264982 236
282 3300005434 Ga0070709_10189103 Ga0070709_101891032 236
283 3300005435 Ga0070714_100007506 Ga0070714_1000075069 236
284 3300005435 Ga0070714_100022875 Ga0070714_1000228756 236
285 3300005436 Ga0070713_100026589 Ga0070713_1000265892 236
286 3300005436 Ga0070713_100318343 Ga0070713_1003183431 236
287 3300005437 Ga0070710_10000687 Ga0070710_1000068710 236
288 3300005439 Ga0070711_100030508 Ga0070711_1000305085 236
289 3300005439 Ga0070711_100088699 Ga0070711_1000886992 236
290 3300005456 Ga0070678_100016839 Ga0070678_1000168394 236
291 3300005457 Ga0070662_100484910 Ga0070662_1004849102 236
292 3300005459 Ga0068867_100002533 Ga0068867_10000253313 236
293 3300005518 Ga0070699_100039227 Ga0070699_1000392275 236
294 3300005530 Ga0070679_100030058 Ga0070679_1000300583 236
295 3300005530 Ga0070679_100057307 Ga0070679_1000573073 236
296 3300005535 Ga0070684_100001542 Ga0070684_1000015429 236
297 3300005539 Ga0068853_100080703 Ga0068853_1000807033 236
298 3300005539 Ga0068853_100519419 Ga0068853_1005194191 236
299 3300005543 Ga0070672_100001353 Ga0070672_1000013535 236
300 3300005543 Ga0070672_100156020 Ga0070672_1001560202 236
301 3300005543 Ga0070672_100484680 Ga0070672_1004846802 236
302 3300005546 Ga0070696_100014222 Ga0070696_1000142225 236
303 3300005563 Ga0068855_100019744 Ga0068855_1000197443 236
304 3300005564 Ga0070664_100002461 Ga0070664_1000024616 236
305 3300005577 Ga0068857_100002627 Ga0068857_10000262710 236
306 3300005614 Ga0068856_100012536 Ga0068856_1000125363 236
307 3300005616 Ga0068852_100004888 Ga0068852_1000048884 236
308 3300005616 Ga0068852_100010061 Ga0068852_1000100613 236
309 3300005617 Ga0068859_100551534 Ga0068859_1005515342 236
310 3300005618 Ga0068864_100025290 Ga0068864_1000252903 236
311 3300005834 Ga0068851_10000682 Ga0068851_1000068214 236
312 3300005840 Ga0068870_10005548 Ga0068870_100055482 236
313 3300005842 Ga0068858_100016224 Ga0068858_1000162246 236
314 3300005842 Ga0068858_100134563 Ga0068858_1001345633 236
315 3300005842 Ga0068858_100151332 Ga0068858_1001513323 236
316 3300005842 Ga0068858_100154739 Ga0068858_1001547393 236
317 3300005842 Ga0068858_100372346 Ga0068858_1003723462 236
318 3300005843 Ga0068860_100011373 Ga0068860_1000113732 236
319 3300005843 Ga0068860_100024360 Ga0068860_1000243604 236
320 3300006931 Ga0097620_100551407 Ga0097620_1005514072 236
321 3300009093 Ga0105240_10013105 Ga0105240_100131052 236
322 3300009148 Ga0105243_10202859 Ga0105243_102028593 236
323 3300009174 Ga0105241_10089214 Ga0105241_100892143 236
324 3300009177 Ga0105248_10002088 Ga0105248_100020882 236
325 3300009177 Ga0105248_10245953 Ga0105248_102459532 236
326 3300009545 Ga0105237_10193568 Ga0105237_101935683 236
327 3300009545 Ga0105237_10433164 Ga0105237_104331642 236
328 3300009551 Ga0105238_10010467 Ga0105238_1001046712 236
329 3300013100 Ga0157373_10035784 Ga0157373_100357843 236
330 3300013102 Ga0157371_10020786 Ga0157371_100207864 236
331 3300013104 Ga0157370_10011952 Ga0157370_1001195211 236
332 3300013105 Ga0157369_10005334 Ga0157369_1000533410 236
333 3300013105 Ga0157369_10006475 Ga0157369_1000647510 236
334 3300013296 Ga0157374_10052217 Ga0157374_100522172 236
335 3300013297 Ga0157378_10471659 Ga0157378_104716592 236
336 3300013306 Ga0163162_10268141 Ga0163162_102681412 236
337 3300013307 Ga0157372_10012901 Ga0157372_1001290110 236
338 3300013307 Ga0157372_10094978 Ga0157372_100949783 236
339 3300013307 Ga0157372_10142657 Ga0157372_101426572 236
340 3300013307 Ga0157372_10259244 Ga0157372_102592443 236
341 3300013307 Ga0157372_10979218 Ga0157372_109792181 236
342 3300013308 Ga0157375_10003757 Ga0157375_1000375713 236
343 3300014325 Ga0163163_10066448 Ga0163163_100664483 236
344 3300014497 Ga0182008_10123840 Ga0182008_101238402 236
345 3300014968 Ga0157379_10015344 Ga0157379_100153443 236
346 3300014969 Ga0157376_10292704 Ga0157376_102927042 236
347 3300017792 Ga0163161_10021774 Ga0163161_100217743 236
348 3300025893 Ga0207682_10000075 Ga0207682_1000007510 236
349 3300025898 Ga0207692_10051069 Ga0207692_100510692 236
350 3300025901 Ga0207688_10148368 Ga0207688_101483682 236
351 3300025903 Ga0207680_10001434 Ga0207680_1000143410 236
352 3300025906 Ga0207699_10003665 Ga0207699_100036652 236
353 3300025907 Ga0207645_10000152 Ga0207645_1000015245 236
354 3300025907 Ga0207645_10046452 Ga0207645_100464521 236
355 3300025913 Ga0207695_10026649 Ga0207695_100266496 236
356 3300025914 Ga0207671_10200979 Ga0207671_102009792 236
357 3300025916 Ga0207663_10113573 Ga0207663_101135732 236
358 3300025916 Ga0207663_10348085 Ga0207663_103480852 236
359 3300025919 Ga0207657_10022789 Ga0207657_100227894 236
360 3300025919 Ga0207657_10167995 Ga0207657_101679952 236
361 3300025920 Ga0207649_10004462 Ga0207649_100044627 236
362 3300025921 Ga0207652_10064338 Ga0207652_100643383 236
363 3300025923 Ga0207681_10169607 Ga0207681_101696072 236
364 3300025924 Ga0207694_10002004 Ga0207694_1000200417 236
365 3300025925 Ga0207650_10054956 Ga0207650_100549562 236
366 3300025928 Ga0207700_10192761 Ga0207700_101927613 236
367 3300025928 Ga0207700_10401948 Ga0207700_104019482 236
368 3300025929 Ga0207664_10001519 Ga0207664_1000151910 236
369 3300025929 Ga0207664_10021433 Ga0207664_100214334 236
370 3300025929 Ga0207664_10556819 Ga0207664_105568192 236
371 3300025931 Ga0207644_10000862 Ga0207644_1000086220 236
372 3300025931 Ga0207644_10018400 Ga0207644_100184004 236
373 3300025932 Ga0207690_10256461 Ga0207690_102564612 236
374 3300025933 Ga0207706_10105624 Ga0207706_101056242 236
375 3300025937 Ga0207669_10001543 Ga0207669_1000154310 236
376 3300025937 Ga0207669_10085108 Ga0207669_100851082 236
377 3300025940 Ga0207691_10000006 Ga0207691_10000006117 236
378 3300025940 Ga0207691_10095166 Ga0207691_100951663 236
379 3300025941 Ga0207711_10069173 Ga0207711_100691732 236
380 3300025941 Ga0207711_10187691 Ga0207711_101876911 236
381 3300025941 Ga0207711_10261159 Ga0207711_102611592 236
382 3300025944 Ga0207661_10433289 Ga0207661_104332891 236
383 3300025945 Ga0207679_10008964 Ga0207679_100089646 236
384 3300025949 Ga0207667_10003249 Ga0207667_100032499 236
385 3300025949 Ga0207667_10119726 Ga0207667_101197262 236
386 3300025960 Ga0207651_10003988 Ga0207651_100039885 236
387 3300025981 Ga0207640_10034409 Ga0207640_100344092 236
388 3300025986 Ga0207658_10003664 Ga0207658_100036648 236
389 3300025986 Ga0207658_10033513 Ga0207658_100335135 236
390 3300025986 Ga0207658_10076087 Ga0207658_100760873 236
391 3300025986 Ga0207658_10149631 Ga0207658_101496313 236
392 3300026023 Ga0207677_10068808 Ga0207677_100688082 236
393 3300026023 Ga0207677_10271219 Ga0207677_102712191 236
394 3300026035 Ga0207703_10018924 Ga0207703_100189243 236
395 3300026035 Ga0207703_10039927 Ga0207703_100399273 236
396 3300026035 Ga0207703_10429091 Ga0207703_104290912 236
397 3300026041 Ga0207639_10060361 Ga0207639_100603612 236
398 3300026067 Ga0207678_10008744 Ga0207678_100087446 236
399 3300026078 Ga0207702_10002033 Ga0207702_1000203311 236
400 3300026088 Ga0207641_10177746 Ga0207641_101777462 236
401 3300026089 Ga0207648_10006993 Ga0207648_100069937 236
402 3300026095 Ga0207676_10015541 Ga0207676_100155415 236
403 3300026116 Ga0207674_10000205 Ga0207674_1000020515 236
404 3300026121 Ga0207683_10000056 Ga0207683_1000005623 236
405 3300026142 Ga0207698_10023043 Ga0207698_100230433 236
406 3300027360 Ga0209969_1009951 Ga0209969_10099512 236
407 3300027378 Ga0209981_1009038 Ga0209981_10090382 236
408 3300027614 Ga0209970_1014088 Ga0209970_10140882 236
409 3300027665 Ga0209983_1016009 Ga0209983_10160092 236
410 3300027682 Ga0209971_1001234 Ga0209971_10012346 236
411 3300028380 Ga0268265_10433055 Ga0268265_104330552 236
412 3300028380 Ga0268265_10440983 Ga0268265_104409832 236
413 3300028381 Ga0268264_10170995 Ga0268264_101709952 236
414 3300035410 Ga0373924_0004339 Ga0373924_0004339_3241_3951 236
415 3300045051 Ga0451576_0497140 Ga0451576_0497140_255_965 236
416 3300046683 Ga0495658_0196516 Ga0495658_0196516_455_1165 236
417 3300047317 Ga0495604_0427283 Ga0495604_0427283_120_836 236
418 3300048913 Ga0496110_0423288 Ga0496110_0423288_29_739 236
419 3300048913 Ga0496110_0741641 Ga0496110_0741641_124_834 236
420 3300048915 Ga0496112_0001802 Ga0496112_0001802_12758_13468 236
421 3300001976 JGI24752J21851_1007012 JGI24752J21851_10070122 237
422 3300001977 JGI24746J21847_1020783 JGI24746J21847_10207832 237
423 3300002076 JGI24749J21850_1002611 JGI24749J21850_10026113 237
424 3300002126 JGI24035J26624_1009658 JGI24035J26624_10096582 237
425 3300005328 Ga0070676_10124284 Ga0070676_101242842 237
426 3300005330 Ga0070690_100170974 Ga0070690_1001709742 237
427 3300005331 Ga0070670_100065001 Ga0070670_1000650014 237
428 3300005331 Ga0070670_100120456 Ga0070670_1001204563 237
429 3300005333 Ga0070677_10002466 Ga0070677_100024663 237
430 3300005334 Ga0068869_100020312 Ga0068869_1000203123 237
431 3300005338 Ga0068868_100181487 Ga0068868_1001814872 237
432 3300005339 Ga0070660_100066098 Ga0070660_1000660982 237
433 3300005339 Ga0070660_100464495 Ga0070660_1004644952 237
434 3300005340 Ga0070689_100014335 Ga0070689_1000143351 237
435 3300005344 Ga0070661_100007131 Ga0070661_1000071312 237
436 3300005344 Ga0070661_100057780 Ga0070661_1000577803 237
437 3300005355 Ga0070671_100749280 Ga0070671_1007492801 237
438 3300005365 Ga0070688_100020439 Ga0070688_1000204393 237
439 3300005366 Ga0070659_100022667 Ga0070659_1000226676 237
440 3300005366 Ga0070659_100120210 Ga0070659_1001202102 237
441 3300005455 Ga0070663_100607683 Ga0070663_1006076832 237
442 3300005456 Ga0070678_100171756 Ga0070678_1001717561 237
443 3300005457 Ga0070662_100095159 Ga0070662_1000951592 237
444 3300005535 Ga0070684_100033871 Ga0070684_1000338713 237
445 3300005535 Ga0070684_100385040 Ga0070684_1003850402 237
446 3300005563 Ga0068855_100187278 Ga0068855_1001872783 237
447 3300005564 Ga0070664_100045817 Ga0070664_1000458173 237
448 3300005564 Ga0070664_100057489 Ga0070664_1000574894 237
449 3300005564 Ga0070664_100095464 Ga0070664_1000954642 237
450 3300005577 Ga0068857_100114401 Ga0068857_1001144012 237
451 3300005615 Ga0070702_100021708 Ga0070702_1000217083 237
452 3300005617 Ga0068859_100087220 Ga0068859_1000872203 237
453 3300005718 Ga0068866_10033930 Ga0068866_100339302 237
454 3300005719 Ga0068861_100040936 Ga0068861_1000409363 237
455 3300005834 Ga0068851_10009081 Ga0068851_100090815 237
456 3300005834 Ga0068851_10038811 Ga0068851_100388113 237
457 3300005841 Ga0068863_100616755 Ga0068863_1006167551 237
458 3300005844 Ga0068862_100031836 Ga0068862_1000318365 237
459 3300006237 Ga0097621_100734776 Ga0097621_1007347761 237
460 3300006881 Ga0068865_100253326 Ga0068865_1002533262 237
461 3300006931 Ga0097620_100087224 Ga0097620_1000872243 237
462 3300009094 Ga0111539_10055286 Ga0111539_100552865 237
463 3300009176 Ga0105242_10244688 Ga0105242_102446882 237
464 3300009177 Ga0105248_10560600 Ga0105248_105606001 237
465 3300009177 Ga0105248_10736469 Ga0105248_107364692 237
466 3300009553 Ga0105249_10238954 Ga0105249_102389542 237
467 3300010375 Ga0105239_10099207 Ga0105239_100992073 237
468 3300013102 Ga0157371_10338601 Ga0157371_103386012 237
469 3300013105 Ga0157369_10095984 Ga0157369_100959843 237
470 3300013105 Ga0157369_10140396 Ga0157369_101403963 237
471 3300013296 Ga0157374_10048901 Ga0157374_100489015 237
472 3300013296 Ga0157374_10642424 Ga0157374_106424242 237
473 3300013307 Ga0157372_10734768 Ga0157372_107347682 237
474 3300013308 Ga0157375_10032850 Ga0157375_100328503 237
475 3300014326 Ga0157380_10047964 Ga0157380_100479642 237
476 3300014745 Ga0157377_10004959 Ga0157377_100049593 237
477 3300025290 Ga0207673_1003898 Ga0207673_10038982 237
478 3300025315 Ga0207697_10000319 Ga0207697_100003196 237
479 3300025321 Ga0207656_10004660 Ga0207656_100046605 237
480 3300025321 Ga0207656_10037161 Ga0207656_100371612 237
481 3300025893 Ga0207682_10002499 Ga0207682_100024993 237
482 3300025901 Ga0207688_10070330 Ga0207688_100703302 237
483 3300025907 Ga0207645_10012159 Ga0207645_100121596 237
484 3300025908 Ga0207643_10000851 Ga0207643_1000085110 237
485 3300025915 Ga0207693_10133207 Ga0207693_101332072 237
486 3300025918 Ga0207662_10111056 Ga0207662_101110562 237
487 3300025919 Ga0207657_10006415 Ga0207657_1000641513 237
488 3300025919 Ga0207657_10150293 Ga0207657_101502933 237
489 3300025920 Ga0207649_10006859 Ga0207649_100068596 237
490 3300025923 Ga0207681_10150652 Ga0207681_101506522 237
491 3300025925 Ga0207650_10010136 Ga0207650_100101366 237
492 3300025925 Ga0207650_10092059 Ga0207650_100920592 237
493 3300025925 Ga0207650_10300226 Ga0207650_103002262 237
494 3300025926 Ga0207659_10003749 Ga0207659_1000374910 237
495 3300025931 Ga0207644_10200671 Ga0207644_102006712 237
496 3300025931 Ga0207644_10207115 Ga0207644_102071151 237
497 3300025932 Ga0207690_10092775 Ga0207690_100927752 237
498 3300025932 Ga0207690_10167015 Ga0207690_101670153 237
499 3300025933 Ga0207706_10007913 Ga0207706_100079135 237
500 3300025938 Ga0207704_10127659 Ga0207704_101276592 237
501 3300025940 Ga0207691_10040936 Ga0207691_100409365 237
502 3300025942 Ga0207689_10002080 Ga0207689_100020809 237
503 3300025945 Ga0207679_10022620 Ga0207679_100226203 237
504 3300025945 Ga0207679_10092208 Ga0207679_100922081 237
505 3300025949 Ga0207667_10088541 Ga0207667_100885413 237
506 3300025981 Ga0207640_10103740 Ga0207640_101037402 237
507 3300025981 Ga0207640_10525445 Ga0207640_105254452 237
508 3300026041 Ga0207639_10282537 Ga0207639_102825372 237
509 3300026067 Ga0207678_10004977 Ga0207678_100049774 237
510 3300026075 Ga0207708_10026820 Ga0207708_100268203 237
511 3300026088 Ga0207641_10048697 Ga0207641_100486973 237
512 3300026089 Ga0207648_10027992 Ga0207648_100279924 237
513 3300026116 Ga0207674_10028634 Ga0207674_100286344 237
514 3300026118 Ga0207675_100003107 Ga0207675_1000031073 237
515 3300026121 Ga0207683_10044769 Ga0207683_100447693 237
516 3300026121 Ga0207683_10313336 Ga0207683_103133362 237
517 3300035118 Ga0373954_0124080 Ga0373954_0124080_328_1062 237
518 3300035171 Ga0373946_0123107 Ga0373946_0123107_85_798 237
519 3300035172 Ga0373955_0244910 Ga0373955_0244910_172_906 237
520 3300036401 Ga0373937_0033401 Ga0373937_0033401_325_1053 237
521 3300036401 Ga0373937_0878888 Ga0373937_0878888_67_801 237
522 3300037068 Ga0373925_0271217 Ga0373925_0271217_240_953 237
523 3300041501 Ga0451845_0985314 Ga0451845_0985314_315_1028 237
524 3300046537 Ga0495598_0034946 Ga0495598_0034946_115_828 237
525 3300048907 Ga0496104_0014540 Ga0496104_0014540_4590_5303 237
526 3300048909 Ga0496106_0061640 Ga0496106_0061640_44_757 237
527 3300048910 Ga0496107_0040743 Ga0496107_0040743_1916_2629 237
528 3300048911 Ga0496108_0034386 Ga0496108_0034386_743_1456 237
529 3300048912 Ga0496109_0322347 Ga0496109_0322347_258_971 237
530 3300048913 Ga0496110_0063038 Ga0496110_0063038_198_911 237
531 3300048917 Ga0496114_0138207 Ga0496114_0138207_752_1465 237
532 3300050511 nmdc:mga08y16_38103_c1 nmdc:mga08y16_38103_c1_623_1336 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

25

223

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4maq-assembly1.cif.gz_B crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9322 1 234
4maq-assembly1.cif.gz_A crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9198 2 234
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9144 25 234
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9109 25 234
6foh-assembly1.cif.gz_A x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) at 1.56a resolution. 0.9102 25 234
ID Description Score Start End Superfamily
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9198 2 234 3.90.850.10
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.908 2 234 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8902 25 234 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8866 25 234 3.90.850.10
af_Q10B63_1_221_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8815 25 234 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A435SEY7-F1-model_v4 deleted 0.9443 73 233
AF-A0A226WXR6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9422 88 233 GO:0018773
GO:0046872
AF-A0A812IQ58-F1-model_v4 deleted 0.9416 42 233
AF-A0A534JQW6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9399 51 234 GO:0018773
GO:0046872
AF-A0A7V7X9R7-F1-model_v4 deleted 0.9381 80 233

Feature Viewer

pLDDT pTM Quality
87.64 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map