F460300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 532 | 222 | 532 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0440541|Ga0373925_0440541_195_902 |
| Length | 227 |
| Sequence | MTALPTFEIPTVPIHGGAERFPVRHVYCVGRNYAEHAKEMGGDASKEPPFFFTKAADSVVPVVPPAVGSIAYPLATKNFHHEIELVVAIGGRGARLPPERALSVVFGYAVGLDMTRRDLQSDMREKKRPWDIGKSFAGAAPIVGHLARGAIWVDVNGTRRQTGDLADMIWDVPHTLAFLSQYYELLPGDLVFTGTPSGVGPVVAGDRLDGGIDALGSLAVTVGPPIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 198 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 199 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 200 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.82 |
| Rhizosphere | 96.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1007012 | 3300001976 | Bacteria | 1472 |
| 2 | JGI24746J21847_1020783 | 3300001977 | Bacteria | 920 |
| 3 | JGI24749J21850_1002611 | 3300002076 | Bacteria | 2527 |
| 4 | JGI24035J26624_1009658 | 3300002126 | Bacteria | 952 |
| 5 | Ga0065715_10186585 | 3300005293 | Bacteria | 1441 |
| 6 | Ga0070676_10002968 | 3300005328 | Bacteria | 8766 |
| 7 | Ga0070676_10010362 | 3300005328 | Bacteria | 5056 |
| 8 | Ga0070676_10038133 | 3300005328 | Bacteria | 2775 |
| 9 | Ga0070676_10124284 | 3300005328 | Bacteria | 1623 |
| 10 | Ga0070683_100064230 | 3300005329 | Bacteria | 3417 |
| 11 | Ga0070683_100240109 | 3300005329 | Bacteria | 1723 |
| 12 | Ga0070683_100563981 | 3300005329 | Bacteria | 1089 |
| 13 | Ga0070690_100170974 | 3300005330 | Bacteria | 1495 |
| 14 | Ga0070690_100363437 | 3300005330 | Bacteria | 1054 |
| 15 | Ga0070670_100065001 | 3300005331 | Bacteria | 3130 |
| 16 | Ga0070670_100120456 | 3300005331 | Bacteria | 2263 |
| 17 | Ga0070670_100232967 | 3300005331 | Bacteria | 1603 |
| 18 | Ga0070670_100311616 | 3300005331 | Bacteria | 1378 |
| 19 | Ga0070677_10000399 | 3300005333 | Bacteria | 15153 |
| 20 | Ga0070677_10002466 | 3300005333 | Bacteria | 5923 |
| 21 | Ga0070677_10004021 | 3300005333 | Bacteria | 4775 |
| 22 | Ga0068869_100000108 | 3300005334 | Bacteria | 39249 |
| 23 | Ga0068869_100020312 | 3300005334 | Bacteria | 4553 |
| 24 | Ga0070666_10001754 | 3300005335 | Bacteria | 13241 |
| 25 | Ga0070666_10026451 | 3300005335 | Bacteria | 3791 |
| 26 | Ga0070666_10038220 | 3300005335 | Bacteria | 3193 |
| 27 | Ga0070680_100095133 | 3300005336 | Bacteria | 2469 |
| 28 | Ga0070680_100135663 | 3300005336 | Bacteria | 2061 |
| 29 | Ga0070680_100857832 | 3300005336 | Bacteria | 783 |
| 30 | Ga0070682_100221197 | 3300005337 | Bacteria | 1348 |
| 31 | Ga0068868_100006441 | 3300005338 | Bacteria | 8309 |
| 32 | Ga0068868_100011862 | 3300005338 | Bacteria | 6355 |
| 33 | Ga0068868_100056259 | 3300005338 | Bacteria | 3106 |
| 34 | Ga0068868_100090852 | 3300005338 | Bacteria | 2460 |
| 35 | Ga0068868_100181487 | 3300005338 | Bacteria | 1746 |
| 36 | Ga0070660_100012123 | 3300005339 | Bacteria | 6154 |
| 37 | Ga0070660_100066098 | 3300005339 | Bacteria | 2814 |
| 38 | Ga0070660_100464495 | 3300005339 | Bacteria | 1051 |
| 39 | Ga0070660_100468949 | 3300005339 | Bacteria | 1046 |
| 40 | Ga0070689_100014335 | 3300005340 | Bacteria | 5756 |
| 41 | Ga0070689_100114572 | 3300005340 | Bacteria | 2148 |
| 42 | Ga0070689_100141774 | 3300005340 | Bacteria | 1933 |
| 43 | Ga0070689_100658069 | 3300005340 | Bacteria | 912 |
| 44 | Ga0070687_100384223 | 3300005343 | Bacteria | 916 |
| 45 | Ga0070661_100005143 | 3300005344 | Bacteria | 9010 |
| 46 | Ga0070661_100007131 | 3300005344 | Bacteria | 7706 |
| 47 | Ga0070661_100016337 | 3300005344 | Bacteria | 5246 |
| 48 | Ga0070661_100033352 | 3300005344 | Bacteria | 3729 |
| 49 | Ga0070661_100057780 | 3300005344 | Bacteria | 2842 |
| 50 | Ga0070661_100065403 | 3300005344 | Bacteria | 2672 |
| 51 | Ga0070661_100351859 | 3300005344 | Bacteria | 1156 |
| 52 | Ga0070661_100508687 | 3300005344 | Bacteria | 965 |
| 53 | Ga0070668_100025885 | 3300005347 | Bacteria | 4449 |
| 54 | Ga0070668_100031665 | 3300005347 | Bacteria | 4024 |
| 55 | Ga0070668_100037182 | 3300005347 | Bacteria | 3717 |
| 56 | Ga0070668_100090578 | 3300005347 | Bacteria | 2409 |
| 57 | Ga0070668_100090767 | 3300005347 | Bacteria | 2407 |
| 58 | Ga0070669_100000482 | 3300005353 | Bacteria | 30329 |
| 59 | Ga0070669_100028863 | 3300005353 | Bacteria | 3996 |
| 60 | Ga0070675_100005354 | 3300005354 | Bacteria | 9811 |
| 61 | Ga0070675_100038658 | 3300005354 | Bacteria | 3890 |
| 62 | Ga0070675_100120329 | 3300005354 | Bacteria | 2230 |
| 63 | Ga0070671_100004778 | 3300005355 | Bacteria | 10770 |
| 64 | Ga0070671_100005229 | 3300005355 | Bacteria | 10344 |
| 65 | Ga0070671_100051697 | 3300005355 | Bacteria | 3418 |
| 66 | Ga0070671_100749280 | 3300005355 | Bacteria | 849 |
| 67 | Ga0070674_100004774 | 3300005356 | Bacteria | 7764 |
| 68 | Ga0070674_100031998 | 3300005356 | Bacteria | 3491 |
| 69 | Ga0070674_100193973 | 3300005356 | Bacteria | 1564 |
| 70 | Ga0070674_100434996 | 3300005356 | Bacteria | 1079 |
| 71 | Ga0070673_100001176 | 3300005364 | Bacteria | 15032 |
| 72 | Ga0070673_100027742 | 3300005364 | Bacteria | 4200 |
| 73 | Ga0070688_100016771 | 3300005365 | Bacteria | 4193 |
| 74 | Ga0070688_100020439 | 3300005365 | Bacteria | 3851 |
| 75 | Ga0070688_100199834 | 3300005365 | Bacteria | 1398 |
| 76 | Ga0070659_100022667 | 3300005366 | Bacteria | 4795 |
| 77 | Ga0070659_100075387 | 3300005366 | Bacteria | 2689 |
| 78 | Ga0070659_100092659 | 3300005366 | Bacteria | 2423 |
| 79 | Ga0070659_100120210 | 3300005366 | Bacteria | 2127 |
| 80 | Ga0070667_100001817 | 3300005367 | Bacteria | 19009 |
| 81 | Ga0070667_100003815 | 3300005367 | Bacteria | 12806 |
| 82 | Ga0070667_100022212 | 3300005367 | Bacteria | 5264 |
| 83 | Ga0070667_100041022 | 3300005367 | Bacteria | 3883 |
| 84 | Ga0070667_100059966 | 3300005367 | Bacteria | 3220 |
| 85 | Ga0070667_100100736 | 3300005367 | Bacteria | 2495 |
| 86 | Ga0070667_100269379 | 3300005367 | Bacteria | 1527 |
| 87 | Ga0070667_100426498 | 3300005367 | Bacteria | 1210 |
| 88 | Ga0070709_10189103 | 3300005434 | Bacteria | 1451 |
| 89 | Ga0070714_100004596 | 3300005435 | Bacteria | 10409 |
| 90 | Ga0070714_100007506 | 3300005435 | Bacteria | 8487 |
| 91 | Ga0070714_100022875 | 3300005435 | Bacteria | 5128 |
| 92 | Ga0070713_100026589 | 3300005436 | Bacteria | 4546 |
| 93 | Ga0070713_100318343 | 3300005436 | Bacteria | 1436 |
| 94 | Ga0070710_10000687 | 3300005437 | Bacteria | 16064 |
| 95 | Ga0070711_100030508 | 3300005439 | Bacteria | 3569 |
| 96 | Ga0070711_100088699 | 3300005439 | Bacteria | 2223 |
| 97 | Ga0070663_100008998 | 3300005455 | Bacteria | 6165 |
| 98 | Ga0070663_100607683 | 3300005455 | Bacteria | 920 |
| 99 | Ga0070678_100016839 | 3300005456 | Bacteria | 4687 |
| 100 | Ga0070678_100020355 | 3300005456 | Bacteria | 4352 |
| 101 | Ga0070678_100171756 | 3300005456 | Bacteria | 1766 |
| 102 | Ga0070662_100095159 | 3300005457 | Bacteria | 2244 |
| 103 | Ga0070662_100484910 | 3300005457 | Bacteria | 1030 |
| 104 | Ga0070681_10012832 | 3300005458 | Bacteria | 8318 |
| 105 | Ga0070681_10253132 | 3300005458 | Bacteria | 1673 |
| 106 | Ga0068867_100001466 | 3300005459 | Bacteria | 16338 |
| 107 | Ga0068867_100002533 | 3300005459 | Bacteria | 12859 |
| 108 | Ga0068867_100009464 | 3300005459 | Bacteria | 6871 |
| 109 | Ga0068867_100175113 | 3300005459 | Bacteria | 1702 |
| 110 | Ga0068867_100851509 | 3300005459 | Bacteria | 817 |
| 111 | Ga0070707_100881527 | 3300005468 | Bacteria | 859 |
| 112 | Ga0070699_100039227 | 3300005518 | Bacteria | 4101 |
| 113 | Ga0070679_100008089 | 3300005530 | Bacteria | 9883 |
| 114 | Ga0070679_100012228 | 3300005530 | Bacteria | 8198 |
| 115 | Ga0070679_100030058 | 3300005530 | Bacteria | 5362 |
| 116 | Ga0070679_100057307 | 3300005530 | Bacteria | 3883 |
| 117 | Ga0070679_100097318 | 3300005530 | Bacteria | 2930 |
| 118 | Ga0070679_100206760 | 3300005530 | Bacteria | 1927 |
| 119 | Ga0070684_100001542 | 3300005535 | Bacteria | 16627 |
| 120 | Ga0070684_100033871 | 3300005535 | Bacteria | 4364 |
| 121 | Ga0070684_100274283 | 3300005535 | Bacteria | 1544 |
| 122 | Ga0070684_100385040 | 3300005535 | Bacteria | 1292 |
| 123 | Ga0068853_100033222 | 3300005539 | Bacteria | 4375 |
| 124 | Ga0068853_100080703 | 3300005539 | Bacteria | 2847 |
| 125 | Ga0068853_100085998 | 3300005539 | Bacteria | 2757 |
| 126 | Ga0068853_100373923 | 3300005539 | Bacteria | 1330 |
| 127 | Ga0068853_100519419 | 3300005539 | Bacteria | 1126 |
| 128 | Ga0070672_100001353 | 3300005543 | Bacteria | 15124 |
| 129 | Ga0070672_100001874 | 3300005543 | Bacteria | 13152 |
| 130 | Ga0070672_100156020 | 3300005543 | Bacteria | 1891 |
| 131 | Ga0070672_100385641 | 3300005543 | Bacteria | 1199 |
| 132 | Ga0070672_100484680 | 3300005543 | Bacteria | 1068 |
| 133 | Ga0070696_100014222 | 3300005546 | Bacteria | 5340 |
| 134 | Ga0070693_100318270 | 3300005547 | Bacteria | 1055 |
| 135 | Ga0070665_100001984 | 3300005548 | Bacteria | 23024 |
| 136 | Ga0070665_100063857 | 3300005548 | Bacteria | 3692 |
| 137 | Ga0070665_100365677 | 3300005548 | Bacteria | 1449 |
| 138 | Ga0068855_100019744 | 3300005563 | Bacteria | 8092 |
| 139 | Ga0068855_100187278 | 3300005563 | Bacteria | 2337 |
| 140 | Ga0070664_100002461 | 3300005564 | Bacteria | 14911 |
| 141 | Ga0070664_100045817 | 3300005564 | Bacteria | 3693 |
| 142 | Ga0070664_100057489 | 3300005564 | Bacteria | 3306 |
| 143 | Ga0070664_100095464 | 3300005564 | Bacteria | 2579 |
| 144 | Ga0070664_100181088 | 3300005564 | Bacteria | 1873 |
| 145 | Ga0070664_100274808 | 3300005564 | Bacteria | 1518 |
| 146 | Ga0068857_100002627 | 3300005577 | Bacteria | 14748 |
| 147 | Ga0068857_100114401 | 3300005577 | Bacteria | 2426 |
| 148 | Ga0068857_100153625 | 3300005577 | Bacteria | 2086 |
| 149 | Ga0068854_100002763 | 3300005578 | Bacteria | 10903 |
| 150 | Ga0068856_100003325 | 3300005614 | Bacteria | 16338 |
| 151 | Ga0068856_100003654 | 3300005614 | Bacteria | 15456 |
| 152 | Ga0068856_100012536 | 3300005614 | Bacteria | 8206 |
| 153 | Ga0070702_100021708 | 3300005615 | Bacteria | 3383 |
| 154 | Ga0068852_100004888 | 3300005616 | Bacteria | 9517 |
| 155 | Ga0068852_100010061 | 3300005616 | Bacteria | 7039 |
| 156 | Ga0068852_100017500 | 3300005616 | Bacteria | 5625 |
| 157 | Ga0068852_100686830 | 3300005616 | Bacteria | 1033 |
| 158 | Ga0068859_100000217 | 3300005617 | Bacteria | 56968 |
| 159 | Ga0068859_100002842 | 3300005617 | Bacteria | 17566 |
| 160 | Ga0068859_100087220 | 3300005617 | Bacteria | 3168 |
| 161 | Ga0068859_100551534 | 3300005617 | Bacteria | 1247 |
| 162 | Ga0068864_100015296 | 3300005618 | Bacteria | 6381 |
| 163 | Ga0068864_100025290 | 3300005618 | Bacteria | 4999 |
| 164 | Ga0068864_100066851 | 3300005618 | Bacteria | 3121 |
| 165 | Ga0068864_100317733 | 3300005618 | Bacteria | 1462 |
| 166 | Ga0068866_10033930 | 3300005718 | Bacteria | 2481 |
| 167 | Ga0068861_100040936 | 3300005719 | Bacteria | 3468 |
| 168 | Ga0068861_100691751 | 3300005719 | Bacteria | 946 |
| 169 | Ga0068851_10000506 | 3300005834 | Bacteria | 17035 |
| 170 | Ga0068851_10000682 | 3300005834 | Bacteria | 14458 |
| 171 | Ga0068851_10009081 | 3300005834 | Bacteria | 4614 |
| 172 | Ga0068851_10038811 | 3300005834 | Bacteria | 2390 |
| 173 | Ga0068870_10005548 | 3300005840 | Bacteria | 5510 |
| 174 | Ga0068863_100030801 | 3300005841 | Bacteria | 5123 |
| 175 | Ga0068863_100127597 | 3300005841 | Bacteria | 2427 |
| 176 | Ga0068863_100137327 | 3300005841 | Bacteria | 2336 |
| 177 | Ga0068863_100616755 | 3300005841 | Bacteria | 1074 |
| 178 | Ga0068858_100004830 | 3300005842 | Bacteria | 13204 |
| 179 | Ga0068858_100016224 | 3300005842 | Bacteria | 6998 |
| 180 | Ga0068858_100075295 | 3300005842 | Bacteria | 3135 |
| 181 | Ga0068858_100134563 | 3300005842 | Bacteria | 2319 |
| 182 | Ga0068858_100151332 | 3300005842 | Bacteria | 2182 |
| 183 | Ga0068858_100154739 | 3300005842 | Bacteria | 2157 |
| 184 | Ga0068858_100372346 | 3300005842 | Bacteria | 1370 |
| 185 | Ga0068860_100011373 | 3300005843 | Bacteria | 8772 |
| 186 | Ga0068860_100024360 | 3300005843 | Bacteria | 5848 |
| 187 | Ga0068860_100323708 | 3300005843 | Bacteria | 1513 |
| 188 | Ga0068862_100031836 | 3300005844 | Bacteria | 4454 |
| 189 | Ga0068862_100068977 | 3300005844 | Bacteria | 3051 |
| 190 | Ga0068862_100324696 | 3300005844 | Bacteria | 1422 |
| 191 | Ga0068862_100973969 | 3300005844 | Bacteria | 838 |
| 192 | Ga0097621_100000380 | 3300006237 | Bacteria | 30961 |
| 193 | Ga0097621_100734776 | 3300006237 | Unclassified | 911 |
| 194 | Ga0068871_100330931 | 3300006358 | Bacteria | 1343 |
| 195 | Ga0075428_100027029 | 3300006844 | Bacteria | 6353 |
| 196 | Ga0068865_100003738 | 3300006881 | Bacteria | 9139 |
| 197 | Ga0068865_100253326 | 3300006881 | Bacteria | 1390 |
| 198 | Ga0097620_100000217 | 3300006931 | Bacteria | 56968 |
| 199 | Ga0097620_100002842 | 3300006931 | Bacteria | 17566 |
| 200 | Ga0097620_100087224 | 3300006931 | Bacteria | 3168 |
| 201 | Ga0097620_100551407 | 3300006931 | Bacteria | 1247 |
| 202 | Ga0105240_10013105 | 3300009093 | Bacteria | 11409 |
| 203 | Ga0105240_10021400 | 3300009093 | Bacteria | 8601 |
| 204 | Ga0111539_10055286 | 3300009094 | Bacteria | 4718 |
| 205 | Ga0105243_10202859 | 3300009148 | Bacteria | 1740 |
| 206 | Ga0105241_10044414 | 3300009174 | Bacteria | 3367 |
| 207 | Ga0105241_10089214 | 3300009174 | Bacteria | 2429 |
| 208 | Ga0105242_10244688 | 3300009176 | Bacteria | 1614 |
| 209 | Ga0105248_10002088 | 3300009177 | Bacteria | 22111 |
| 210 | Ga0105248_10002614 | 3300009177 | Bacteria | 20045 |
| 211 | Ga0105248_10245953 | 3300009177 | Bacteria | 2013 |
| 212 | Ga0105248_10560600 | 3300009177 | Bacteria | 1289 |
| 213 | Ga0105248_10736469 | 3300009177 | Unclassified | 1112 |
| 214 | Ga0105237_10030494 | 3300009545 | Bacteria | 5476 |
| 215 | Ga0105237_10193568 | 3300009545 | Bacteria | 2033 |
| 216 | Ga0105237_10433164 | 3300009545 | Bacteria | 1321 |
| 217 | Ga0105238_10010467 | 3300009551 | Bacteria | 9309 |
| 218 | Ga0105249_10238954 | 3300009553 | Bacteria | 1795 |
| 219 | Ga0105239_10099207 | 3300010375 | Bacteria | 3220 |
| 220 | Ga0157373_10035784 | 3300013100 | Bacteria | 3563 |
| 221 | Ga0157373_10077649 | 3300013100 | Bacteria | 2343 |
| 222 | Ga0157371_10020786 | 3300013102 | Bacteria | 4828 |
| 223 | Ga0157371_10118647 | 3300013102 | Bacteria | 1881 |
| 224 | Ga0157371_10338601 | 3300013102 | Bacteria | 1094 |
| 225 | Ga0157370_10000893 | 3300013104 | Bacteria | 37892 |
| 226 | Ga0157370_10011952 | 3300013104 | Bacteria | 9048 |
| 227 | Ga0157370_10038691 | 3300013104 | Bacteria | 4613 |
| 228 | Ga0157370_10218720 | 3300013104 | Bacteria | 1764 |
| 229 | Ga0157370_10381747 | 3300013104 | Bacteria | 1298 |
| 230 | Ga0157369_10005334 | 3300013105 | Bacteria | 14979 |
| 231 | Ga0157369_10006475 | 3300013105 | Bacteria | 13573 |
| 232 | Ga0157369_10038630 | 3300013105 | Bacteria | 5219 |
| 233 | Ga0157369_10095984 | 3300013105 | Bacteria | 3163 |
| 234 | Ga0157369_10140396 | 3300013105 | Bacteria | 2557 |
| 235 | Ga0157374_10026894 | 3300013296 | Bacteria | 5181 |
| 236 | Ga0157374_10048901 | 3300013296 | Bacteria | 3925 |
| 237 | Ga0157374_10052217 | 3300013296 | Bacteria | 3806 |
| 238 | Ga0157374_10642424 | 3300013296 | Bacteria | 1073 |
| 239 | Ga0157378_10471659 | 3300013297 | Bacteria | 1249 |
| 240 | Ga0163162_10001723 | 3300013306 | Bacteria | 20486 |
| 241 | Ga0163162_10268141 | 3300013306 | Bacteria | 1839 |
| 242 | Ga0157372_10012901 | 3300013307 | Bacteria | 8908 |
| 243 | Ga0157372_10063295 | 3300013307 | Bacteria | 4147 |
| 244 | Ga0157372_10094978 | 3300013307 | Bacteria | 3396 |
| 245 | Ga0157372_10142657 | 3300013307 | Bacteria | 2761 |
| 246 | Ga0157372_10198419 | 3300013307 | Bacteria | 2324 |
| 247 | Ga0157372_10259244 | 3300013307 | Bacteria | 2019 |
| 248 | Ga0157372_10259930 | 3300013307 | Bacteria | 2016 |
| 249 | Ga0157372_10734768 | 3300013307 | Bacteria | 1148 |
| 250 | Ga0157372_10979218 | 3300013307 | Bacteria | 980 |
| 251 | Ga0157375_10003757 | 3300013308 | Bacteria | 13163 |
| 252 | Ga0157375_10009466 | 3300013308 | Bacteria | 8553 |
| 253 | Ga0157375_10032850 | 3300013308 | Bacteria | 4925 |
| 254 | Ga0157375_10265728 | 3300013308 | Bacteria | 1877 |
| 255 | Ga0157375_10594153 | 3300013308 | Bacteria | 1266 |
| 256 | Ga0163163_10027486 | 3300014325 | Bacteria | 5450 |
| 257 | Ga0163163_10066448 | 3300014325 | Bacteria | 3581 |
| 258 | Ga0157380_10047964 | 3300014326 | Bacteria | 3362 |
| 259 | Ga0182008_10123840 | 3300014497 | Bacteria | 1286 |
| 260 | Ga0157377_10004959 | 3300014745 | Bacteria | 6205 |
| 261 | Ga0157379_10003822 | 3300014968 | Bacteria | 12838 |
| 262 | Ga0157379_10015344 | 3300014968 | Bacteria | 6721 |
| 263 | Ga0157379_10402239 | 3300014968 | Bacteria | 1259 |
| 264 | Ga0157376_10033384 | 3300014969 | Bacteria | 4143 |
| 265 | Ga0157376_10292704 | 3300014969 | Bacteria | 1538 |
| 266 | Ga0163161_10021774 | 3300017792 | Bacteria | 4507 |
| 267 | Ga0163161_10031650 | 3300017792 | Bacteria | 3771 |
| 268 | Ga0206356_10593666 | 3300020070 | Bacteria | 1245 |
| 269 | Ga0206354_11341275 | 3300020081 | Bacteria | 1404 |
| 270 | Ga0207673_1003898 | 3300025290 | Bacteria | 1760 |
| 271 | Ga0207697_10000319 | 3300025315 | Bacteria | 26864 |
| 272 | Ga0207656_10004660 | 3300025321 | Bacteria | 4807 |
| 273 | Ga0207656_10017184 | 3300025321 | Bacteria | 2829 |
| 274 | Ga0207656_10037161 | 3300025321 | Bacteria | 2048 |
| 275 | Ga0207682_10000075 | 3300025893 | Bacteria | 43404 |
| 276 | Ga0207682_10002499 | 3300025893 | Bacteria | 8216 |
| 277 | Ga0207692_10051069 | 3300025898 | Bacteria | 2095 |
| 278 | Ga0207688_10070330 | 3300025901 | Bacteria | 1984 |
| 279 | Ga0207688_10148368 | 3300025901 | Bacteria | 1384 |
| 280 | Ga0207680_10000486 | 3300025903 | Bacteria | 18844 |
| 281 | Ga0207680_10001434 | 3300025903 | Bacteria | 11296 |
| 282 | Ga0207680_10267069 | 3300025903 | Bacteria | 1186 |
| 283 | Ga0207699_10003665 | 3300025906 | Bacteria | 7336 |
| 284 | Ga0207645_10000152 | 3300025907 | Bacteria | 54586 |
| 285 | Ga0207645_10002330 | 3300025907 | Bacteria | 15002 |
| 286 | Ga0207645_10012159 | 3300025907 | Bacteria | 5846 |
| 287 | Ga0207645_10046452 | 3300025907 | Bacteria | 2774 |
| 288 | Ga0207645_10073475 | 3300025907 | Bacteria | 2189 |
| 289 | Ga0207643_10000851 | 3300025908 | Bacteria | 18500 |
| 290 | Ga0207643_10144732 | 3300025908 | Bacteria | 1421 |
| 291 | Ga0207705_10034967 | 3300025909 | Bacteria | 3594 |
| 292 | Ga0207654_10025709 | 3300025911 | Bacteria | 3180 |
| 293 | Ga0207707_10013313 | 3300025912 | Bacteria | 7169 |
| 294 | Ga0207707_10019919 | 3300025912 | Bacteria | 5856 |
| 295 | Ga0207707_10068931 | 3300025912 | Bacteria | 3082 |
| 296 | Ga0207695_10026649 | 3300025913 | Bacteria | 6450 |
| 297 | Ga0207695_10045749 | 3300025913 | Bacteria | 4644 |
| 298 | Ga0207671_10200979 | 3300025914 | Bacteria | 1556 |
| 299 | Ga0207693_10133207 | 3300025915 | Bacteria | 1953 |
| 300 | Ga0207663_10113573 | 3300025916 | Bacteria | 1842 |
| 301 | Ga0207663_10348085 | 3300025916 | Bacteria | 1121 |
| 302 | Ga0207660_10002028 | 3300025917 | Bacteria | 13478 |
| 303 | Ga0207662_10111056 | 3300025918 | Bacteria | 1709 |
| 304 | Ga0207662_10507058 | 3300025918 | Bacteria | 831 |
| 305 | Ga0207657_10000093 | 3300025919 | Bacteria | 85263 |
| 306 | Ga0207657_10001139 | 3300025919 | Bacteria | 28216 |
| 307 | Ga0207657_10006415 | 3300025919 | Bacteria | 12199 |
| 308 | Ga0207657_10022789 | 3300025919 | Bacteria | 5848 |
| 309 | Ga0207657_10150293 | 3300025919 | Bacteria | 1897 |
| 310 | Ga0207657_10167995 | 3300025919 | Bacteria | 1778 |
| 311 | Ga0207649_10004462 | 3300025920 | Bacteria | 7599 |
| 312 | Ga0207649_10006859 | 3300025920 | Bacteria | 6185 |
| 313 | Ga0207649_10016245 | 3300025920 | Bacteria | 4194 |
| 314 | Ga0207649_10437260 | 3300025920 | Bacteria | 985 |
| 315 | Ga0207652_10004714 | 3300025921 | Bacteria | 11056 |
| 316 | Ga0207652_10009141 | 3300025921 | Bacteria | 7976 |
| 317 | Ga0207652_10064338 | 3300025921 | Bacteria | 3174 |
| 318 | Ga0207652_10138820 | 3300025921 | Bacteria | 2172 |
| 319 | Ga0207652_10187597 | 3300025921 | Bacteria | 1859 |
| 320 | Ga0207681_10003320 | 3300025923 | Bacteria | 10074 |
| 321 | Ga0207681_10150652 | 3300025923 | Bacteria | 1742 |
| 322 | Ga0207681_10169607 | 3300025923 | Bacteria | 1653 |
| 323 | Ga0207694_10002004 | 3300025924 | Bacteria | 16854 |
| 324 | Ga0207694_10011390 | 3300025924 | Bacteria | 6712 |
| 325 | Ga0207650_10003684 | 3300025925 | Bacteria | 10477 |
| 326 | Ga0207650_10006975 | 3300025925 | Bacteria | 7702 |
| 327 | Ga0207650_10010136 | 3300025925 | Bacteria | 6458 |
| 328 | Ga0207650_10054956 | 3300025925 | Bacteria | 2954 |
| 329 | Ga0207650_10058669 | 3300025925 | Bacteria | 2866 |
| 330 | Ga0207650_10092059 | 3300025925 | Bacteria | 2318 |
| 331 | Ga0207650_10300226 | 3300025925 | Bacteria | 1311 |
| 332 | Ga0207650_10484410 | 3300025925 | Bacteria | 1032 |
| 333 | Ga0207659_10002569 | 3300025926 | Bacteria | 10806 |
| 334 | Ga0207659_10003749 | 3300025926 | Bacteria | 9163 |
| 335 | Ga0207659_10037947 | 3300025926 | Bacteria | 3348 |
| 336 | Ga0207700_10000045 | 3300025928 | Bacteria | 88536 |
| 337 | Ga0207700_10192761 | 3300025928 | Bacteria | 1713 |
| 338 | Ga0207700_10401948 | 3300025928 | Bacteria | 1201 |
| 339 | Ga0207664_10001519 | 3300025929 | Bacteria | 15217 |
| 340 | Ga0207664_10015073 | 3300025929 | Bacteria | 5600 |
| 341 | Ga0207664_10021433 | 3300025929 | Bacteria | 4805 |
| 342 | Ga0207664_10556819 | 3300025929 | Bacteria | 1029 |
| 343 | Ga0207644_10000862 | 3300025931 | Bacteria | 19192 |
| 344 | Ga0207644_10018400 | 3300025931 | Bacteria | 4726 |
| 345 | Ga0207644_10200671 | 3300025931 | Bacteria | 1573 |
| 346 | Ga0207644_10207115 | 3300025931 | Bacteria | 1549 |
| 347 | Ga0207690_10092775 | 3300025932 | Bacteria | 2138 |
| 348 | Ga0207690_10167015 | 3300025932 | Bacteria | 1645 |
| 349 | Ga0207690_10256461 | 3300025932 | Bacteria | 1353 |
| 350 | Ga0207706_10007913 | 3300025933 | Bacteria | 9809 |
| 351 | Ga0207706_10105624 | 3300025933 | Bacteria | 2478 |
| 352 | Ga0207670_10131084 | 3300025936 | Bacteria | 1837 |
| 353 | Ga0207670_10277682 | 3300025936 | Bacteria | 1304 |
| 354 | Ga0207669_10001543 | 3300025937 | Bacteria | 9822 |
| 355 | Ga0207669_10085108 | 3300025937 | Bacteria | 2040 |
| 356 | Ga0207669_10116847 | 3300025937 | Bacteria | 1801 |
| 357 | Ga0207704_10002721 | 3300025938 | Bacteria | 7973 |
| 358 | Ga0207704_10127659 | 3300025938 | Bacteria | 1754 |
| 359 | Ga0207691_10000006 | 3300025940 | Bacteria | 161922 |
| 360 | Ga0207691_10009804 | 3300025940 | Bacteria | 9197 |
| 361 | Ga0207691_10010195 | 3300025940 | Bacteria | 9014 |
| 362 | Ga0207691_10040936 | 3300025940 | Bacteria | 4280 |
| 363 | Ga0207691_10095166 | 3300025940 | Bacteria | 2664 |
| 364 | Ga0207691_10665614 | 3300025940 | Bacteria | 879 |
| 365 | Ga0207711_10026184 | 3300025941 | Bacteria | 4893 |
| 366 | Ga0207711_10069173 | 3300025941 | Bacteria | 3059 |
| 367 | Ga0207711_10187691 | 3300025941 | Bacteria | 1883 |
| 368 | Ga0207711_10261159 | 3300025941 | Bacteria | 1592 |
| 369 | Ga0207689_10000030 | 3300025942 | Bacteria | 97584 |
| 370 | Ga0207689_10002080 | 3300025942 | Bacteria | 18880 |
| 371 | Ga0207661_10082071 | 3300025944 | Bacteria | 2664 |
| 372 | Ga0207661_10433289 | 3300025944 | Bacteria | 1195 |
| 373 | Ga0207679_10008964 | 3300025945 | Bacteria | 6391 |
| 374 | Ga0207679_10022620 | 3300025945 | Bacteria | 4283 |
| 375 | Ga0207679_10048385 | 3300025945 | Bacteria | 3095 |
| 376 | Ga0207679_10092208 | 3300025945 | Bacteria | 2346 |
| 377 | Ga0207679_10832526 | 3300025945 | Bacteria | 842 |
| 378 | Ga0207667_10000410 | 3300025949 | Bacteria | 58059 |
| 379 | Ga0207667_10003249 | 3300025949 | Bacteria | 20059 |
| 380 | Ga0207667_10088541 | 3300025949 | Bacteria | 3201 |
| 381 | Ga0207667_10119726 | 3300025949 | Bacteria | 2713 |
| 382 | Ga0207651_10003988 | 3300025960 | Bacteria | 7337 |
| 383 | Ga0207651_10009648 | 3300025960 | Bacteria | 5301 |
| 384 | Ga0207651_10344074 | 3300025960 | Bacteria | 1254 |
| 385 | Ga0207712_10051920 | 3300025961 | Bacteria | 2869 |
| 386 | Ga0207668_10009342 | 3300025972 | Bacteria | 5870 |
| 387 | Ga0207668_10079566 | 3300025972 | Bacteria | 2371 |
| 388 | Ga0207668_10212219 | 3300025972 | Bacteria | 1549 |
| 389 | Ga0207668_10453904 | 3300025972 | Bacteria | 1094 |
| 390 | Ga0207640_10034409 | 3300025981 | Bacteria | 3162 |
| 391 | Ga0207640_10041560 | 3300025981 | Bacteria | 2925 |
| 392 | Ga0207640_10103740 | 3300025981 | Bacteria | 2000 |
| 393 | Ga0207640_10293905 | 3300025981 | Bacteria | 1282 |
| 394 | Ga0207640_10525445 | 3300025981 | Unclassified | 990 |
| 395 | Ga0207658_10002793 | 3300025986 | Bacteria | 12571 |
| 396 | Ga0207658_10003664 | 3300025986 | Bacteria | 10837 |
| 397 | Ga0207658_10010570 | 3300025986 | Bacteria | 6272 |
| 398 | Ga0207658_10033513 | 3300025986 | Bacteria | 3665 |
| 399 | Ga0207658_10076087 | 3300025986 | Bacteria | 2556 |
| 400 | Ga0207658_10149631 | 3300025986 | Bacteria | 1900 |
| 401 | Ga0207677_10010904 | 3300026023 | Bacteria | 5160 |
| 402 | Ga0207677_10068808 | 3300026023 | Bacteria | 2487 |
| 403 | Ga0207677_10271219 | 3300026023 | Bacteria | 1388 |
| 404 | Ga0207677_10579480 | 3300026023 | Bacteria | 982 |
| 405 | Ga0207703_10018924 | 3300026035 | Bacteria | 5380 |
| 406 | Ga0207703_10039927 | 3300026035 | Bacteria | 3753 |
| 407 | Ga0207703_10102256 | 3300026035 | Bacteria | 2431 |
| 408 | Ga0207703_10429091 | 3300026035 | Bacteria | 1231 |
| 409 | Ga0207639_10003283 | 3300026041 | Bacteria | 10888 |
| 410 | Ga0207639_10032420 | 3300026041 | Bacteria | 3846 |
| 411 | Ga0207639_10060361 | 3300026041 | Bacteria | 2925 |
| 412 | Ga0207639_10282537 | 3300026041 | Bacteria | 1460 |
| 413 | Ga0207678_10004977 | 3300026067 | Bacteria | 11917 |
| 414 | Ga0207678_10008744 | 3300026067 | Bacteria | 8913 |
| 415 | Ga0207678_10070138 | 3300026067 | Bacteria | 3005 |
| 416 | Ga0207678_10283352 | 3300026067 | Bacteria | 1422 |
| 417 | Ga0207708_10026820 | 3300026075 | Bacteria | 4361 |
| 418 | Ga0207702_10002033 | 3300026078 | Bacteria | 19598 |
| 419 | Ga0207702_10002576 | 3300026078 | Bacteria | 17051 |
| 420 | Ga0207702_10013518 | 3300026078 | Bacteria | 6781 |
| 421 | Ga0207641_10003854 | 3300026088 | Bacteria | 13135 |
| 422 | Ga0207641_10026143 | 3300026088 | Bacteria | 4816 |
| 423 | Ga0207641_10048697 | 3300026088 | Bacteria | 3578 |
| 424 | Ga0207641_10177746 | 3300026088 | Bacteria | 1947 |
| 425 | Ga0207648_10003534 | 3300026089 | Bacteria | 16341 |
| 426 | Ga0207648_10006993 | 3300026089 | Bacteria | 11157 |
| 427 | Ga0207648_10027992 | 3300026089 | Bacteria | 5000 |
| 428 | Ga0207648_10226715 | 3300026089 | Bacteria | 1661 |
| 429 | Ga0207676_10005417 | 3300026095 | Bacteria | 9032 |
| 430 | Ga0207676_10015541 | 3300026095 | Bacteria | 5493 |
| 431 | Ga0207676_10048815 | 3300026095 | Bacteria | 3288 |
| 432 | Ga0207674_10000205 | 3300026116 | Bacteria | 73346 |
| 433 | Ga0207674_10000749 | 3300026116 | Bacteria | 42581 |
| 434 | Ga0207674_10012924 | 3300026116 | Bacteria | 9311 |
| 435 | Ga0207674_10028634 | 3300026116 | Bacteria | 5876 |
| 436 | Ga0207675_100000852 | 3300026118 | Bacteria | 30393 |
| 437 | Ga0207675_100003107 | 3300026118 | Bacteria | 16280 |
| 438 | Ga0207683_10000056 | 3300026121 | Bacteria | 84718 |
| 439 | Ga0207683_10000700 | 3300026121 | Bacteria | 30630 |
| 440 | Ga0207683_10044769 | 3300026121 | Bacteria | 3869 |
| 441 | Ga0207683_10313336 | 3300026121 | Bacteria | 1437 |
| 442 | Ga0207698_10000366 | 3300026142 | Bacteria | 26504 |
| 443 | Ga0207698_10023043 | 3300026142 | Bacteria | 4343 |
| 444 | Ga0207698_10081713 | 3300026142 | Bacteria | 2609 |
| 445 | Ga0207698_10579271 | 3300026142 | Bacteria | 1104 |
| 446 | Ga0209969_1009951 | 3300027360 | Bacteria | 1358 |
| 447 | Ga0209981_1009038 | 3300027378 | Bacteria | 1359 |
| 448 | Ga0209970_1014088 | 3300027614 | Bacteria | 1327 |
| 449 | Ga0209983_1016009 | 3300027665 | Bacteria | 1547 |
| 450 | Ga0209971_1001234 | 3300027682 | Bacteria | 6406 |
| 451 | Ga0268266_10014129 | 3300028379 | Bacteria | 6874 |
| 452 | Ga0268266_10014630 | 3300028379 | Bacteria | 6743 |
| 453 | Ga0268266_10277589 | 3300028379 | Bacteria | 1557 |
| 454 | Ga0268266_10567288 | 3300028379 | Bacteria | 1089 |
| 455 | Ga0268265_10433055 | 3300028380 | Bacteria | 1224 |
| 456 | Ga0268265_10440983 | 3300028380 | Bacteria | 1214 |
| 457 | Ga0268265_10565708 | 3300028380 | Bacteria | 1081 |
| 458 | Ga0268264_10003459 | 3300028381 | Bacteria | 13616 |
| 459 | Ga0268264_10008098 | 3300028381 | Bacteria | 8742 |
| 460 | Ga0268264_10170995 | 3300028381 | Bacteria | 1965 |
| 461 | Ga0307408_100006423 | 3300031548 | Bacteria | 7795 |
| 462 | Ga0307405_10021290 | 3300031731 | Bacteria | 3641 |
| 463 | Ga0307413_10663931 | 3300031824 | Bacteria | 861 |
| 464 | Ga0307410_10004248 | 3300031852 | Bacteria | 7370 |
| 465 | Ga0307406_10053508 | 3300031901 | Bacteria | 2571 |
| 466 | Ga0307407_10001704 | 3300031903 | Bacteria | 8175 |
| 467 | Ga0307412_10007574 | 3300031911 | Bacteria | 6165 |
| 468 | Ga0307409_100001026 | 3300031995 | Bacteria | 13083 |
| 469 | Ga0307409_100561904 | 3300031995 | Bacteria | 1122 |
| 470 | Ga0307416_100142446 | 3300032002 | Bacteria | 2181 |
| 471 | Ga0307414_10770928 | 3300032004 | Bacteria | 875 |
| 472 | Ga0307411_10000807 | 3300032005 | Bacteria | 11702 |
| 473 | Ga0307415_100026473 | 3300032126 | Bacteria | 3659 |
| 474 | Ga0373954_0124080 | 3300035118 | Bacteria | 1255 |
| 475 | Ga0373956_0082341 | 3300035119 | Bacteria | 1478 |
| 476 | Ga0373946_0123107 | 3300035171 | Bacteria | 1186 |
| 477 | Ga0373955_0244910 | 3300035172 | Bacteria | 1074 |
| 478 | Ga0373924_0004339 | 3300035410 | Bacteria | 4950 |
| 479 | Ga0373927_0040790 | 3300035695 | Bacteria | 3011 |
| 480 | Ga0373947_0267278 | 3300035725 | Bacteria | 1134 |
| 481 | Ga0373937_0033401 | 3300036401 | Bacteria | 4672 |
| 482 | Ga0373937_0878888 | 3300036401 | Bacteria | 845 |
| 483 | Ga0373925_0271217 | 3300037068 | Bacteria | 1365 |
| 484 | Ga0373925_0440541 | 3300037068 | Bacteria | 1066 |
| 485 | Ga0373925_0942757 | 3300037068 | Bacteria | 711 |
| 486 | Ga0395900_0048985 | 3300037418 | Bacteria | 4352 |
| 487 | Ga0395898_0024992 | 3300037466 | Bacteria | 6022 |
| 488 | Ga0395905_0261715 | 3300037471 | Bacteria | 1615 |
| 489 | Ga0451845_0985314 | 3300041501 | Bacteria | 1280 |
| 490 | Ga0466963_0068802 | 3300044694 | Bacteria | 2379 |
| 491 | Ga0451576_0497140 | 3300045051 | Bacteria | 1281 |
| 492 | Ga0495580_0023904 | 3300046472 | Bacteria | 4480 |
| 493 | Ga0495580_0275544 | 3300046472 | Bacteria | 1148 |
| 494 | Ga0495580_0503482 | 3300046472 | Bacteria | 808 |
| 495 | Ga0495582_0428295 | 3300046473 | Bacteria | 763 |
| 496 | Ga0495630_0532298 | 3300046517 | Bacteria | 901 |
| 497 | Ga0495598_0034946 | 3300046537 | Bacteria | 1436 |
| 498 | Ga0495658_0196516 | 3300046683 | Bacteria | 1256 |
| 499 | Ga0495658_0199792 | 3300046683 | Bacteria | 1246 |
| 500 | Ga0495604_0427283 | 3300047317 | Bacteria | 869 |
| 501 | Ga0496104_0014540 | 3300048907 | Bacteria | 7109 |
| 502 | Ga0496105_0381768 | 3300048908 | Bacteria | 1121 |
| 503 | Ga0496106_0061640 | 3300048909 | Bacteria | 2846 |
| 504 | Ga0496106_0441980 | 3300048909 | Bacteria | 1045 |
| 505 | Ga0496107_0040743 | 3300048910 | Bacteria | 3335 |
| 506 | Ga0496108_0034386 | 3300048911 | Bacteria | 4211 |
| 507 | Ga0496108_0039168 | 3300048911 | Bacteria | 3952 |
| 508 | Ga0496109_0120495 | 3300048912 | Bacteria | 2444 |
| 509 | Ga0496109_0322347 | 3300048912 | Bacteria | 1458 |
| 510 | Ga0496110_0063038 | 3300048913 | Bacteria | 3275 |
| 511 | Ga0496110_0423288 | 3300048913 | Bacteria | 1214 |
| 512 | Ga0496110_0741641 | 3300048913 | Bacteria | 885 |
| 513 | Ga0496112_0001802 | 3300048915 | Bacteria | 16862 |
| 514 | Ga0496113_0348320 | 3300048916 | Bacteria | 1188 |
| 515 | Ga0496114_0138207 | 3300048917 | Bacteria | 2107 |
| 516 | Ga0501034_0028364 | 3300049571 | Bacteria | 5696 |
| 517 | Ga0501041_0132662 | 3300049577 | Bacteria | 1552 |
| 518 | Ga0501042_0280679 | 3300049578 | Bacteria | 1203 |
| 519 | Ga0501047_0105302 | 3300049581 | Bacteria | 2701 |
| 520 | Ga0501048_0097229 | 3300049582 | Bacteria | 2077 |
| 521 | Ga0501070_0011144 | 3300049586 | Bacteria | 7588 |
| 522 | Ga0501070_0616242 | 3300049586 | Bacteria | 864 |
| 523 | Ga0501071_0525767 | 3300049587 | Bacteria | 908 |
| 524 | Ga0501072_0169526 | 3300049588 | Bacteria | 1742 |
| 525 | Ga0501080_0000772 | 3300049742 | Bacteria | 26012 |
| 526 | Ga0501081_0442986 | 3300049743 | Bacteria | 964 |
| 527 | Ga0501083_0240904 | 3300049744 | Bacteria | 1177 |
| 528 | Ga0501035_0143882 | 3300049822 | Bacteria | 2072 |
| 529 | nmdc:mga08y16_38103_c1 | 3300050511 | Bacteria | 5048 |
| 530 | nmdc:mga08x19_855708_c1 | 3300050514 | Bacteria | 646 |
| 531 | Ga0501084_0145961 | 3300054114 | Bacteria | 1993 |
| 532 | Ga0501082_0127999 | 3300060353 | Bacteria | 2203 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046472 | Ga0495580_0503482 | Ga0495580_0503482_186_764 | 192 |
| 2 | 3300050514 | nmdc:mga08x19_855708_c1 | nmdc:mga08x19_855708_c1_37_633 | 196 |
| 3 | 3300035725 | Ga0373947_0267278 | Ga0373947_0267278_32_643 | 203 |
| 4 | 3300046473 | Ga0495582_0428295 | Ga0495582_0428295_21_632 | 203 |
| 5 | 3300046517 | Ga0495630_0532298 | Ga0495630_0532298_26_637 | 203 |
| 6 | 3300037068 | Ga0373925_0942757 | Ga0373925_0942757_77_700 | 207 |
| 7 | 3300048916 | Ga0496113_0348320 | Ga0496113_0348320_29_652 | 207 |
| 8 | 3300049588 | Ga0501072_0169526 | Ga0501072_0169526_1050_1715 | 221 |
| 9 | 3300005328 | Ga0070676_10038133 | Ga0070676_100381331 | 224 |
| 10 | 3300005336 | Ga0070680_100857832 | Ga0070680_1008578321 | 226 |
| 11 | 3300005344 | Ga0070661_100065403 | Ga0070661_1000654033 | 226 |
| 12 | 3300005458 | Ga0070681_10012832 | Ga0070681_100128322 | 226 |
| 13 | 3300005530 | Ga0070679_100008089 | Ga0070679_10000808910 | 226 |
| 14 | 3300005547 | Ga0070693_100318270 | Ga0070693_1003182701 | 226 |
| 15 | 3300005564 | Ga0070664_100181088 | Ga0070664_1001810882 | 226 |
| 16 | 3300005614 | Ga0068856_100003325 | Ga0068856_1000033252 | 226 |
| 17 | 3300013307 | Ga0157372_10063295 | Ga0157372_100632953 | 226 |
| 18 | 3300025912 | Ga0207707_10068931 | Ga0207707_100689314 | 226 |
| 19 | 3300025920 | Ga0207649_10437260 | Ga0207649_104372602 | 226 |
| 20 | 3300025921 | Ga0207652_10009141 | Ga0207652_100091413 | 226 |
| 21 | 3300025945 | Ga0207679_10832526 | Ga0207679_108325261 | 226 |
| 22 | 3300026078 | Ga0207702_10002576 | Ga0207702_1000257617 | 226 |
| 23 | 3300037418 | Ga0395900_0048985 | Ga0395900_0048985_1745_2455 | 226 |
| 24 | 3300037466 | Ga0395898_0024992 | Ga0395898_0024992_1347_2057 | 226 |
| 25 | 3300005329 | Ga0070683_100240109 | Ga0070683_1002401092 | 227 |
| 26 | 3300005336 | Ga0070680_100135663 | Ga0070680_1001356633 | 227 |
| 27 | 3300005337 | Ga0070682_100221197 | Ga0070682_1002211972 | 227 |
| 28 | 3300005344 | Ga0070661_100016337 | Ga0070661_1000163374 | 227 |
| 29 | 3300005435 | Ga0070714_100004596 | Ga0070714_10000459611 | 227 |
| 30 | 3300005455 | Ga0070663_100008998 | Ga0070663_1000089982 | 227 |
| 31 | 3300005458 | Ga0070681_10253132 | Ga0070681_102531323 | 227 |
| 32 | 3300005530 | Ga0070679_100206760 | Ga0070679_1002067602 | 227 |
| 33 | 3300005535 | Ga0070684_100274283 | Ga0070684_1002742832 | 227 |
| 34 | 3300005539 | Ga0068853_100085998 | Ga0068853_1000859983 | 227 |
| 35 | 3300005564 | Ga0070664_100274808 | Ga0070664_1002748082 | 227 |
| 36 | 3300005577 | Ga0068857_100153625 | Ga0068857_1001536252 | 227 |
| 37 | 3300005578 | Ga0068854_100002763 | Ga0068854_1000027639 | 227 |
| 38 | 3300005614 | Ga0068856_100003654 | Ga0068856_10000365416 | 227 |
| 39 | 3300005616 | Ga0068852_100017500 | Ga0068852_1000175002 | 227 |
| 40 | 3300005834 | Ga0068851_10000506 | Ga0068851_1000050613 | 227 |
| 41 | 3300009093 | Ga0105240_10021400 | Ga0105240_100214009 | 227 |
| 42 | 3300009174 | Ga0105241_10044414 | Ga0105241_100444143 | 227 |
| 43 | 3300009545 | Ga0105237_10030494 | Ga0105237_100304947 | 227 |
| 44 | 3300013102 | Ga0157371_10118647 | Ga0157371_101186472 | 227 |
| 45 | 3300013104 | Ga0157370_10218720 | Ga0157370_102187203 | 227 |
| 46 | 3300013105 | Ga0157369_10038630 | Ga0157369_100386306 | 227 |
| 47 | 3300020070 | Ga0206356_10593666 | Ga0206356_105936662 | 227 |
| 48 | 3300020081 | Ga0206354_11341275 | Ga0206354_113412752 | 227 |
| 49 | 3300025321 | Ga0207656_10017184 | Ga0207656_100171842 | 227 |
| 50 | 3300025909 | Ga0207705_10034967 | Ga0207705_100349673 | 227 |
| 51 | 3300025911 | Ga0207654_10025709 | Ga0207654_100257093 | 227 |
| 52 | 3300025912 | Ga0207707_10019919 | Ga0207707_100199198 | 227 |
| 53 | 3300025913 | Ga0207695_10045749 | Ga0207695_100457493 | 227 |
| 54 | 3300025917 | Ga0207660_10002028 | Ga0207660_1000202814 | 227 |
| 55 | 3300025919 | Ga0207657_10000093 | Ga0207657_1000009341 | 227 |
| 56 | 3300025921 | Ga0207652_10004714 | Ga0207652_100047148 | 227 |
| 57 | 3300025924 | Ga0207694_10011390 | Ga0207694_100113902 | 227 |
| 58 | 3300025929 | Ga0207664_10015073 | Ga0207664_100150733 | 227 |
| 59 | 3300025944 | Ga0207661_10082071 | Ga0207661_100820713 | 227 |
| 60 | 3300025945 | Ga0207679_10048385 | Ga0207679_100483852 | 227 |
| 61 | 3300025949 | Ga0207667_10000410 | Ga0207667_1000041016 | 227 |
| 62 | 3300025981 | Ga0207640_10041560 | Ga0207640_100415601 | 227 |
| 63 | 3300026041 | Ga0207639_10003283 | Ga0207639_1000328310 | 227 |
| 64 | 3300026067 | Ga0207678_10070138 | Ga0207678_100701383 | 227 |
| 65 | 3300026078 | Ga0207702_10013518 | Ga0207702_100135185 | 227 |
| 66 | 3300026116 | Ga0207674_10000749 | Ga0207674_1000074932 | 227 |
| 67 | 3300026142 | Ga0207698_10000366 | Ga0207698_1000036616 | 227 |
| 68 | 3300037068 | Ga0373925_0440541 | Ga0373925_0440541_195_902 | 227 |
| 69 | 3300037471 | Ga0395905_0261715 | Ga0395905_0261715_864_1574 | 227 |
| 70 | 3300044694 | Ga0466963_0068802 | Ga0466963_0068802_1311_2042 | 227 |
| 71 | 3300005329 | Ga0070683_100563981 | Ga0070683_1005639812 | 228 |
| 72 | 3300005344 | Ga0070661_100033352 | Ga0070661_1000333523 | 228 |
| 73 | 3300005539 | Ga0068853_100373923 | Ga0068853_1003739232 | 228 |
| 74 | 3300013104 | Ga0157370_10038691 | Ga0157370_100386915 | 228 |
| 75 | 3300013307 | Ga0157372_10198419 | Ga0157372_101984193 | 228 |
| 76 | 3300025919 | Ga0207657_10001139 | Ga0207657_1000113918 | 228 |
| 77 | 3300025920 | Ga0207649_10016245 | Ga0207649_100162453 | 228 |
| 78 | 3300005293 | Ga0065715_10186585 | Ga0065715_101865852 | 232 |
| 79 | 3300005328 | Ga0070676_10002968 | Ga0070676_100029687 | 232 |
| 80 | 3300005328 | Ga0070676_10010362 | Ga0070676_100103625 | 232 |
| 81 | 3300005330 | Ga0070690_100363437 | Ga0070690_1003634371 | 232 |
| 82 | 3300005331 | Ga0070670_100232967 | Ga0070670_1002329672 | 232 |
| 83 | 3300005331 | Ga0070670_100311616 | Ga0070670_1003116162 | 232 |
| 84 | 3300005333 | Ga0070677_10004021 | Ga0070677_100040213 | 232 |
| 85 | 3300005334 | Ga0068869_100000108 | Ga0068869_1000001083 | 232 |
| 86 | 3300005335 | Ga0070666_10026451 | Ga0070666_100264514 | 232 |
| 87 | 3300005338 | Ga0068868_100006441 | Ga0068868_1000064415 | 232 |
| 88 | 3300005338 | Ga0068868_100056259 | Ga0068868_1000562593 | 232 |
| 89 | 3300005340 | Ga0070689_100114572 | Ga0070689_1001145722 | 232 |
| 90 | 3300005340 | Ga0070689_100658069 | Ga0070689_1006580692 | 232 |
| 91 | 3300005343 | Ga0070687_100384223 | Ga0070687_1003842231 | 232 |
| 92 | 3300005344 | Ga0070661_100351859 | Ga0070661_1003518591 | 232 |
| 93 | 3300005344 | Ga0070661_100508687 | Ga0070661_1005086872 | 232 |
| 94 | 3300005347 | Ga0070668_100025885 | Ga0070668_1000258853 | 232 |
| 95 | 3300005347 | Ga0070668_100031665 | Ga0070668_1000316653 | 232 |
| 96 | 3300005347 | Ga0070668_100037182 | Ga0070668_1000371823 | 232 |
| 97 | 3300005353 | Ga0070669_100000482 | Ga0070669_10000048223 | 232 |
| 98 | 3300005353 | Ga0070669_100028863 | Ga0070669_1000288634 | 232 |
| 99 | 3300005354 | Ga0070675_100038658 | Ga0070675_1000386581 | 232 |
| 100 | 3300005356 | Ga0070674_100031998 | Ga0070674_1000319982 | 232 |
| 101 | 3300005356 | Ga0070674_100193973 | Ga0070674_1001939731 | 232 |
| 102 | 3300005364 | Ga0070673_100027742 | Ga0070673_1000277425 | 232 |
| 103 | 3300005365 | Ga0070688_100016771 | Ga0070688_1000167713 | 232 |
| 104 | 3300005367 | Ga0070667_100003815 | Ga0070667_10000381513 | 232 |
| 105 | 3300005367 | Ga0070667_100022212 | Ga0070667_1000222124 | 232 |
| 106 | 3300005367 | Ga0070667_100041022 | Ga0070667_1000410223 | 232 |
| 107 | 3300005367 | Ga0070667_100269379 | Ga0070667_1002693792 | 232 |
| 108 | 3300005456 | Ga0070678_100020355 | Ga0070678_1000203552 | 232 |
| 109 | 3300005459 | Ga0068867_100001466 | Ga0068867_1000014666 | 232 |
| 110 | 3300005459 | Ga0068867_100009464 | Ga0068867_1000094645 | 232 |
| 111 | 3300005459 | Ga0068867_100175113 | Ga0068867_1001751133 | 232 |
| 112 | 3300005468 | Ga0070707_100881527 | Ga0070707_1008815271 | 232 |
| 113 | 3300005543 | Ga0070672_100001874 | Ga0070672_1000018746 | 232 |
| 114 | 3300005548 | Ga0070665_100001984 | Ga0070665_1000019847 | 232 |
| 115 | 3300005548 | Ga0070665_100063857 | Ga0070665_1000638573 | 232 |
| 116 | 3300005548 | Ga0070665_100365677 | Ga0070665_1003656772 | 232 |
| 117 | 3300005616 | Ga0068852_100686830 | Ga0068852_1006868302 | 232 |
| 118 | 3300005617 | Ga0068859_100000217 | Ga0068859_10000021754 | 232 |
| 119 | 3300005617 | Ga0068859_100002842 | Ga0068859_1000028426 | 232 |
| 120 | 3300005618 | Ga0068864_100015296 | Ga0068864_1000152966 | 232 |
| 121 | 3300005618 | Ga0068864_100066851 | Ga0068864_1000668513 | 232 |
| 122 | 3300005618 | Ga0068864_100317733 | Ga0068864_1003177331 | 232 |
| 123 | 3300005719 | Ga0068861_100691751 | Ga0068861_1006917511 | 232 |
| 124 | 3300005841 | Ga0068863_100030801 | Ga0068863_1000308014 | 232 |
| 125 | 3300005841 | Ga0068863_100127597 | Ga0068863_1001275972 | 232 |
| 126 | 3300005842 | Ga0068858_100004830 | Ga0068858_1000048306 | 232 |
| 127 | 3300005842 | Ga0068858_100075295 | Ga0068858_1000752953 | 232 |
| 128 | 3300005843 | Ga0068860_100323708 | Ga0068860_1003237081 | 232 |
| 129 | 3300005844 | Ga0068862_100068977 | Ga0068862_1000689774 | 232 |
| 130 | 3300005844 | Ga0068862_100973969 | Ga0068862_1009739691 | 232 |
| 131 | 3300006237 | Ga0097621_100000380 | Ga0097621_1000003803 | 232 |
| 132 | 3300006358 | Ga0068871_100330931 | Ga0068871_1003309312 | 232 |
| 133 | 3300006881 | Ga0068865_100003738 | Ga0068865_1000037385 | 232 |
| 134 | 3300006931 | Ga0097620_100000217 | Ga0097620_1000002172 | 232 |
| 135 | 3300006931 | Ga0097620_100002842 | Ga0097620_1000028426 | 232 |
| 136 | 3300009177 | Ga0105248_10002614 | Ga0105248_1000261417 | 232 |
| 137 | 3300013296 | Ga0157374_10026894 | Ga0157374_100268943 | 232 |
| 138 | 3300013306 | Ga0163162_10001723 | Ga0163162_1000172318 | 232 |
| 139 | 3300013308 | Ga0157375_10009466 | Ga0157375_100094663 | 232 |
| 140 | 3300013308 | Ga0157375_10594153 | Ga0157375_105941532 | 232 |
| 141 | 3300014325 | Ga0163163_10027486 | Ga0163163_100274865 | 232 |
| 142 | 3300014968 | Ga0157379_10003822 | Ga0157379_1000382210 | 232 |
| 143 | 3300014968 | Ga0157379_10402239 | Ga0157379_104022392 | 232 |
| 144 | 3300014969 | Ga0157376_10033384 | Ga0157376_100333842 | 232 |
| 145 | 3300017792 | Ga0163161_10031650 | Ga0163161_100316503 | 232 |
| 146 | 3300025903 | Ga0207680_10000486 | Ga0207680_1000048613 | 232 |
| 147 | 3300025903 | Ga0207680_10267069 | Ga0207680_102670692 | 232 |
| 148 | 3300025907 | Ga0207645_10002330 | Ga0207645_1000233013 | 232 |
| 149 | 3300025907 | Ga0207645_10073475 | Ga0207645_100734752 | 232 |
| 150 | 3300025908 | Ga0207643_10144732 | Ga0207643_101447322 | 232 |
| 151 | 3300025918 | Ga0207662_10507058 | Ga0207662_105070581 | 232 |
| 152 | 3300025923 | Ga0207681_10003320 | Ga0207681_100033207 | 232 |
| 153 | 3300025925 | Ga0207650_10003684 | Ga0207650_100036846 | 232 |
| 154 | 3300025925 | Ga0207650_10006975 | Ga0207650_100069752 | 232 |
| 155 | 3300025925 | Ga0207650_10058669 | Ga0207650_100586694 | 232 |
| 156 | 3300025926 | Ga0207659_10002569 | Ga0207659_1000256910 | 232 |
| 157 | 3300025936 | Ga0207670_10131084 | Ga0207670_101310842 | 232 |
| 158 | 3300025936 | Ga0207670_10277682 | Ga0207670_102776822 | 232 |
| 159 | 3300025937 | Ga0207669_10116847 | Ga0207669_101168472 | 232 |
| 160 | 3300025938 | Ga0207704_10002721 | Ga0207704_100027215 | 232 |
| 161 | 3300025940 | Ga0207691_10009804 | Ga0207691_100098043 | 232 |
| 162 | 3300025940 | Ga0207691_10010195 | Ga0207691_100101953 | 232 |
| 163 | 3300025941 | Ga0207711_10026184 | Ga0207711_100261845 | 232 |
| 164 | 3300025942 | Ga0207689_10000030 | Ga0207689_100000306 | 232 |
| 165 | 3300025960 | Ga0207651_10009648 | Ga0207651_100096483 | 232 |
| 166 | 3300025961 | Ga0207712_10051920 | Ga0207712_100519202 | 232 |
| 167 | 3300025972 | Ga0207668_10009342 | Ga0207668_100093425 | 232 |
| 168 | 3300025972 | Ga0207668_10079566 | Ga0207668_100795663 | 232 |
| 169 | 3300025972 | Ga0207668_10212219 | Ga0207668_102122192 | 232 |
| 170 | 3300025981 | Ga0207640_10293905 | Ga0207640_102939051 | 232 |
| 171 | 3300025986 | Ga0207658_10002793 | Ga0207658_100027937 | 232 |
| 172 | 3300025986 | Ga0207658_10010570 | Ga0207658_100105705 | 232 |
| 173 | 3300026023 | Ga0207677_10010904 | Ga0207677_100109046 | 232 |
| 174 | 3300026023 | Ga0207677_10579480 | Ga0207677_105794802 | 232 |
| 175 | 3300026035 | Ga0207703_10102256 | Ga0207703_101022563 | 232 |
| 176 | 3300026067 | Ga0207678_10283352 | Ga0207678_102833522 | 232 |
| 177 | 3300026088 | Ga0207641_10003854 | Ga0207641_100038545 | 232 |
| 178 | 3300026088 | Ga0207641_10026143 | Ga0207641_100261435 | 232 |
| 179 | 3300026089 | Ga0207648_10003534 | Ga0207648_100035348 | 232 |
| 180 | 3300026095 | Ga0207676_10005417 | Ga0207676_100054175 | 232 |
| 181 | 3300026095 | Ga0207676_10048815 | Ga0207676_100488153 | 232 |
| 182 | 3300026116 | Ga0207674_10012924 | Ga0207674_100129244 | 232 |
| 183 | 3300026118 | Ga0207675_100000852 | Ga0207675_10000085230 | 232 |
| 184 | 3300026121 | Ga0207683_10000700 | Ga0207683_100007009 | 232 |
| 185 | 3300026142 | Ga0207698_10081713 | Ga0207698_100817132 | 232 |
| 186 | 3300026142 | Ga0207698_10579271 | Ga0207698_105792712 | 232 |
| 187 | 3300028379 | Ga0268266_10014129 | Ga0268266_100141293 | 232 |
| 188 | 3300028379 | Ga0268266_10014630 | Ga0268266_100146304 | 232 |
| 189 | 3300028379 | Ga0268266_10277589 | Ga0268266_102775892 | 232 |
| 190 | 3300028380 | Ga0268265_10565708 | Ga0268265_105657082 | 232 |
| 191 | 3300028381 | Ga0268264_10003459 | Ga0268264_100034599 | 232 |
| 192 | 3300028381 | Ga0268264_10008098 | Ga0268264_100080984 | 232 |
| 193 | 3300031548 | Ga0307408_100006423 | Ga0307408_1000064233 | 232 |
| 194 | 3300031731 | Ga0307405_10021290 | Ga0307405_100212903 | 232 |
| 195 | 3300031824 | Ga0307413_10663931 | Ga0307413_106639311 | 232 |
| 196 | 3300031852 | Ga0307410_10004248 | Ga0307410_100042483 | 232 |
| 197 | 3300031901 | Ga0307406_10053508 | Ga0307406_100535083 | 232 |
| 198 | 3300031903 | Ga0307407_10001704 | Ga0307407_100017049 | 232 |
| 199 | 3300031911 | Ga0307412_10007574 | Ga0307412_100075745 | 232 |
| 200 | 3300031995 | Ga0307409_100001026 | Ga0307409_1000010264 | 232 |
| 201 | 3300031995 | Ga0307409_100561904 | Ga0307409_1005619042 | 232 |
| 202 | 3300032002 | Ga0307416_100142446 | Ga0307416_1001424462 | 232 |
| 203 | 3300032004 | Ga0307414_10770928 | Ga0307414_107709282 | 232 |
| 204 | 3300032005 | Ga0307411_10000807 | Ga0307411_100008075 | 232 |
| 205 | 3300032126 | Ga0307415_100026473 | Ga0307415_1000264734 | 232 |
| 206 | 3300048908 | Ga0496105_0381768 | Ga0496105_0381768_79_777 | 232 |
| 207 | 3300048909 | Ga0496106_0441980 | Ga0496106_0441980_129_827 | 232 |
| 208 | 3300048911 | Ga0496108_0039168 | Ga0496108_0039168_1894_2592 | 232 |
| 209 | 3300048912 | Ga0496109_0120495 | Ga0496109_0120495_286_984 | 232 |
| 210 | 3300049587 | Ga0501071_0525767 | Ga0501071_0525767_11_709 | 232 |
| 211 | 3300005347 | Ga0070668_100090578 | Ga0070668_1000905782 | 233 |
| 212 | 3300005365 | Ga0070688_100199834 | Ga0070688_1001998341 | 233 |
| 213 | 3300005530 | Ga0070679_100012228 | Ga0070679_1000122283 | 233 |
| 214 | 3300005530 | Ga0070679_100097318 | Ga0070679_1000973182 | 233 |
| 215 | 3300005539 | Ga0068853_100033222 | Ga0068853_1000332222 | 233 |
| 216 | 3300005841 | Ga0068863_100137327 | Ga0068863_1001373272 | 233 |
| 217 | 3300005844 | Ga0068862_100324696 | Ga0068862_1003246962 | 233 |
| 218 | 3300013100 | Ga0157373_10077649 | Ga0157373_100776492 | 233 |
| 219 | 3300013104 | Ga0157370_10381747 | Ga0157370_103817472 | 233 |
| 220 | 3300013307 | Ga0157372_10259930 | Ga0157372_102599303 | 233 |
| 221 | 3300013308 | Ga0157375_10265728 | Ga0157375_102657282 | 233 |
| 222 | 3300025912 | Ga0207707_10013313 | Ga0207707_100133132 | 233 |
| 223 | 3300025921 | Ga0207652_10138820 | Ga0207652_101388202 | 233 |
| 224 | 3300025921 | Ga0207652_10187597 | Ga0207652_101875972 | 233 |
| 225 | 3300025960 | Ga0207651_10344074 | Ga0207651_103440742 | 233 |
| 226 | 3300025972 | Ga0207668_10453904 | Ga0207668_104539042 | 233 |
| 227 | 3300026041 | Ga0207639_10032420 | Ga0207639_100324205 | 233 |
| 228 | 3300049571 | Ga0501034_0028364 | Ga0501034_0028364_2322_3023 | 233 |
| 229 | 3300049581 | Ga0501047_0105302 | Ga0501047_0105302_344_1045 | 233 |
| 230 | 3300049586 | Ga0501070_0011144 | Ga0501070_0011144_17_718 | 233 |
| 231 | 3300049586 | Ga0501070_0616242 | Ga0501070_0616242_14_715 | 233 |
| 232 | 3300049742 | Ga0501080_0000772 | Ga0501080_0000772_13805_14506 | 233 |
| 233 | 3300049744 | Ga0501083_0240904 | Ga0501083_0240904_248_949 | 233 |
| 234 | 3300049822 | Ga0501035_0143882 | Ga0501035_0143882_956_1657 | 233 |
| 235 | 3300054114 | Ga0501084_0145961 | Ga0501084_0145961_393_1094 | 233 |
| 236 | 3300005354 | Ga0070675_100005354 | Ga0070675_1000053543 | 234 |
| 237 | 3300005459 | Ga0068867_100851509 | Ga0068867_1008515091 | 234 |
| 238 | 3300005543 | Ga0070672_100385641 | Ga0070672_1003856411 | 234 |
| 239 | 3300025925 | Ga0207650_10484410 | Ga0207650_104844101 | 234 |
| 240 | 3300025926 | Ga0207659_10037947 | Ga0207659_100379472 | 234 |
| 241 | 3300025940 | Ga0207691_10665614 | Ga0207691_106656142 | 234 |
| 242 | 3300026089 | Ga0207648_10226715 | Ga0207648_102267152 | 234 |
| 243 | 3300028379 | Ga0268266_10567288 | Ga0268266_105672882 | 234 |
| 244 | 3300049577 | Ga0501041_0132662 | Ga0501041_0132662_62_766 | 234 |
| 245 | 3300049578 | Ga0501042_0280679 | Ga0501042_0280679_487_1191 | 234 |
| 246 | 3300049582 | Ga0501048_0097229 | Ga0501048_0097229_1025_1729 | 234 |
| 247 | 3300049743 | Ga0501081_0442986 | Ga0501081_0442986_94_798 | 234 |
| 248 | 3300060353 | Ga0501082_0127999 | Ga0501082_0127999_787_1491 | 234 |
| 249 | 3300006844 | Ga0075428_100027029 | Ga0075428_1000270297 | 235 |
| 250 | 3300013104 | Ga0157370_10000893 | Ga0157370_100008937 | 235 |
| 251 | 3300025928 | Ga0207700_10000045 | Ga0207700_1000004572 | 235 |
| 252 | 3300035119 | Ga0373956_0082341 | Ga0373956_0082341_38_745 | 235 |
| 253 | 3300035695 | Ga0373927_0040790 | Ga0373927_0040790_2050_2757 | 235 |
| 254 | 3300046472 | Ga0495580_0023904 | Ga0495580_0023904_323_1030 | 235 |
| 255 | 3300046472 | Ga0495580_0275544 | Ga0495580_0275544_208_915 | 235 |
| 256 | 3300046683 | Ga0495658_0199792 | Ga0495658_0199792_457_1164 | 235 |
| 257 | 3300005329 | Ga0070683_100064230 | Ga0070683_1000642303 | 236 |
| 258 | 3300005333 | Ga0070677_10000399 | Ga0070677_1000039915 | 236 |
| 259 | 3300005335 | Ga0070666_10001754 | Ga0070666_1000175410 | 236 |
| 260 | 3300005335 | Ga0070666_10038220 | Ga0070666_100382202 | 236 |
| 261 | 3300005336 | Ga0070680_100095133 | Ga0070680_1000951332 | 236 |
| 262 | 3300005338 | Ga0068868_100011862 | Ga0068868_1000118627 | 236 |
| 263 | 3300005338 | Ga0068868_100090852 | Ga0068868_1000908523 | 236 |
| 264 | 3300005339 | Ga0070660_100012123 | Ga0070660_1000121236 | 236 |
| 265 | 3300005339 | Ga0070660_100468949 | Ga0070660_1004689492 | 236 |
| 266 | 3300005340 | Ga0070689_100141774 | Ga0070689_1001417743 | 236 |
| 267 | 3300005344 | Ga0070661_100005143 | Ga0070661_1000051433 | 236 |
| 268 | 3300005347 | Ga0070668_100090767 | Ga0070668_1000907672 | 236 |
| 269 | 3300005354 | Ga0070675_100120329 | Ga0070675_1001203292 | 236 |
| 270 | 3300005355 | Ga0070671_100004778 | Ga0070671_1000047781 | 236 |
| 271 | 3300005355 | Ga0070671_100005229 | Ga0070671_1000052297 | 236 |
| 272 | 3300005355 | Ga0070671_100051697 | Ga0070671_1000516972 | 236 |
| 273 | 3300005356 | Ga0070674_100004774 | Ga0070674_1000047743 | 236 |
| 274 | 3300005356 | Ga0070674_100434996 | Ga0070674_1004349961 | 236 |
| 275 | 3300005364 | Ga0070673_100001176 | Ga0070673_1000011767 | 236 |
| 276 | 3300005366 | Ga0070659_100075387 | Ga0070659_1000753873 | 236 |
| 277 | 3300005366 | Ga0070659_100092659 | Ga0070659_1000926592 | 236 |
| 278 | 3300005367 | Ga0070667_100001817 | Ga0070667_1000018173 | 236 |
| 279 | 3300005367 | Ga0070667_100059966 | Ga0070667_1000599664 | 236 |
| 280 | 3300005367 | Ga0070667_100100736 | Ga0070667_1001007362 | 236 |
| 281 | 3300005367 | Ga0070667_100426498 | Ga0070667_1004264982 | 236 |
| 282 | 3300005434 | Ga0070709_10189103 | Ga0070709_101891032 | 236 |
| 283 | 3300005435 | Ga0070714_100007506 | Ga0070714_1000075069 | 236 |
| 284 | 3300005435 | Ga0070714_100022875 | Ga0070714_1000228756 | 236 |
| 285 | 3300005436 | Ga0070713_100026589 | Ga0070713_1000265892 | 236 |
| 286 | 3300005436 | Ga0070713_100318343 | Ga0070713_1003183431 | 236 |
| 287 | 3300005437 | Ga0070710_10000687 | Ga0070710_1000068710 | 236 |
| 288 | 3300005439 | Ga0070711_100030508 | Ga0070711_1000305085 | 236 |
| 289 | 3300005439 | Ga0070711_100088699 | Ga0070711_1000886992 | 236 |
| 290 | 3300005456 | Ga0070678_100016839 | Ga0070678_1000168394 | 236 |
| 291 | 3300005457 | Ga0070662_100484910 | Ga0070662_1004849102 | 236 |
| 292 | 3300005459 | Ga0068867_100002533 | Ga0068867_10000253313 | 236 |
| 293 | 3300005518 | Ga0070699_100039227 | Ga0070699_1000392275 | 236 |
| 294 | 3300005530 | Ga0070679_100030058 | Ga0070679_1000300583 | 236 |
| 295 | 3300005530 | Ga0070679_100057307 | Ga0070679_1000573073 | 236 |
| 296 | 3300005535 | Ga0070684_100001542 | Ga0070684_1000015429 | 236 |
| 297 | 3300005539 | Ga0068853_100080703 | Ga0068853_1000807033 | 236 |
| 298 | 3300005539 | Ga0068853_100519419 | Ga0068853_1005194191 | 236 |
| 299 | 3300005543 | Ga0070672_100001353 | Ga0070672_1000013535 | 236 |
| 300 | 3300005543 | Ga0070672_100156020 | Ga0070672_1001560202 | 236 |
| 301 | 3300005543 | Ga0070672_100484680 | Ga0070672_1004846802 | 236 |
| 302 | 3300005546 | Ga0070696_100014222 | Ga0070696_1000142225 | 236 |
| 303 | 3300005563 | Ga0068855_100019744 | Ga0068855_1000197443 | 236 |
| 304 | 3300005564 | Ga0070664_100002461 | Ga0070664_1000024616 | 236 |
| 305 | 3300005577 | Ga0068857_100002627 | Ga0068857_10000262710 | 236 |
| 306 | 3300005614 | Ga0068856_100012536 | Ga0068856_1000125363 | 236 |
| 307 | 3300005616 | Ga0068852_100004888 | Ga0068852_1000048884 | 236 |
| 308 | 3300005616 | Ga0068852_100010061 | Ga0068852_1000100613 | 236 |
| 309 | 3300005617 | Ga0068859_100551534 | Ga0068859_1005515342 | 236 |
| 310 | 3300005618 | Ga0068864_100025290 | Ga0068864_1000252903 | 236 |
| 311 | 3300005834 | Ga0068851_10000682 | Ga0068851_1000068214 | 236 |
| 312 | 3300005840 | Ga0068870_10005548 | Ga0068870_100055482 | 236 |
| 313 | 3300005842 | Ga0068858_100016224 | Ga0068858_1000162246 | 236 |
| 314 | 3300005842 | Ga0068858_100134563 | Ga0068858_1001345633 | 236 |
| 315 | 3300005842 | Ga0068858_100151332 | Ga0068858_1001513323 | 236 |
| 316 | 3300005842 | Ga0068858_100154739 | Ga0068858_1001547393 | 236 |
| 317 | 3300005842 | Ga0068858_100372346 | Ga0068858_1003723462 | 236 |
| 318 | 3300005843 | Ga0068860_100011373 | Ga0068860_1000113732 | 236 |
| 319 | 3300005843 | Ga0068860_100024360 | Ga0068860_1000243604 | 236 |
| 320 | 3300006931 | Ga0097620_100551407 | Ga0097620_1005514072 | 236 |
| 321 | 3300009093 | Ga0105240_10013105 | Ga0105240_100131052 | 236 |
| 322 | 3300009148 | Ga0105243_10202859 | Ga0105243_102028593 | 236 |
| 323 | 3300009174 | Ga0105241_10089214 | Ga0105241_100892143 | 236 |
| 324 | 3300009177 | Ga0105248_10002088 | Ga0105248_100020882 | 236 |
| 325 | 3300009177 | Ga0105248_10245953 | Ga0105248_102459532 | 236 |
| 326 | 3300009545 | Ga0105237_10193568 | Ga0105237_101935683 | 236 |
| 327 | 3300009545 | Ga0105237_10433164 | Ga0105237_104331642 | 236 |
| 328 | 3300009551 | Ga0105238_10010467 | Ga0105238_1001046712 | 236 |
| 329 | 3300013100 | Ga0157373_10035784 | Ga0157373_100357843 | 236 |
| 330 | 3300013102 | Ga0157371_10020786 | Ga0157371_100207864 | 236 |
| 331 | 3300013104 | Ga0157370_10011952 | Ga0157370_1001195211 | 236 |
| 332 | 3300013105 | Ga0157369_10005334 | Ga0157369_1000533410 | 236 |
| 333 | 3300013105 | Ga0157369_10006475 | Ga0157369_1000647510 | 236 |
| 334 | 3300013296 | Ga0157374_10052217 | Ga0157374_100522172 | 236 |
| 335 | 3300013297 | Ga0157378_10471659 | Ga0157378_104716592 | 236 |
| 336 | 3300013306 | Ga0163162_10268141 | Ga0163162_102681412 | 236 |
| 337 | 3300013307 | Ga0157372_10012901 | Ga0157372_1001290110 | 236 |
| 338 | 3300013307 | Ga0157372_10094978 | Ga0157372_100949783 | 236 |
| 339 | 3300013307 | Ga0157372_10142657 | Ga0157372_101426572 | 236 |
| 340 | 3300013307 | Ga0157372_10259244 | Ga0157372_102592443 | 236 |
| 341 | 3300013307 | Ga0157372_10979218 | Ga0157372_109792181 | 236 |
| 342 | 3300013308 | Ga0157375_10003757 | Ga0157375_1000375713 | 236 |
| 343 | 3300014325 | Ga0163163_10066448 | Ga0163163_100664483 | 236 |
| 344 | 3300014497 | Ga0182008_10123840 | Ga0182008_101238402 | 236 |
| 345 | 3300014968 | Ga0157379_10015344 | Ga0157379_100153443 | 236 |
| 346 | 3300014969 | Ga0157376_10292704 | Ga0157376_102927042 | 236 |
| 347 | 3300017792 | Ga0163161_10021774 | Ga0163161_100217743 | 236 |
| 348 | 3300025893 | Ga0207682_10000075 | Ga0207682_1000007510 | 236 |
| 349 | 3300025898 | Ga0207692_10051069 | Ga0207692_100510692 | 236 |
| 350 | 3300025901 | Ga0207688_10148368 | Ga0207688_101483682 | 236 |
| 351 | 3300025903 | Ga0207680_10001434 | Ga0207680_1000143410 | 236 |
| 352 | 3300025906 | Ga0207699_10003665 | Ga0207699_100036652 | 236 |
| 353 | 3300025907 | Ga0207645_10000152 | Ga0207645_1000015245 | 236 |
| 354 | 3300025907 | Ga0207645_10046452 | Ga0207645_100464521 | 236 |
| 355 | 3300025913 | Ga0207695_10026649 | Ga0207695_100266496 | 236 |
| 356 | 3300025914 | Ga0207671_10200979 | Ga0207671_102009792 | 236 |
| 357 | 3300025916 | Ga0207663_10113573 | Ga0207663_101135732 | 236 |
| 358 | 3300025916 | Ga0207663_10348085 | Ga0207663_103480852 | 236 |
| 359 | 3300025919 | Ga0207657_10022789 | Ga0207657_100227894 | 236 |
| 360 | 3300025919 | Ga0207657_10167995 | Ga0207657_101679952 | 236 |
| 361 | 3300025920 | Ga0207649_10004462 | Ga0207649_100044627 | 236 |
| 362 | 3300025921 | Ga0207652_10064338 | Ga0207652_100643383 | 236 |
| 363 | 3300025923 | Ga0207681_10169607 | Ga0207681_101696072 | 236 |
| 364 | 3300025924 | Ga0207694_10002004 | Ga0207694_1000200417 | 236 |
| 365 | 3300025925 | Ga0207650_10054956 | Ga0207650_100549562 | 236 |
| 366 | 3300025928 | Ga0207700_10192761 | Ga0207700_101927613 | 236 |
| 367 | 3300025928 | Ga0207700_10401948 | Ga0207700_104019482 | 236 |
| 368 | 3300025929 | Ga0207664_10001519 | Ga0207664_1000151910 | 236 |
| 369 | 3300025929 | Ga0207664_10021433 | Ga0207664_100214334 | 236 |
| 370 | 3300025929 | Ga0207664_10556819 | Ga0207664_105568192 | 236 |
| 371 | 3300025931 | Ga0207644_10000862 | Ga0207644_1000086220 | 236 |
| 372 | 3300025931 | Ga0207644_10018400 | Ga0207644_100184004 | 236 |
| 373 | 3300025932 | Ga0207690_10256461 | Ga0207690_102564612 | 236 |
| 374 | 3300025933 | Ga0207706_10105624 | Ga0207706_101056242 | 236 |
| 375 | 3300025937 | Ga0207669_10001543 | Ga0207669_1000154310 | 236 |
| 376 | 3300025937 | Ga0207669_10085108 | Ga0207669_100851082 | 236 |
| 377 | 3300025940 | Ga0207691_10000006 | Ga0207691_10000006117 | 236 |
| 378 | 3300025940 | Ga0207691_10095166 | Ga0207691_100951663 | 236 |
| 379 | 3300025941 | Ga0207711_10069173 | Ga0207711_100691732 | 236 |
| 380 | 3300025941 | Ga0207711_10187691 | Ga0207711_101876911 | 236 |
| 381 | 3300025941 | Ga0207711_10261159 | Ga0207711_102611592 | 236 |
| 382 | 3300025944 | Ga0207661_10433289 | Ga0207661_104332891 | 236 |
| 383 | 3300025945 | Ga0207679_10008964 | Ga0207679_100089646 | 236 |
| 384 | 3300025949 | Ga0207667_10003249 | Ga0207667_100032499 | 236 |
| 385 | 3300025949 | Ga0207667_10119726 | Ga0207667_101197262 | 236 |
| 386 | 3300025960 | Ga0207651_10003988 | Ga0207651_100039885 | 236 |
| 387 | 3300025981 | Ga0207640_10034409 | Ga0207640_100344092 | 236 |
| 388 | 3300025986 | Ga0207658_10003664 | Ga0207658_100036648 | 236 |
| 389 | 3300025986 | Ga0207658_10033513 | Ga0207658_100335135 | 236 |
| 390 | 3300025986 | Ga0207658_10076087 | Ga0207658_100760873 | 236 |
| 391 | 3300025986 | Ga0207658_10149631 | Ga0207658_101496313 | 236 |
| 392 | 3300026023 | Ga0207677_10068808 | Ga0207677_100688082 | 236 |
| 393 | 3300026023 | Ga0207677_10271219 | Ga0207677_102712191 | 236 |
| 394 | 3300026035 | Ga0207703_10018924 | Ga0207703_100189243 | 236 |
| 395 | 3300026035 | Ga0207703_10039927 | Ga0207703_100399273 | 236 |
| 396 | 3300026035 | Ga0207703_10429091 | Ga0207703_104290912 | 236 |
| 397 | 3300026041 | Ga0207639_10060361 | Ga0207639_100603612 | 236 |
| 398 | 3300026067 | Ga0207678_10008744 | Ga0207678_100087446 | 236 |
| 399 | 3300026078 | Ga0207702_10002033 | Ga0207702_1000203311 | 236 |
| 400 | 3300026088 | Ga0207641_10177746 | Ga0207641_101777462 | 236 |
| 401 | 3300026089 | Ga0207648_10006993 | Ga0207648_100069937 | 236 |
| 402 | 3300026095 | Ga0207676_10015541 | Ga0207676_100155415 | 236 |
| 403 | 3300026116 | Ga0207674_10000205 | Ga0207674_1000020515 | 236 |
| 404 | 3300026121 | Ga0207683_10000056 | Ga0207683_1000005623 | 236 |
| 405 | 3300026142 | Ga0207698_10023043 | Ga0207698_100230433 | 236 |
| 406 | 3300027360 | Ga0209969_1009951 | Ga0209969_10099512 | 236 |
| 407 | 3300027378 | Ga0209981_1009038 | Ga0209981_10090382 | 236 |
| 408 | 3300027614 | Ga0209970_1014088 | Ga0209970_10140882 | 236 |
| 409 | 3300027665 | Ga0209983_1016009 | Ga0209983_10160092 | 236 |
| 410 | 3300027682 | Ga0209971_1001234 | Ga0209971_10012346 | 236 |
| 411 | 3300028380 | Ga0268265_10433055 | Ga0268265_104330552 | 236 |
| 412 | 3300028380 | Ga0268265_10440983 | Ga0268265_104409832 | 236 |
| 413 | 3300028381 | Ga0268264_10170995 | Ga0268264_101709952 | 236 |
| 414 | 3300035410 | Ga0373924_0004339 | Ga0373924_0004339_3241_3951 | 236 |
| 415 | 3300045051 | Ga0451576_0497140 | Ga0451576_0497140_255_965 | 236 |
| 416 | 3300046683 | Ga0495658_0196516 | Ga0495658_0196516_455_1165 | 236 |
| 417 | 3300047317 | Ga0495604_0427283 | Ga0495604_0427283_120_836 | 236 |
| 418 | 3300048913 | Ga0496110_0423288 | Ga0496110_0423288_29_739 | 236 |
| 419 | 3300048913 | Ga0496110_0741641 | Ga0496110_0741641_124_834 | 236 |
| 420 | 3300048915 | Ga0496112_0001802 | Ga0496112_0001802_12758_13468 | 236 |
| 421 | 3300001976 | JGI24752J21851_1007012 | JGI24752J21851_10070122 | 237 |
| 422 | 3300001977 | JGI24746J21847_1020783 | JGI24746J21847_10207832 | 237 |
| 423 | 3300002076 | JGI24749J21850_1002611 | JGI24749J21850_10026113 | 237 |
| 424 | 3300002126 | JGI24035J26624_1009658 | JGI24035J26624_10096582 | 237 |
| 425 | 3300005328 | Ga0070676_10124284 | Ga0070676_101242842 | 237 |
| 426 | 3300005330 | Ga0070690_100170974 | Ga0070690_1001709742 | 237 |
| 427 | 3300005331 | Ga0070670_100065001 | Ga0070670_1000650014 | 237 |
| 428 | 3300005331 | Ga0070670_100120456 | Ga0070670_1001204563 | 237 |
| 429 | 3300005333 | Ga0070677_10002466 | Ga0070677_100024663 | 237 |
| 430 | 3300005334 | Ga0068869_100020312 | Ga0068869_1000203123 | 237 |
| 431 | 3300005338 | Ga0068868_100181487 | Ga0068868_1001814872 | 237 |
| 432 | 3300005339 | Ga0070660_100066098 | Ga0070660_1000660982 | 237 |
| 433 | 3300005339 | Ga0070660_100464495 | Ga0070660_1004644952 | 237 |
| 434 | 3300005340 | Ga0070689_100014335 | Ga0070689_1000143351 | 237 |
| 435 | 3300005344 | Ga0070661_100007131 | Ga0070661_1000071312 | 237 |
| 436 | 3300005344 | Ga0070661_100057780 | Ga0070661_1000577803 | 237 |
| 437 | 3300005355 | Ga0070671_100749280 | Ga0070671_1007492801 | 237 |
| 438 | 3300005365 | Ga0070688_100020439 | Ga0070688_1000204393 | 237 |
| 439 | 3300005366 | Ga0070659_100022667 | Ga0070659_1000226676 | 237 |
| 440 | 3300005366 | Ga0070659_100120210 | Ga0070659_1001202102 | 237 |
| 441 | 3300005455 | Ga0070663_100607683 | Ga0070663_1006076832 | 237 |
| 442 | 3300005456 | Ga0070678_100171756 | Ga0070678_1001717561 | 237 |
| 443 | 3300005457 | Ga0070662_100095159 | Ga0070662_1000951592 | 237 |
| 444 | 3300005535 | Ga0070684_100033871 | Ga0070684_1000338713 | 237 |
| 445 | 3300005535 | Ga0070684_100385040 | Ga0070684_1003850402 | 237 |
| 446 | 3300005563 | Ga0068855_100187278 | Ga0068855_1001872783 | 237 |
| 447 | 3300005564 | Ga0070664_100045817 | Ga0070664_1000458173 | 237 |
| 448 | 3300005564 | Ga0070664_100057489 | Ga0070664_1000574894 | 237 |
| 449 | 3300005564 | Ga0070664_100095464 | Ga0070664_1000954642 | 237 |
| 450 | 3300005577 | Ga0068857_100114401 | Ga0068857_1001144012 | 237 |
| 451 | 3300005615 | Ga0070702_100021708 | Ga0070702_1000217083 | 237 |
| 452 | 3300005617 | Ga0068859_100087220 | Ga0068859_1000872203 | 237 |
| 453 | 3300005718 | Ga0068866_10033930 | Ga0068866_100339302 | 237 |
| 454 | 3300005719 | Ga0068861_100040936 | Ga0068861_1000409363 | 237 |
| 455 | 3300005834 | Ga0068851_10009081 | Ga0068851_100090815 | 237 |
| 456 | 3300005834 | Ga0068851_10038811 | Ga0068851_100388113 | 237 |
| 457 | 3300005841 | Ga0068863_100616755 | Ga0068863_1006167551 | 237 |
| 458 | 3300005844 | Ga0068862_100031836 | Ga0068862_1000318365 | 237 |
| 459 | 3300006237 | Ga0097621_100734776 | Ga0097621_1007347761 | 237 |
| 460 | 3300006881 | Ga0068865_100253326 | Ga0068865_1002533262 | 237 |
| 461 | 3300006931 | Ga0097620_100087224 | Ga0097620_1000872243 | 237 |
| 462 | 3300009094 | Ga0111539_10055286 | Ga0111539_100552865 | 237 |
| 463 | 3300009176 | Ga0105242_10244688 | Ga0105242_102446882 | 237 |
| 464 | 3300009177 | Ga0105248_10560600 | Ga0105248_105606001 | 237 |
| 465 | 3300009177 | Ga0105248_10736469 | Ga0105248_107364692 | 237 |
| 466 | 3300009553 | Ga0105249_10238954 | Ga0105249_102389542 | 237 |
| 467 | 3300010375 | Ga0105239_10099207 | Ga0105239_100992073 | 237 |
| 468 | 3300013102 | Ga0157371_10338601 | Ga0157371_103386012 | 237 |
| 469 | 3300013105 | Ga0157369_10095984 | Ga0157369_100959843 | 237 |
| 470 | 3300013105 | Ga0157369_10140396 | Ga0157369_101403963 | 237 |
| 471 | 3300013296 | Ga0157374_10048901 | Ga0157374_100489015 | 237 |
| 472 | 3300013296 | Ga0157374_10642424 | Ga0157374_106424242 | 237 |
| 473 | 3300013307 | Ga0157372_10734768 | Ga0157372_107347682 | 237 |
| 474 | 3300013308 | Ga0157375_10032850 | Ga0157375_100328503 | 237 |
| 475 | 3300014326 | Ga0157380_10047964 | Ga0157380_100479642 | 237 |
| 476 | 3300014745 | Ga0157377_10004959 | Ga0157377_100049593 | 237 |
| 477 | 3300025290 | Ga0207673_1003898 | Ga0207673_10038982 | 237 |
| 478 | 3300025315 | Ga0207697_10000319 | Ga0207697_100003196 | 237 |
| 479 | 3300025321 | Ga0207656_10004660 | Ga0207656_100046605 | 237 |
| 480 | 3300025321 | Ga0207656_10037161 | Ga0207656_100371612 | 237 |
| 481 | 3300025893 | Ga0207682_10002499 | Ga0207682_100024993 | 237 |
| 482 | 3300025901 | Ga0207688_10070330 | Ga0207688_100703302 | 237 |
| 483 | 3300025907 | Ga0207645_10012159 | Ga0207645_100121596 | 237 |
| 484 | 3300025908 | Ga0207643_10000851 | Ga0207643_1000085110 | 237 |
| 485 | 3300025915 | Ga0207693_10133207 | Ga0207693_101332072 | 237 |
| 486 | 3300025918 | Ga0207662_10111056 | Ga0207662_101110562 | 237 |
| 487 | 3300025919 | Ga0207657_10006415 | Ga0207657_1000641513 | 237 |
| 488 | 3300025919 | Ga0207657_10150293 | Ga0207657_101502933 | 237 |
| 489 | 3300025920 | Ga0207649_10006859 | Ga0207649_100068596 | 237 |
| 490 | 3300025923 | Ga0207681_10150652 | Ga0207681_101506522 | 237 |
| 491 | 3300025925 | Ga0207650_10010136 | Ga0207650_100101366 | 237 |
| 492 | 3300025925 | Ga0207650_10092059 | Ga0207650_100920592 | 237 |
| 493 | 3300025925 | Ga0207650_10300226 | Ga0207650_103002262 | 237 |
| 494 | 3300025926 | Ga0207659_10003749 | Ga0207659_1000374910 | 237 |
| 495 | 3300025931 | Ga0207644_10200671 | Ga0207644_102006712 | 237 |
| 496 | 3300025931 | Ga0207644_10207115 | Ga0207644_102071151 | 237 |
| 497 | 3300025932 | Ga0207690_10092775 | Ga0207690_100927752 | 237 |
| 498 | 3300025932 | Ga0207690_10167015 | Ga0207690_101670153 | 237 |
| 499 | 3300025933 | Ga0207706_10007913 | Ga0207706_100079135 | 237 |
| 500 | 3300025938 | Ga0207704_10127659 | Ga0207704_101276592 | 237 |
| 501 | 3300025940 | Ga0207691_10040936 | Ga0207691_100409365 | 237 |
| 502 | 3300025942 | Ga0207689_10002080 | Ga0207689_100020809 | 237 |
| 503 | 3300025945 | Ga0207679_10022620 | Ga0207679_100226203 | 237 |
| 504 | 3300025945 | Ga0207679_10092208 | Ga0207679_100922081 | 237 |
| 505 | 3300025949 | Ga0207667_10088541 | Ga0207667_100885413 | 237 |
| 506 | 3300025981 | Ga0207640_10103740 | Ga0207640_101037402 | 237 |
| 507 | 3300025981 | Ga0207640_10525445 | Ga0207640_105254452 | 237 |
| 508 | 3300026041 | Ga0207639_10282537 | Ga0207639_102825372 | 237 |
| 509 | 3300026067 | Ga0207678_10004977 | Ga0207678_100049774 | 237 |
| 510 | 3300026075 | Ga0207708_10026820 | Ga0207708_100268203 | 237 |
| 511 | 3300026088 | Ga0207641_10048697 | Ga0207641_100486973 | 237 |
| 512 | 3300026089 | Ga0207648_10027992 | Ga0207648_100279924 | 237 |
| 513 | 3300026116 | Ga0207674_10028634 | Ga0207674_100286344 | 237 |
| 514 | 3300026118 | Ga0207675_100003107 | Ga0207675_1000031073 | 237 |
| 515 | 3300026121 | Ga0207683_10044769 | Ga0207683_100447693 | 237 |
| 516 | 3300026121 | Ga0207683_10313336 | Ga0207683_103133362 | 237 |
| 517 | 3300035118 | Ga0373954_0124080 | Ga0373954_0124080_328_1062 | 237 |
| 518 | 3300035171 | Ga0373946_0123107 | Ga0373946_0123107_85_798 | 237 |
| 519 | 3300035172 | Ga0373955_0244910 | Ga0373955_0244910_172_906 | 237 |
| 520 | 3300036401 | Ga0373937_0033401 | Ga0373937_0033401_325_1053 | 237 |
| 521 | 3300036401 | Ga0373937_0878888 | Ga0373937_0878888_67_801 | 237 |
| 522 | 3300037068 | Ga0373925_0271217 | Ga0373925_0271217_240_953 | 237 |
| 523 | 3300041501 | Ga0451845_0985314 | Ga0451845_0985314_315_1028 | 237 |
| 524 | 3300046537 | Ga0495598_0034946 | Ga0495598_0034946_115_828 | 237 |
| 525 | 3300048907 | Ga0496104_0014540 | Ga0496104_0014540_4590_5303 | 237 |
| 526 | 3300048909 | Ga0496106_0061640 | Ga0496106_0061640_44_757 | 237 |
| 527 | 3300048910 | Ga0496107_0040743 | Ga0496107_0040743_1916_2629 | 237 |
| 528 | 3300048911 | Ga0496108_0034386 | Ga0496108_0034386_743_1456 | 237 |
| 529 | 3300048912 | Ga0496109_0322347 | Ga0496109_0322347_258_971 | 237 |
| 530 | 3300048913 | Ga0496110_0063038 | Ga0496110_0063038_198_911 | 237 |
| 531 | 3300048917 | Ga0496114_0138207 | Ga0496114_0138207_752_1465 | 237 |
| 532 | 3300050511 | nmdc:mga08y16_38103_c1 | nmdc:mga08y16_38103_c1_623_1336 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4maq-assembly1.cif.gz_B | crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia | 0.9322 | 1 | 234 |
| 4maq-assembly1.cif.gz_A | crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia | 0.9198 | 2 | 234 |
| 1saw-assembly1.cif.gz_A | x-ray structure of homo sapiens protein flj36880 | 0.9144 | 25 | 234 |
| 6sbj-assembly2.cif.gz_C | x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed | 0.9109 | 25 | 234 |
| 6foh-assembly1.cif.gz_A | x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) at 1.56a resolution. | 0.9102 | 25 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4maqA00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9198 | 2 | 234 | 3.90.850.10 |
| 4maqA00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.908 | 2 | 234 | 3.90.850.10 |
| af_Q9VDE2_1_220_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8902 | 25 | 234 | 3.90.850.10 |
| 1wzoC02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8866 | 25 | 234 | 3.90.850.10 |
| af_Q10B63_1_221_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8815 | 25 | 234 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435SEY7-F1-model_v4 | deleted | 0.9443 | 73 | 233 |
|
| AF-A0A226WXR6-F1-model_v4 | Fumarylacetoacetate hydrolase family protein | 0.9422 | 88 | 233 |
GO:0018773
GO:0046872 |
| AF-A0A812IQ58-F1-model_v4 | deleted | 0.9416 | 42 | 233 |
|
| AF-A0A534JQW6-F1-model_v4 | Fumarylacetoacetate hydrolase family protein | 0.9399 | 51 | 234 |
GO:0018773
GO:0046872 |
| AF-A0A7V7X9R7-F1-model_v4 | deleted | 0.9381 | 80 | 233 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar