F460106

General Info

Members Datasets Scaffolds Average Seq Length
531 223 1044 309

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100027920|Ga0075428_1000279202
Length 328
Sequence MWIRFGVSATTVGIIISALLVISLSVIVGRVSAQRAIAPAXXXXSSSAQIRRQANGKPDFSGIWQANNTANWDLVTHEAMPARVMQTGVHPLSPVPAAPVLALGAVGGVPPGPGVVEGDVIPYKPEALQRKKDNFEHWLDRDPEIKCYQPGVPRAMYMPYPFQILQGTNKIMMVFEYANAQRTIHLDQVEPYPNDSWMGHSVGNWEGDTLVVDVTSQIDKTWFDRAGDFHSDALHVVERYRMMTPDAIWYEATIEDPNVFTRPWKIAMPLYRHLEPGAQLMDYRCIEMVEELLYGHLRKQPLVSNWEGQTLTVRVERKVPPPDVLYER

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 0.38
Rhizosphere 98.87
Stem 0
Stem Tuber 0
Unclassified 24.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100027920 3300006844 Bacteria 6245
2 Ga0070683_100068226 3300005329 Unclassified 3313
3 Ga0070683_100068666 3300005329 Bacteria 3302
4 Ga0070690_100153375 3300005330 Unclassified 1573
5 Ga0070670_100000419 3300005331 Bacteria 34947
6 Ga0070670_100076749 3300005331 Bacteria 2871
7 Ga0068869_100437950 3300005334 Unclassified 1081
8 Ga0070666_10083885 3300005335 Unclassified 2180
9 Ga0070666_10084797 3300005335 Bacteria 2169
10 Ga0070666_10171588 3300005335 Unclassified 1519
11 Ga0068868_100000775 3300005338 Bacteria 21626
12 Ga0068868_100241025 3300005338 Unclassified 1519
13 Ga0068868_100452269 3300005338 Unclassified 1117
14 Ga0070660_100212972 3300005339 Bacteria 1569
15 Ga0070689_100042658 3300005340 Bacteria 3483
16 Ga0070689_100056515 3300005340 Unclassified 3043
17 Ga0070689_100086462 3300005340 Bacteria 2466
18 Ga0070689_100086795 3300005340 Bacteria 2461
19 Ga0070691_10000667 3300005341 Bacteria 13322
20 Ga0070687_100085182 3300005343 Unclassified 1734
21 Ga0070661_100047111 3300005344 Bacteria 3155
22 Ga0070692_10043331 3300005345 Unclassified 2314
23 Ga0070669_100115116 3300005353 Unclassified 2045
24 Ga0070675_100000093 3300005354 Bacteria 51263
25 Ga0070675_100000173 3300005354 Bacteria 39883
26 Ga0070675_100000413 3300005354 Bacteria 29141
27 Ga0070675_100002006 3300005354 Bacteria 15103
28 Ga0070675_100104700 3300005354 Unclassified 2387
29 Ga0070675_100116588 3300005354 Unclassified 2265
30 Ga0070675_100194198 3300005354 Unclassified 1760
31 Ga0070671_100007337 3300005355 Bacteria 8805
32 Ga0070671_100009227 3300005355 Bacteria 7924
33 Ga0070671_100131888 3300005355 Bacteria 2104
34 Ga0070673_100003330 3300005364 Bacteria 9982
35 Ga0070673_100016284 3300005364 Bacteria 5253
36 Ga0070673_100069866 3300005364 Bacteria 2817
37 Ga0070673_100208615 3300005364 Unclassified 1686
38 Ga0070673_100463228 3300005364 Bacteria 1142
39 Ga0070688_100035372 3300005365 Unclassified 3034
40 Ga0070688_100050349 3300005365 Bacteria 2594
41 Ga0070667_100008037 3300005367 Bacteria 8749
42 Ga0070667_100008750 3300005367 Bacteria 8390
43 Ga0070667_100026133 3300005367 Unclassified 4855
44 Ga0070714_100006277 3300005435 Bacteria 9160
45 Ga0070713_100001089 3300005436 Bacteria 17388
46 Ga0070713_100002372 3300005436 Bacteria 12275
47 Ga0070713_100570711 3300005436 Bacteria 1073
48 Ga0070701_10148434 3300005438 Bacteria 1348
49 Ga0070701_10184963 3300005438 Unclassified 1222
50 Ga0070705_100002127 3300005440 Bacteria 10072
51 Ga0070705_100009312 3300005440 Bacteria 4880
52 Ga0070705_100026527 3300005440 Bacteria 3154
53 Ga0070705_100178953 3300005440 Bacteria 1435
54 Ga0070694_100000733 3300005444 Bacteria 18330
55 Ga0070694_100003516 3300005444 Bacteria 9366
56 Ga0070694_100018041 3300005444 Bacteria 4471
57 Ga0070694_100139408 3300005444 Bacteria 1760
58 Ga0070694_100187585 3300005444 Bacteria 1533
59 Ga0070708_100173867 3300005445 Bacteria 2012
60 Ga0070708_100253660 3300005445 Bacteria 1653
61 Ga0070678_100027943 3300005456 Bacteria 3839
62 Ga0070678_100067807 3300005456 Unclassified 2657
63 Ga0070662_100065442 3300005457 Bacteria 2665
64 Ga0070662_100233894 3300005457 Bacteria 1471
65 Ga0070681_10021472 3300005458 Bacteria 6472
66 Ga0068867_100249477 3300005459 Bacteria 1443
67 Ga0068867_100250579 3300005459 Bacteria 1440
68 Ga0070685_10036649 3300005466 Bacteria 2773
69 Ga0070707_100010061 3300005468 Bacteria 8805
70 Ga0070707_100047693 3300005468 Bacteria 4101
71 Ga0070707_100054382 3300005468 Bacteria 3838
72 Ga0070707_100207070 3300005468 Unclassified 1912
73 Ga0070698_100005682 3300005471 Bacteria 13652
74 Ga0070698_100007072 3300005471 Bacteria 12154
75 Ga0070698_100007846 3300005471 Bacteria 11556
76 Ga0070698_100032318 3300005471 Bacteria 5421
77 Ga0070698_100051432 3300005471 Bacteria 4196
78 Ga0070698_100247410 3300005471 Bacteria 1716
79 Ga0070699_100000583 3300005518 Bacteria 34487
80 Ga0070699_100001609 3300005518 Bacteria 20621
81 Ga0070699_100014311 3300005518 Bacteria 6821
82 Ga0070699_100063563 3300005518 Bacteria 3200
83 Ga0070699_100123113 3300005518 Bacteria 2281
84 Ga0070699_100132767 3300005518 Bacteria 2195
85 Ga0070699_100167805 3300005518 Bacteria 1944
86 Ga0070679_100008841 3300005530 Bacteria 9504
87 Ga0070684_100002037 3300005535 Bacteria 14883
88 Ga0070684_100019645 3300005535 Bacteria 5591
89 Ga0070684_100137399 3300005535 Bacteria 2209
90 Ga0070697_100056829 3300005536 Bacteria 3184
91 Ga0070697_100058190 3300005536 Unclassified 3145
92 Ga0068853_100031857 3300005539 Bacteria 4463
93 Ga0070672_100008033 3300005543 Bacteria 7207
94 Ga0070672_100070414 3300005543 Unclassified 2779
95 Ga0070695_100000219 3300005545 Bacteria 27963
96 Ga0070695_100016127 3300005545 Bacteria 4518
97 Ga0070695_100058796 3300005545 Bacteria 2487
98 Ga0070695_100102067 3300005545 Bacteria 1933
99 Ga0070696_100000188 3300005546 Bacteria 36187
100 Ga0070696_100002056 3300005546 Bacteria 13192
101 Ga0070696_100034651 3300005546 Bacteria 3473
102 Ga0070696_100036776 3300005546 Bacteria 3376
103 Ga0070696_100050702 3300005546 Bacteria 2885
104 Ga0070696_100062388 3300005546 Bacteria 2609
105 Ga0070696_100190908 3300005546 Bacteria 1525
106 Ga0070696_100252782 3300005546 Bacteria 1333
107 Ga0070693_100245459 3300005547 Bacteria 1184
108 Ga0070665_100267482 3300005548 Unclassified 1711
109 Ga0070704_100001156 3300005549 Bacteria 13788
110 Ga0070704_100013795 3300005549 Bacteria 5029
111 Ga0070704_100041241 3300005549 Unclassified 3184
112 Ga0070704_100047069 3300005549 Bacteria 3013
113 Ga0070704_100060078 3300005549 Bacteria 2715
114 Ga0070704_100098014 3300005549 Bacteria 2201
115 Ga0070704_100128331 3300005549 Bacteria 1961
116 Ga0070704_100163511 3300005549 Bacteria 1763
117 Ga0068855_100012187 3300005563 Bacteria 10389
118 Ga0068855_100062315 3300005563 Bacteria 4354
119 Ga0068855_100202062 3300005563 Unclassified 2237
120 Ga0070664_100000131 3300005564 Bacteria 49975
121 Ga0070664_100054501 3300005564 Bacteria 3392
122 Ga0070664_100386820 3300005564 Unclassified 1278
123 Ga0068857_100025506 3300005577 Bacteria 5204
124 Ga0068857_100095280 3300005577 Bacteria 2666
125 Ga0068854_100059834 3300005578 Unclassified 2754
126 Ga0068856_100003282 3300005614 Bacteria 16442
127 Ga0068856_100069252 3300005614 Unclassified 3489
128 Ga0068856_100106576 3300005614 Bacteria 2797
129 Ga0070702_100034512 3300005615 Bacteria 2789
130 Ga0070702_100039637 3300005615 Unclassified 2630
131 Ga0070702_100066804 3300005615 Bacteria 2110
132 Ga0068852_100003962 3300005616 Bacteria 10402
133 Ga0068852_100431126 3300005616 Bacteria 1302
134 Ga0068852_100451375 3300005616 Bacteria 1273
135 Ga0068859_100000161 3300005617 Bacteria 65050
136 Ga0068859_100001946 3300005617 Bacteria 21062
137 Ga0068859_100008877 3300005617 Bacteria 10148
138 Ga0068859_100069643 3300005617 Bacteria 3553
139 Ga0068859_100193541 3300005617 Bacteria 2118
140 Ga0068859_100199189 3300005617 Bacteria 2087
141 Ga0068864_100000280 3300005618 Bacteria 45611
142 Ga0068864_100069903 3300005618 Unclassified 3053
143 Ga0068864_100083081 3300005618 Bacteria 2812
144 Ga0068864_100120839 3300005618 Bacteria 2342
145 Ga0068864_100146670 3300005618 Bacteria 2134
146 Ga0068861_100218651 3300005719 Bacteria 1609
147 Ga0068851_10051145 3300005834 Unclassified 2099
148 Ga0068863_100001065 3300005841 Bacteria 27415
149 Ga0068863_100001626 3300005841 Bacteria 22199
150 Ga0068863_100038749 3300005841 Unclassified 4534
151 Ga0068863_100302376 3300005841 Bacteria 1552
152 Ga0068863_100560933 3300005841 Unclassified 1128
153 Ga0068858_100043953 3300005842 Bacteria 4142
154 Ga0068858_100056308 3300005842 Bacteria 3634
155 Ga0068858_100061214 3300005842 Unclassified 3480
156 Ga0068860_100001147 3300005843 Bacteria 29074
157 Ga0068860_100004829 3300005843 Bacteria 13726
158 Ga0068862_100123977 3300005844 Bacteria 2280
159 Ga0081455_10089287 3300005937 Bacteria 2501
160 Ga0097621_100005805 3300006237 Bacteria 8717
161 Ga0097621_100096950 3300006237 Unclassified 2475
162 Ga0097621_100116556 3300006237 Bacteria 2262
163 Ga0068871_100022259 3300006358 Unclassified 4886
164 Ga0068871_100024699 3300006358 Unclassified 4664
165 Ga0068871_100027085 3300006358 Unclassified 4480
166 Ga0068871_100238356 3300006358 Unclassified 1581
167 Ga0075428_100017747 3300006844 Bacteria 7863
168 Ga0075428_100055719 3300006844 Unclassified 4332
169 Ga0075428_100296256 3300006844 Bacteria 1739
170 Ga0075430_100028868 3300006846 Bacteria 4710
171 Ga0075430_100455915 3300006846 Bacteria 1055
172 Ga0075431_100007116 3300006847 Bacteria 11116
173 Ga0075431_100141063 3300006847 Unclassified 2484
174 Ga0075433_10102987 3300006852 Bacteria 2528
175 Ga0075433_10135805 3300006852 Bacteria 2186
176 Ga0075433_10138946 3300006852 Unclassified 2159
177 Ga0075433_10197243 3300006852 Bacteria 1790
178 Ga0075434_100003262 3300006871 Bacteria 14500
179 Ga0075434_100065012 3300006871 Unclassified 3633
180 Ga0075434_100171562 3300006871 Bacteria 2189
181 Ga0075434_100190595 3300006871 Unclassified 2071
182 Ga0075434_100201768 3300006871 Bacteria 2009
183 Ga0075434_100431223 3300006871 Bacteria 1339
184 Ga0075429_100068947 3300006880 Bacteria 3078
185 Ga0068865_100196496 3300006881 Bacteria 1563
186 Ga0075436_100178131 3300006914 Bacteria 1502
187 Ga0097620_100000161 3300006931 Bacteria 65050
188 Ga0097620_100001946 3300006931 Bacteria 21062
189 Ga0097620_100008878 3300006931 Bacteria 10148
190 Ga0097620_100069643 3300006931 Bacteria 3553
191 Ga0097620_100193539 3300006931 Bacteria 2118
192 Ga0097620_100199192 3300006931 Bacteria 2087
193 Ga0075435_100011219 3300007076 Bacteria 6577
194 Ga0075435_100034374 3300007076 Bacteria 4016
195 Ga0075435_100049738 3300007076 Unclassified 3372
196 Ga0075435_100188587 3300007076 Bacteria 1744
197 Ga0075435_100245108 3300007076 Bacteria 1525
198 Ga0099794_10035671 3300007265 Bacteria 2348
199 Ga0105240_10001609 3300009093 Bacteria 38288
200 Ga0105240_10010039 3300009093 Bacteria 13334
201 Ga0105240_10293034 3300009093 Bacteria 1864
202 Ga0105240_10481724 3300009093 Unclassified 1383
203 Ga0111539_10007902 3300009094 Bacteria 13575
204 Ga0111539_10029099 3300009094 Bacteria 6735
205 Ga0111539_10139687 3300009094 Unclassified 2836
206 Ga0111539_10142657 3300009094 Bacteria 2804
207 Ga0105245_10006558 3300009098 Bacteria 10218
208 Ga0105245_10042365 3300009098 Bacteria 4062
209 Ga0105245_10100336 3300009098 Bacteria 2678
210 Ga0105247_10027869 3300009101 Bacteria 3416
211 Ga0105247_10218174 3300009101 Bacteria 1290
212 Ga0114129_10000796 3300009147 Bacteria 40446
213 Ga0114129_10009049 3300009147 Bacteria 14193
214 Ga0114129_10012911 3300009147 Bacteria 11885
215 Ga0114129_10066410 3300009147 Bacteria 5032
216 Ga0114129_10077282 3300009147 Bacteria 4631
217 Ga0105243_10029290 3300009148 Bacteria 4233
218 Ga0105241_10091945 3300009174 Bacteria 2395
219 Ga0105248_10000212 3300009177 Bacteria 67170
220 Ga0105248_10000511 3300009177 Bacteria 44011
221 Ga0105248_10001915 3300009177 Bacteria 23101
222 Ga0105248_10013372 3300009177 Bacteria 9033
223 Ga0105248_10014685 3300009177 Bacteria 8618
224 Ga0105248_10050139 3300009177 Bacteria 4681
225 Ga0105248_10202656 3300009177 Unclassified 2235
226 Ga0105248_10547059 3300009177 Bacteria 1306
227 Ga0105237_10006460 3300009545 Bacteria 13001
228 Ga0105237_10008797 3300009545 Bacteria 10889
229 Ga0105237_10119281 3300009545 Bacteria 2632
230 Ga0105238_10003466 3300009551 Bacteria 15696
231 Ga0105238_10008181 3300009551 Bacteria 10460
232 Ga0105238_10027385 3300009551 Bacteria 5807
233 Ga0105238_10052656 3300009551 Bacteria 4092
234 Ga0105238_10276606 3300009551 Unclassified 1660
235 Ga0105249_10245355 3300009553 Bacteria 1773
236 Ga0105239_10002868 3300010375 Bacteria 21560
237 Ga0105239_10015025 3300010375 Bacteria 8582
238 Ga0105239_10050596 3300010375 Bacteria 4557
239 Ga0105239_10106246 3300010375 Bacteria 3110
240 Ga0105246_10026373 3300011119 Bacteria 3796
241 Ga0157371_10016055 3300013102 Bacteria 5597
242 Ga0157370_10000946 3300013104 Bacteria 36859
243 Ga0157370_10032571 3300013104 Bacteria 5089
244 Ga0157369_10002207 3300013105 Bacteria 23452
245 Ga0157369_10016546 3300013105 Bacteria 8291
246 Ga0157369_10020523 3300013105 Bacteria 7386
247 Ga0157374_10021545 3300013296 Bacteria 5737
248 Ga0157374_10046687 3300013296 Bacteria 4012
249 Ga0157374_10300727 3300013296 Bacteria 1587
250 Ga0157378_10007018 3300013297 Bacteria 9829
251 Ga0163162_10005106 3300013306 Bacteria 12653
252 Ga0163162_10010902 3300013306 Bacteria 8849
253 Ga0163162_10224699 3300013306 Bacteria 2007
254 Ga0157372_10020183 3300013307 Bacteria 7185
255 Ga0157372_10020539 3300013307 Bacteria 7126
256 Ga0157372_10040051 3300013307 Bacteria 5174
257 Ga0157375_10000265 3300013308 Bacteria 47566
258 Ga0157375_10001336 3300013308 Bacteria 21253
259 Ga0157375_10010347 3300013308 Bacteria 8212
260 Ga0157375_10014300 3300013308 Bacteria 7075
261 Ga0157375_10262715 3300013308 Bacteria 1888
262 Ga0157375_10304518 3300013308 Unclassified 1757
263 Ga0157375_10412951 3300013308 Bacteria 1516
264 Ga0163163_10017826 3300014325 Bacteria 6627
265 Ga0163163_10036725 3300014325 Unclassified 4761
266 Ga0163163_10084724 3300014325 Bacteria 3176
267 Ga0163163_10099654 3300014325 Unclassified 2927
268 Ga0163163_10219391 3300014325 Bacteria 1950
269 Ga0157380_10020746 3300014326 Bacteria 4917
270 Ga0157380_10220326 3300014326 Bacteria 1697
271 Ga0157379_10000041 3300014968 Bacteria 78644
272 Ga0157379_10000414 3300014968 Bacteria 34654
273 Ga0157379_10542578 3300014968 Unclassified 1081
274 Ga0157376_10049591 3300014969 Bacteria 3478
275 Ga0157376_10480556 3300014969 Bacteria 1217
276 Ga0163161_10020341 3300017792 Unclassified 4657
277 Ga0163161_10264086 3300017792 Bacteria 1345
278 Ga0207710_10019346 3300025900 Bacteria 2905
279 Ga0207680_10018986 3300025903 Bacteria 3669
280 Ga0207699_10070363 3300025906 Unclassified 2136
281 Ga0207645_10101219 3300025907 Bacteria 1859
282 Ga0207654_10050242 3300025911 Bacteria 2395
283 Ga0207654_10134131 3300025911 Unclassified 1571
284 Ga0207707_10001181 3300025912 Bacteria 24586
285 Ga0207695_10008926 3300025913 Bacteria 12479
286 Ga0207695_10014789 3300025913 Bacteria 9220
287 Ga0207695_10254613 3300025913 Unclassified 1654
288 Ga0207671_10016000 3300025914 Bacteria 5846
289 Ga0207671_10029567 3300025914 Unclassified 4091
290 Ga0207671_10333469 3300025914 Bacteria 1201
291 Ga0207663_10117663 3300025916 Bacteria 1814
292 Ga0207657_10021795 3300025919 Bacteria 6019
293 Ga0207652_10020563 3300025921 Bacteria 5438
294 Ga0207646_10023827 3300025922 Bacteria 5617
295 Ga0207646_10042633 3300025922 Bacteria 4076
296 Ga0207646_10078815 3300025922 Unclassified 2945
297 Ga0207646_10318615 3300025922 Unclassified 1405
298 Ga0207681_10171432 3300025923 Unclassified 1645
299 Ga0207694_10001610 3300025924 Bacteria 19042
300 Ga0207694_10063967 3300025924 Bacteria 2866
301 Ga0207650_10007495 3300025925 Bacteria 7441
302 Ga0207650_10035701 3300025925 Bacteria 3612
303 Ga0207650_10058640 3300025925 Bacteria 2867
304 Ga0207659_10000149 3300025926 Bacteria 41113
305 Ga0207659_10001425 3300025926 Bacteria 14246
306 Ga0207659_10006021 3300025926 Bacteria 7398
307 Ga0207659_10115754 3300025926 Unclassified 2046
308 Ga0207659_10516209 3300025926 Bacteria 1013
309 Ga0207687_10002463 3300025927 Bacteria 12566
310 Ga0207687_10016738 3300025927 Bacteria 4820
311 Ga0207700_10002594 3300025928 Bacteria 10394
312 Ga0207700_10003418 3300025928 Bacteria 9223
313 Ga0207664_10037330 3300025929 Bacteria 3759
314 Ga0207664_10395219 3300025929 Unclassified 1229
315 Ga0207644_10014016 3300025931 Bacteria 5358
316 Ga0207644_10090011 3300025931 Bacteria 2285
317 Ga0207706_10065367 3300025933 Bacteria 3203
318 Ga0207706_10150863 3300025933 Bacteria 2044
319 Ga0207686_10021366 3300025934 Bacteria 3714
320 Ga0207709_10018819 3300025935 Bacteria 3873
321 Ga0207670_10011610 3300025936 Bacteria 5121
322 Ga0207691_10067645 3300025940 Bacteria 3230
323 Ga0207691_10123847 3300025940 Unclassified 2288
324 Ga0207711_10001894 3300025941 Bacteria 19053
325 Ga0207711_10005536 3300025941 Bacteria 10678
326 Ga0207711_10008411 3300025941 Bacteria 8630
327 Ga0207711_10217607 3300025941 Unclassified 1746
328 Ga0207689_10419871 3300025942 Unclassified 1116
329 Ga0207661_10025917 3300025944 Bacteria 4462
330 Ga0207661_10054908 3300025944 Bacteria 3192
331 Ga0207661_10087279 3300025944 Bacteria 2590
332 Ga0207679_10004811 3300025945 Bacteria 8414
333 Ga0207679_10020015 3300025945 Unclassified 4509
334 Ga0207679_10047128 3300025945 Bacteria 3129
335 Ga0207679_10396666 3300025945 Unclassified 1213
336 Ga0207667_10000800 3300025949 Bacteria 40825
337 Ga0207667_10015941 3300025949 Bacteria 8511
338 Ga0207667_10509284 3300025949 Unclassified 1220
339 Ga0207651_10003501 3300025960 Bacteria 7717
340 Ga0207651_10011821 3300025960 Unclassified 4903
341 Ga0207640_10051399 3300025981 Unclassified 2679
342 Ga0207658_10047174 3300025986 Unclassified 3151
343 Ga0207658_10049997 3300025986 Unclassified 3074
344 Ga0207677_10002810 3300026023 Bacteria 9183
345 Ga0207703_10032572 3300026035 Unclassified 4126
346 Ga0207703_10096301 3300026035 Bacteria 2498
347 Ga0207703_10119141 3300026035 Bacteria 2264
348 Ga0207703_10455892 3300026035 Unclassified 1195
349 Ga0207702_10047426 3300026078 Unclassified 3620
350 Ga0207702_10065943 3300026078 Bacteria 3102
351 Ga0207641_10000819 3300026088 Bacteria 33028
352 Ga0207641_10006123 3300026088 Bacteria 10180
353 Ga0207641_10055150 3300026088 Unclassified 3374
354 Ga0207648_10113254 3300026089 Bacteria 2382
355 Ga0207648_10364060 3300026089 Bacteria 1305
356 Ga0207676_10002761 3300026095 Bacteria 12486
357 Ga0207676_10117149 3300026095 Unclassified 2240
358 Ga0207676_10272885 3300026095 Unclassified 1532
359 Ga0207674_10002433 3300026116 Bacteria 23506
360 Ga0207674_10054819 3300026116 Bacteria 4057
361 Ga0207674_10167529 3300026116 Unclassified 2150
362 Ga0207675_100293670 3300026118 Bacteria 1581
363 Ga0207698_10274444 3300026142 Bacteria 1556
364 Ga0207428_10010373 3300027907 Bacteria 8328
365 Ga0268266_10341914 3300028379 Unclassified 1405
366 Ga0268264_10005613 3300028381 Bacteria 10627
367 Ga0268264_10021928 3300028381 Bacteria 5213
368 Ga0265331_10038562 3300031250 Bacteria 2335
369 Ga0265313_10001870 3300031595 Bacteria 19154
370 Ga0265314_10004161 3300031711 Bacteria 13607
371 Ga0265314_10022469 3300031711 Bacteria 4831
372 Ga0265342_10013118 3300031712 Bacteria 5575
373 Ga0373926_0003476 3300035083 Bacteria 5088
374 Ga0373934_0013218 3300035086 Unclassified 3119
375 Ga0373944_0012165 3300035089 Bacteria 2368
376 Ga0373923_0011213 3300035111 Unclassified 3282
377 Ga0373941_0024599 3300035115 Bacteria 1731
378 Ga0373953_0002851 3300035117 Bacteria 5271
379 Ga0373954_0006692 3300035118 Bacteria 5028
380 Ga0373954_0012682 3300035118 Unclassified 3750
381 Ga0373931_0068851 3300035691 Bacteria 1927
382 Ga0373935_0013153 3300035692 Unclassified 4989
383 Ga0373927_0231124 3300035695 Unclassified 1215
384 Ga0373933_0139739 3300035724 Bacteria 1529
385 Ga0373933_0270901 3300035724 Bacteria 1096
386 Ga0373933_0298677 3300035724 Unclassified 1042
387 Ga0373937_0003261 3300036401 Bacteria 13614
388 Ga0373937_0009455 3300036401 Bacteria 8473
389 Ga0373937_0025174 3300036401 Bacteria 5374
390 Ga0373937_0037708 3300036401 Unclassified 4405
391 Ga0373937_0090805 3300036401 Unclassified 2829
392 Ga0373937_0120640 3300036401 Unclassified 2443
393 Ga0373937_0150474 3300036401 Bacteria 2180
394 Ga0373937_0261091 3300036401 Unclassified 1633
395 Ga0373925_0098498 3300037068 Bacteria 2244
396 Ga0373925_0169926 3300037068 Bacteria 1721
397 Ga0436364_1151733 3300037853 Bacteria 9284
398 Ga0436365_0073611 3300039437 Bacteria 2889
399 Ga0451576_0004185 3300045051 Bacteria 18985
400 Ga0451576_0015184 3300045051 Bacteria 8544
401 Ga0451576_0179531 3300045051 Bacteria 2210
402 Ga0451576_0194301 3300045051 Bacteria 2120
403 Ga0495592_0003715 3300046454 Bacteria 10998
404 Ga0495592_0094399 3300046454 Unclassified 2141
405 Ga0495592_0094406 3300046454 Unclassified 2141
406 Ga0495629_0144485 3300046459 Bacteria 1655
407 Ga0495651_0000099 3300046462 Bacteria 63083
408 Ga0495653_0047222 3300046463 Unclassified 3331
409 Ga0495653_0135213 3300046463 Unclassified 1740
410 Ga0495580_0019731 3300046472 Bacteria 5005
411 Ga0495580_0031378 3300046472 Bacteria 3840
412 Ga0495580_0036527 3300046472 Unclassified 3527
413 Ga0495580_0084019 3300046472 Bacteria 2218
414 Ga0495580_0176746 3300046472 Unclassified 1475
415 Ga0495582_0195970 3300046473 Unclassified 1153
416 Ga0495664_0087611 3300046477 Unclassified 1871
417 Ga0495664_0191029 3300046477 Unclassified 1241
418 Ga0495664_0259425 3300046477 Bacteria 1051
419 Ga0495584_0012293 3300046491 Bacteria 4371
420 Ga0495594_0014378 3300046499 Bacteria 4146
421 Ga0495608_0003405 3300046511 Bacteria 11392
422 Ga0495618_0053368 3300046514 Unclassified 2556
423 Ga0495618_0243495 3300046514 Bacteria 1130
424 Ga0495628_0018658 3300046516 Bacteria 5742
425 Ga0495628_0029183 3300046516 Unclassified 4475
426 Ga0495630_0295191 3300046517 Unclassified 1238
427 Ga0495637_0124550 3300046520 Bacteria 989
428 Ga0495663_0014911 3300046525 Unclassified 2184
429 Ga0495663_0057310 3300046525 Bacteria 1219
430 Ga0495663_0065558 3300046525 Bacteria 1148
431 Ga0495666_0049909 3300046526 Unclassified 2012
432 Ga0495666_0093307 3300046526 Bacteria 1420
433 Ga0495642_0033604 3300046528 Bacteria 2062
434 Ga0495652_0029334 3300046529 Unclassified 4834
435 Ga0495665_0001199 3300046531 Bacteria 13813
436 Ga0495665_0024575 3300046531 Bacteria 3237
437 Ga0495586_0001550 3300046535 Bacteria 12688
438 Ga0495586_0012789 3300046535 Bacteria 4447
439 Ga0495587_0005988 3300046536 Bacteria 7928
440 Ga0495587_0037679 3300046536 Unclassified 2902
441 Ga0495598_0015437 3300046537 Bacteria 1929
442 Ga0495598_0017050 3300046537 Bacteria 1866
443 Ga0495609_0048595 3300046538 Bacteria 1896
444 Ga0495621_0000429 3300046539 Bacteria 10385
445 Ga0495621_0002084 3300046539 Bacteria 5297
446 Ga0495621_0062588 3300046539 Unclassified 1354
447 Ga0495667_0000705 3300046559 Bacteria 21415
448 Ga0495667_0008081 3300046559 Bacteria 7140
449 Ga0495667_0009592 3300046559 Unclassified 6564
450 Ga0495667_0059700 3300046559 Unclassified 2503
451 Ga0495634_0027068 3300046642 Bacteria 3994
452 Ga0495635_0039812 3300046663 Bacteria 3250
453 Ga0495659_0001322 3300046664 Bacteria 8513
454 Ga0495659_0003521 3300046664 Bacteria 4990
455 Ga0495659_0008775 3300046664 Unclassified 3217
456 Ga0495659_0020768 3300046664 Bacteria 2209
457 Ga0495588_0147157 3300046674 Bacteria 1245
458 Ga0495657_0004299 3300046675 Bacteria 11373
459 Ga0495599_0054465 3300046678 Bacteria 2506
460 Ga0495623_0001231 3300046679 Bacteria 17390
461 Ga0495646_0011931 3300046680 Bacteria 5526
462 Ga0495647_0063381 3300046681 Unclassified 1464
463 Ga0495658_0017651 3300046683 Unclassified 3692
464 Ga0495669_0030327 3300046684 Bacteria 2374
465 Ga0495613_0004436 3300046689 Bacteria 10513
466 Ga0495613_0006942 3300046689 Bacteria 8446
467 Ga0495624_0005543 3300046690 Bacteria 9083
468 Ga0495600_0097353 3300046809 Unclassified 1918
469 Ga0495600_0175801 3300046809 Unclassified 1380
470 Ga0495581_0042882 3300047315 Bacteria 2618
471 Ga0495581_0071745 3300047315 Bacteria 2004
472 Ga0495604_0002659 3300047317 Bacteria 14344
473 Ga0495604_0009300 3300047317 Bacteria 7781
474 Ga0495636_0019599 3300047318 Bacteria 2721
475 Ga0495636_0048807 3300047318 Bacteria 1769
476 Ga0495636_0061467 3300047318 Unclassified 1588
477 Ga0495674_0178883 3300047319 Unclassified 1767
478 Ga0495674_0478434 3300047319 Unclassified 998
479 Ga0495675_0001150 3300047444 Bacteria 16078
480 Ga0495675_0018604 3300047444 Bacteria 4410
481 Ga0495675_0066709 3300047444 Bacteria 2275
482 Ga0495675_0092029 3300047444 Unclassified 1903
483 Ga0495684_0009268 3300047471 Bacteria 7599
484 Ga0495602_0012048 3300048088 Bacteria 8913
485 Ga0495602_0047647 3300048088 Unclassified 3860
486 Ga0495614_0022632 3300048089 Unclassified 2711
487 Ga0496102_0312366 3300048905 Unclassified 1481
488 Ga0496115_0227613 3300048918 Bacteria 1538
489 Ga0501077_0029151 3300049593 Unclassified 3509
490 nmdc:mga05p37_18938_c1 3300050507 Bacteria 8324
491 nmdc:mga05p37_2143_c1 3300050507 Bacteria 23051
492 nmdc:mga05p37_268666_c1 3300050507 Bacteria 2039
493 nmdc:mga05p37_269950_c1 3300050507 Bacteria 2033
494 nmdc:mga05p37_32072_c1 3300050507 Bacteria 6424
495 nmdc:mga05p37_36701_c1 3300050507 Bacteria 6011
496 nmdc:mga05p37_503404_c1 3300050507 Bacteria 1389
497 nmdc:mga09592_413285_c1 3300050508 Unclassified 1166
498 nmdc:mga09592_70083_c1 3300050508 Bacteria 2975
499 nmdc:mga0qj67_132157_c1 3300050509 Bacteria 2022
500 nmdc:mga0qj67_72990_c1 3300050509 Bacteria 2741
501 nmdc:mga06r32_123043_c1 3300050510 Unclassified 2560
502 nmdc:mga06r32_183841_c1 3300050510 Bacteria 2077
503 nmdc:mga06r32_252332_c1 3300050510 Unclassified 1752
504 nmdc:mga08y16_38437_c1 3300050511 Bacteria 5025
505 nmdc:mga08y16_52674_c1 3300050511 Bacteria 4258
506 nmdc:mga0n895_136636_c1 3300050512 Bacteria 2478
507 nmdc:mga0n895_145840_c1 3300050512 Unclassified 2397
508 nmdc:mga0n895_192762_c1 3300050512 Unclassified 2069
509 nmdc:mga0n895_61724_c1 3300050512 Bacteria 3702
510 nmdc:mga0n895_98621_c1 3300050512 Bacteria 2929
511 nmdc:mga0rr50_223192_c1 3300050513 Bacteria 1557
512 nmdc:mga0rr50_28895_c1 3300050513 Bacteria 3903
513 nmdc:mga0rr50_7224_c2 3300050513 Bacteria 5220
514 nmdc:mga0a205_120939_c1 3300050515 Unclassified 2518
515 nmdc:mga0a205_155815_c1 3300050515 Bacteria 2183
516 nmdc:mga0a205_312738_c1 3300050515 Unclassified 1443
517 nmdc:mga0a205_67287_c1 3300050515 Bacteria 3461
518 nmdc:mga0a205_70659_c1 3300050515 Bacteria 3371
519 Ga0495612_0008870 3300053078 Unclassified 4073
520 Ga0495619_0094393 3300053085 Unclassified 2029
521 Ga0500568_0000749 3300053139 Bacteria 23216
522 Ga0500568_0032043 3300053139 Bacteria 2163
523 Ga0075428_100027920
524 Ga0070683_100068226
525 Ga0070683_100068666
526 Ga0070690_100153375
527 Ga0070670_100000419
528 Ga0070670_100076749
529 Ga0068869_100437950
530 Ga0070666_10083885
531 Ga0070666_10084797
532 Ga0070666_10171588
533 Ga0068868_100000775
534 Ga0068868_100241025
535 Ga0068868_100452269
536 Ga0070660_100212972
537 Ga0070689_100042658
538 Ga0070689_100056515
539 Ga0070689_100086462
540 Ga0070689_100086795
541 Ga0070691_10000667
542 Ga0070687_100085182
543 Ga0070661_100047111
544 Ga0070692_10043331
545 Ga0070669_100115116
546 Ga0070675_100000093
547 Ga0070675_100000173
548 Ga0070675_100000413
549 Ga0070675_100002006
550 Ga0070675_100104700
551 Ga0070675_100116588
552 Ga0070675_100194198
553 Ga0070671_100007337
554 Ga0070671_100009227
555 Ga0070671_100131888
556 Ga0070673_100003330
557 Ga0070673_100016284
558 Ga0070673_100069866
559 Ga0070673_100208615
560 Ga0070673_100463228
561 Ga0070688_100035372
562 Ga0070688_100050349
563 Ga0070667_100008037
564 Ga0070667_100008750
565 Ga0070667_100026133
566 Ga0070714_100006277
567 Ga0070713_100001089
568 Ga0070713_100002372
569 Ga0070713_100570711
570 Ga0070701_10148434
571 Ga0070701_10184963
572 Ga0070705_100002127
573 Ga0070705_100009312
574 Ga0070705_100026527
575 Ga0070705_100178953
576 Ga0070694_100000733
577 Ga0070694_100003516
578 Ga0070694_100018041
579 Ga0070694_100139408
580 Ga0070694_100187585
581 Ga0070708_100173867
582 Ga0070708_100253660
583 Ga0070678_100027943
584 Ga0070678_100067807
585 Ga0070662_100065442
586 Ga0070662_100233894
587 Ga0070681_10021472
588 Ga0068867_100249477
589 Ga0068867_100250579
590 Ga0070685_10036649
591 Ga0070707_100010061
592 Ga0070707_100047693
593 Ga0070707_100054382
594 Ga0070707_100207070
595 Ga0070698_100005682
596 Ga0070698_100007072
597 Ga0070698_100007846
598 Ga0070698_100032318
599 Ga0070698_100051432
600 Ga0070698_100247410
601 Ga0070699_100000583
602 Ga0070699_100001609
603 Ga0070699_100014311
604 Ga0070699_100063563
605 Ga0070699_100123113
606 Ga0070699_100132767
607 Ga0070699_100167805
608 Ga0070679_100008841
609 Ga0070684_100002037
610 Ga0070684_100019645
611 Ga0070684_100137399
612 Ga0070697_100056829
613 Ga0070697_100058190
614 Ga0068853_100031857
615 Ga0070672_100008033
616 Ga0070672_100070414
617 Ga0070695_100000219
618 Ga0070695_100016127
619 Ga0070695_100058796
620 Ga0070695_100102067
621 Ga0070696_100000188
622 Ga0070696_100002056
623 Ga0070696_100034651
624 Ga0070696_100036776
625 Ga0070696_100050702
626 Ga0070696_100062388
627 Ga0070696_100190908
628 Ga0070696_100252782
629 Ga0070693_100245459
630 Ga0070665_100267482
631 Ga0070704_100001156
632 Ga0070704_100013795
633 Ga0070704_100041241
634 Ga0070704_100047069
635 Ga0070704_100060078
636 Ga0070704_100098014
637 Ga0070704_100128331
638 Ga0070704_100163511
639 Ga0068855_100012187
640 Ga0068855_100062315
641 Ga0068855_100202062
642 Ga0070664_100000131
643 Ga0070664_100054501
644 Ga0070664_100386820
645 Ga0068857_100025506
646 Ga0068857_100095280
647 Ga0068854_100059834
648 Ga0068856_100003282
649 Ga0068856_100069252
650 Ga0068856_100106576
651 Ga0070702_100034512
652 Ga0070702_100039637
653 Ga0070702_100066804
654 Ga0068852_100003962
655 Ga0068852_100431126
656 Ga0068852_100451375
657 Ga0068859_100000161
658 Ga0068859_100001946
659 Ga0068859_100008877
660 Ga0068859_100069643
661 Ga0068859_100193541
662 Ga0068859_100199189
663 Ga0068864_100000280
664 Ga0068864_100069903
665 Ga0068864_100083081
666 Ga0068864_100120839
667 Ga0068864_100146670
668 Ga0068861_100218651
669 Ga0068851_10051145
670 Ga0068863_100001065
671 Ga0068863_100001626
672 Ga0068863_100038749
673 Ga0068863_100302376
674 Ga0068863_100560933
675 Ga0068858_100043953
676 Ga0068858_100056308
677 Ga0068858_100061214
678 Ga0068860_100001147
679 Ga0068860_100004829
680 Ga0068862_100123977
681 Ga0081455_10089287
682 Ga0097621_100005805
683 Ga0097621_100096950
684 Ga0097621_100116556
685 Ga0068871_100022259
686 Ga0068871_100024699
687 Ga0068871_100027085
688 Ga0068871_100238356
689 Ga0075428_100017747
690 Ga0075428_100055719
691 Ga0075428_100296256
692 Ga0075430_100028868
693 Ga0075430_100455915
694 Ga0075431_100007116
695 Ga0075431_100141063
696 Ga0075433_10102987
697 Ga0075433_10135805
698 Ga0075433_10138946
699 Ga0075433_10197243
700 Ga0075434_100003262
701 Ga0075434_100065012
702 Ga0075434_100171562
703 Ga0075434_100190595
704 Ga0075434_100201768
705 Ga0075434_100431223
706 Ga0075429_100068947
707 Ga0068865_100196496
708 Ga0075436_100178131
709 Ga0097620_100000161
710 Ga0097620_100001946
711 Ga0097620_100008878
712 Ga0097620_100069643
713 Ga0097620_100193539
714 Ga0097620_100199192
715 Ga0075435_100011219
716 Ga0075435_100034374
717 Ga0075435_100049738
718 Ga0075435_100188587
719 Ga0075435_100245108
720 Ga0099794_10035671
721 Ga0105240_10001609
722 Ga0105240_10010039
723 Ga0105240_10293034
724 Ga0105240_10481724
725 Ga0111539_10007902
726 Ga0111539_10029099
727 Ga0111539_10139687
728 Ga0111539_10142657
729 Ga0105245_10006558
730 Ga0105245_10042365
731 Ga0105245_10100336
732 Ga0105247_10027869
733 Ga0105247_10218174
734 Ga0114129_10000796
735 Ga0114129_10009049
736 Ga0114129_10012911
737 Ga0114129_10066410
738 Ga0114129_10077282
739 Ga0105243_10029290
740 Ga0105241_10091945
741 Ga0105248_10000212
742 Ga0105248_10000511
743 Ga0105248_10001915
744 Ga0105248_10013372
745 Ga0105248_10014685
746 Ga0105248_10050139
747 Ga0105248_10202656
748 Ga0105248_10547059
749 Ga0105237_10006460
750 Ga0105237_10008797
751 Ga0105237_10119281
752 Ga0105238_10003466
753 Ga0105238_10008181
754 Ga0105238_10027385
755 Ga0105238_10052656
756 Ga0105238_10276606
757 Ga0105249_10245355
758 Ga0105239_10002868
759 Ga0105239_10015025
760 Ga0105239_10050596
761 Ga0105239_10106246
762 Ga0105246_10026373
763 Ga0157371_10016055
764 Ga0157370_10000946
765 Ga0157370_10032571
766 Ga0157369_10002207
767 Ga0157369_10016546
768 Ga0157369_10020523
769 Ga0157374_10021545
770 Ga0157374_10046687
771 Ga0157374_10300727
772 Ga0157378_10007018
773 Ga0163162_10005106
774 Ga0163162_10010902
775 Ga0163162_10224699
776 Ga0157372_10020183
777 Ga0157372_10020539
778 Ga0157372_10040051
779 Ga0157375_10000265
780 Ga0157375_10001336
781 Ga0157375_10010347
782 Ga0157375_10014300
783 Ga0157375_10262715
784 Ga0157375_10304518
785 Ga0157375_10412951
786 Ga0163163_10017826
787 Ga0163163_10036725
788 Ga0163163_10084724
789 Ga0163163_10099654
790 Ga0163163_10219391
791 Ga0157380_10020746
792 Ga0157380_10220326
793 Ga0157379_10000041
794 Ga0157379_10000414
795 Ga0157379_10542578
796 Ga0157376_10049591
797 Ga0157376_10480556
798 Ga0163161_10020341
799 Ga0163161_10264086
800 Ga0207710_10019346
801 Ga0207680_10018986
802 Ga0207699_10070363
803 Ga0207645_10101219
804 Ga0207654_10050242
805 Ga0207654_10134131
806 Ga0207707_10001181
807 Ga0207695_10008926
808 Ga0207695_10014789
809 Ga0207695_10254613
810 Ga0207671_10016000
811 Ga0207671_10029567
812 Ga0207671_10333469
813 Ga0207663_10117663
814 Ga0207657_10021795
815 Ga0207652_10020563
816 Ga0207646_10023827
817 Ga0207646_10042633
818 Ga0207646_10078815
819 Ga0207646_10318615
820 Ga0207681_10171432
821 Ga0207694_10001610
822 Ga0207694_10063967
823 Ga0207650_10007495
824 Ga0207650_10035701
825 Ga0207650_10058640
826 Ga0207659_10000149
827 Ga0207659_10001425
828 Ga0207659_10006021
829 Ga0207659_10115754
830 Ga0207659_10516209
831 Ga0207687_10002463
832 Ga0207687_10016738
833 Ga0207700_10002594
834 Ga0207700_10003418
835 Ga0207664_10037330
836 Ga0207664_10395219
837 Ga0207644_10014016
838 Ga0207644_10090011
839 Ga0207706_10065367
840 Ga0207706_10150863
841 Ga0207686_10021366
842 Ga0207709_10018819
843 Ga0207670_10011610
844 Ga0207691_10067645
845 Ga0207691_10123847
846 Ga0207711_10001894
847 Ga0207711_10005536
848 Ga0207711_10008411
849 Ga0207711_10217607
850 Ga0207689_10419871
851 Ga0207661_10025917
852 Ga0207661_10054908
853 Ga0207661_10087279
854 Ga0207679_10004811
855 Ga0207679_10020015
856 Ga0207679_10047128
857 Ga0207679_10396666
858 Ga0207667_10000800
859 Ga0207667_10015941
860 Ga0207667_10509284
861 Ga0207651_10003501
862 Ga0207651_10011821
863 Ga0207640_10051399
864 Ga0207658_10047174
865 Ga0207658_10049997
866 Ga0207677_10002810
867 Ga0207703_10032572
868 Ga0207703_10096301
869 Ga0207703_10119141
870 Ga0207703_10455892
871 Ga0207702_10047426
872 Ga0207702_10065943
873 Ga0207641_10000819
874 Ga0207641_10006123
875 Ga0207641_10055150
876 Ga0207648_10113254
877 Ga0207648_10364060
878 Ga0207676_10002761
879 Ga0207676_10117149
880 Ga0207676_10272885
881 Ga0207674_10002433
882 Ga0207674_10054819
883 Ga0207674_10167529
884 Ga0207675_100293670
885 Ga0207698_10274444
886 Ga0207428_10010373
887 Ga0268266_10341914
888 Ga0268264_10005613
889 Ga0268264_10021928
890 Ga0265331_10038562
891 Ga0265313_10001870
892 Ga0265314_10004161
893 Ga0265314_10022469
894 Ga0265342_10013118
895 Ga0373926_0003476
896 Ga0373934_0013218
897 Ga0373944_0012165
898 Ga0373923_0011213
899 Ga0373941_0024599
900 Ga0373953_0002851
901 Ga0373954_0006692
902 Ga0373954_0012682
903 Ga0373931_0068851
904 Ga0373935_0013153
905 Ga0373927_0231124
906 Ga0373933_0139739
907 Ga0373933_0270901
908 Ga0373933_0298677
909 Ga0373937_0003261
910 Ga0373937_0009455
911 Ga0373937_0025174
912 Ga0373937_0037708
913 Ga0373937_0090805
914 Ga0373937_0120640
915 Ga0373937_0150474
916 Ga0373937_0261091
917 Ga0373925_0098498
918 Ga0373925_0169926
919 Ga0436364_1151733
920 Ga0436365_0073611
921 Ga0451576_0004185
922 Ga0451576_0015184
923 Ga0451576_0179531
924 Ga0451576_0194301
925 Ga0495592_0003715
926 Ga0495592_0094399
927 Ga0495592_0094406
928 Ga0495629_0144485
929 Ga0495651_0000099
930 Ga0495653_0047222
931 Ga0495653_0135213
932 Ga0495580_0019731
933 Ga0495580_0031378
934 Ga0495580_0036527
935 Ga0495580_0084019
936 Ga0495580_0176746
937 Ga0495582_0195970
938 Ga0495664_0087611
939 Ga0495664_0191029
940 Ga0495664_0259425
941 Ga0495584_0012293
942 Ga0495594_0014378
943 Ga0495608_0003405
944 Ga0495618_0053368
945 Ga0495618_0243495
946 Ga0495628_0018658
947 Ga0495628_0029183
948 Ga0495630_0295191
949 Ga0495637_0124550
950 Ga0495663_0014911
951 Ga0495663_0057310
952 Ga0495663_0065558
953 Ga0495666_0049909
954 Ga0495666_0093307
955 Ga0495642_0033604
956 Ga0495652_0029334
957 Ga0495665_0001199
958 Ga0495665_0024575
959 Ga0495586_0001550
960 Ga0495586_0012789
961 Ga0495587_0005988
962 Ga0495587_0037679
963 Ga0495598_0015437
964 Ga0495598_0017050
965 Ga0495609_0048595
966 Ga0495621_0000429
967 Ga0495621_0002084
968 Ga0495621_0062588
969 Ga0495667_0000705
970 Ga0495667_0008081
971 Ga0495667_0009592
972 Ga0495667_0059700
973 Ga0495634_0027068
974 Ga0495635_0039812
975 Ga0495659_0001322
976 Ga0495659_0003521
977 Ga0495659_0008775
978 Ga0495659_0020768
979 Ga0495588_0147157
980 Ga0495657_0004299
981 Ga0495599_0054465
982 Ga0495623_0001231
983 Ga0495646_0011931
984 Ga0495647_0063381
985 Ga0495658_0017651
986 Ga0495669_0030327
987 Ga0495613_0004436
988 Ga0495613_0006942
989 Ga0495624_0005543
990 Ga0495600_0097353
991 Ga0495600_0175801
992 Ga0495581_0042882
993 Ga0495581_0071745
994 Ga0495604_0002659
995 Ga0495604_0009300
996 Ga0495636_0019599
997 Ga0495636_0048807
998 Ga0495636_0061467
999 Ga0495674_0178883
1000 Ga0495674_0478434
1001 Ga0495675_0001150
1002 Ga0495675_0018604
1003 Ga0495675_0066709
1004 Ga0495675_0092029
1005 Ga0495684_0009268
1006 Ga0495602_0012048
1007 Ga0495602_0047647
1008 Ga0495614_0022632
1009 Ga0496102_0312366
1010 Ga0496115_0227613
1011 Ga0501077_0029151
1012 nmdc:mga05p37_18938_c1
1013 nmdc:mga05p37_2143_c1
1014 nmdc:mga05p37_268666_c1
1015 nmdc:mga05p37_269950_c1
1016 nmdc:mga05p37_32072_c1
1017 nmdc:mga05p37_36701_c1
1018 nmdc:mga05p37_503404_c1
1019 nmdc:mga09592_413285_c1
1020 nmdc:mga09592_70083_c1
1021 nmdc:mga0qj67_132157_c1
1022 nmdc:mga0qj67_72990_c1
1023 nmdc:mga06r32_123043_c1
1024 nmdc:mga06r32_183841_c1
1025 nmdc:mga06r32_252332_c1
1026 nmdc:mga08y16_38437_c1
1027 nmdc:mga08y16_52674_c1
1028 nmdc:mga0n895_136636_c1
1029 nmdc:mga0n895_145840_c1
1030 nmdc:mga0n895_192762_c1
1031 nmdc:mga0n895_61724_c1
1032 nmdc:mga0n895_98621_c1
1033 nmdc:mga0rr50_223192_c1
1034 nmdc:mga0rr50_28895_c1
1035 nmdc:mga0rr50_7224_c2
1036 nmdc:mga0a205_120939_c1
1037 nmdc:mga0a205_155815_c1
1038 nmdc:mga0a205_312738_c1
1039 nmdc:mga0a205_67287_c1
1040 nmdc:mga0a205_70659_c1
1041 Ga0495612_0008870
1042 Ga0495619_0094393
1043 Ga0500568_0000749
1044 Ga0500568_0032043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fp6-assembly11.cif.gz_V complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7884 222 243
5tz5-assembly1.cif.gz_B crystal structure of curk dehydratase h996f inactive mutant 0.7097 222 262
3kg9-assembly3.cif.gz_B dehydratase domain from curk module of curacin polyketide synthase 0.7069 222 262
5tz7-assembly1.cif.gz_B crystal structure of curk dehydratase d1169n inactive mutant 0.7052 222 262
7wkk-assembly1.cif.gz_f cryo-em structure of the ir subunit from x. laevis npc 0.6957 217 259
ID Description Score Start End Superfamily
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7358 217 244 2.60.40.200
af_Q2FZ56_72_189_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7152 222 261 3.10.129.10
af_P0ADU7_21_135_2.30.31.10 Mainly Beta;Roll;Transcriptional Co-activator pc4; Chain A;Transcriptional Coactivator Pc4; Chain A 0.7017 221 259 2.30.31.10
3nwzD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6992 222 259 3.10.129.10
af_Q12028_718_826_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6959 217 263 2.60.40.1230
ID Description Score Start End GO Terms
AF-A0A3D1IJC1-F1-model_v4 Uncharacterized protein 0.9374 158 276
AF-A0A1F2S872-F1-model_v4 Uncharacterized protein 0.9202 140 273
AF-A0A3D1IJC1-F1-model_v4 Uncharacterized protein 0.908 158 276
AF-A0A2V8I5A8-F1-model_v4 Uncharacterized protein 0.9064 160 270
AF-A0A2V8EJY4-F1-model_v4 Uncharacterized protein 0.9006 98 277

Map