F459918

General Info

Members Datasets Scaffolds Average Seq Length
530 211 1060 226

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100016421|Ga0070714_1000164215
Length 248
Sequence MTNTLHRFGDAESFRDDYVVFAIASKGKNDQDSLPKLRRFLQIAIEYKPVNLGDARHGGALRPSREMNPLSHWQRDMKPDFDAVIAGLDHPTTCAAVFDDRVKAEDFVKRIKEEDLGLSVNISTSIDGAEQCCHYAGIPRHSVGYSLGFEGHTEKLPNDRVMMLSTMCGHGMVSHQLARKMIDWVKEGRRTPAEAVTYMTRFCSCGVFNPARARRILEGAITSNEIARDFDNRSQAPDQPEDQANNKR

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.02
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 31.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100016421 3300005435 Bacteria 5977
2 Ga0058862_11914007 3300004803 Unclassified 846
3 Ga0065707_10316748 3300005295 Bacteria 974
4 Ga0070658_10424178 3300005327 Bacteria 1144
5 Ga0070676_10232177 3300005328 Bacteria 1223
6 Ga0070683_100168800 3300005329 Bacteria 2077
7 Ga0070670_100435711 3300005331 Bacteria 1160
8 Ga0070666_10000600 3300005335 Bacteria 21637
9 Ga0070680_100196004 3300005336 Bacteria 1703
10 Ga0068868_100013112 3300005338 Bacteria 6071
11 Ga0068868_100016610 3300005338 Bacteria 5472
12 Ga0068868_100033098 3300005338 Unclassified 3983
13 Ga0070660_100012224 3300005339 Bacteria 6128
14 Ga0070660_100021301 3300005339 Bacteria 4778
15 Ga0070660_100065351 3300005339 Bacteria 2831
16 Ga0070689_100055086 3300005340 Bacteria 3080
17 Ga0070689_100432902 3300005340 Bacteria 1117
18 Ga0070661_100155686 3300005344 Unclassified 1729
19 Ga0070661_100354131 3300005344 Unclassified 1152
20 Ga0070675_100168234 3300005354 Bacteria 1889
21 Ga0070671_100558867 3300005355 Bacteria 987
22 Ga0070688_100360738 3300005365 Bacteria 1066
23 Ga0070659_100220938 3300005366 Unclassified 1564
24 Ga0070659_100393293 3300005366 Unclassified 1169
25 Ga0070667_100022540 3300005367 Bacteria 5222
26 Ga0070667_100050155 3300005367 Bacteria 3517
27 Ga0070667_100331936 3300005367 Bacteria 1374
28 Ga0070667_100468739 3300005367 Bacteria 1152
29 Ga0070667_100512361 3300005367 Unclassified 1100
30 Ga0070703_10080714 3300005406 Bacteria 1107
31 Ga0070714_100000346 3300005435 Bacteria 34849
32 Ga0070714_100289876 3300005435 Unclassified 1523
33 Ga0070713_100000362 3300005436 Bacteria 29233
34 Ga0070710_10039894 3300005437 Unclassified 2585
35 Ga0070701_10049937 3300005438 Bacteria 2164
36 Ga0070711_100001935 3300005439 Bacteria 11598
37 Ga0070711_100244345 3300005439 Bacteria 1405
38 Ga0070705_100056085 3300005440 Bacteria 2319
39 Ga0070708_100125904 3300005445 Bacteria 2368
40 Ga0070662_100630736 3300005457 Unclassified 903
41 Ga0070681_10019341 3300005458 Bacteria 6816
42 Ga0070681_10031100 3300005458 Bacteria 5357
43 Ga0070681_10069262 3300005458 Bacteria 3495
44 Ga0070681_10096109 3300005458 Unclassified 2911
45 Ga0068867_100009879 3300005459 Bacteria 6725
46 Ga0070706_100001255 3300005467 Bacteria 27151
47 Ga0070707_100028996 3300005468 Bacteria 5269
48 Ga0070707_100078587 3300005468 Unclassified 3183
49 Ga0070707_100292045 3300005468 Unclassified 1584
50 Ga0070699_100119590 3300005518 Bacteria 2316
51 Ga0070699_100193509 3300005518 Bacteria 1807
52 Ga0070679_100080397 3300005530 Bacteria 3249
53 Ga0070679_100125671 3300005530 Unclassified 2547
54 Ga0070684_100095781 3300005535 Unclassified 2645
55 Ga0070684_100206819 3300005535 Bacteria 1789
56 Ga0070684_100504823 3300005535 Bacteria 1120
57 Ga0070697_100002150 3300005536 Bacteria 15090
58 Ga0068853_100503520 3300005539 Unclassified 1143
59 Ga0068853_100510088 3300005539 Bacteria 1136
60 Ga0070672_100024017 3300005543 Bacteria 4498
61 Ga0070672_100328343 3300005543 Unclassified 1301
62 Ga0070672_100786877 3300005543 Bacteria 836
63 Ga0070686_100079035 3300005544 Bacteria 2174
64 Ga0070665_100064598 3300005548 Bacteria 3671
65 Ga0070665_100166683 3300005548 Unclassified 2205
66 Ga0070665_100535222 3300005548 Bacteria 1183
67 Ga0070665_100729286 3300005548 Unclassified 1004
68 Ga0070665_100799288 3300005548 Bacteria 956
69 Ga0070704_100037152 3300005549 Bacteria 3325
70 Ga0068855_100078678 3300005563 Unclassified 3825
71 Ga0068855_100110995 3300005563 Unclassified 3148
72 Ga0068855_100348561 3300005563 Unclassified 1631
73 Ga0068855_100399323 3300005563 Unclassified 1507
74 Ga0068855_100490286 3300005563 Bacteria 1337
75 Ga0068855_100509846 3300005563 Bacteria 1306
76 Ga0070664_100088616 3300005564 Bacteria 2676
77 Ga0070664_100108029 3300005564 Bacteria 2426
78 Ga0070664_100426765 3300005564 Unclassified 1215
79 Ga0068857_100005968 3300005577 Bacteria 10406
80 Ga0068857_100058106 3300005577 Unclassified 3434
81 Ga0068854_100034014 3300005578 Unclassified 3557
82 Ga0068856_100001322 3300005614 Bacteria 26103
83 Ga0068856_100007250 3300005614 Bacteria 10817
84 Ga0068856_100014314 3300005614 Bacteria 7672
85 Ga0068856_100070738 3300005614 Unclassified 3452
86 Ga0068856_100098498 3300005614 Bacteria 2914
87 Ga0068856_100157205 3300005614 Unclassified 2284
88 Ga0068856_100307643 3300005614 Unclassified 1602
89 Ga0068852_100107500 3300005616 Unclassified 2531
90 Ga0068852_100263379 3300005616 Unclassified 1656
91 Ga0068859_100005624 3300005617 Bacteria 12774
92 Ga0068859_100029634 3300005617 Bacteria 5492
93 Ga0068859_100113598 3300005617 Bacteria 2772
94 Ga0068859_100261132 3300005617 Unclassified 1823
95 Ga0068859_100860035 3300005617 Unclassified 993
96 Ga0068864_100018005 3300005618 Bacteria 5895
97 Ga0068864_100476952 3300005618 Bacteria 1197
98 Ga0068864_100502345 3300005618 Bacteria 1167
99 Ga0068866_10004248 3300005718 Bacteria 5882
100 Ga0068866_10069534 3300005718 Unclassified 1855
101 Ga0068861_100143723 3300005719 Bacteria 1950
102 Ga0068863_100006016 3300005841 Bacteria 11898
103 Ga0068863_100038986 3300005841 Bacteria 4521
104 Ga0068863_100094201 3300005841 Unclassified 2842
105 Ga0068863_100115271 3300005841 Bacteria 2560
106 Ga0068858_100003398 3300005842 Bacteria 15829
107 Ga0068858_100008861 3300005842 Bacteria 9645
108 Ga0068858_100010130 3300005842 Bacteria 8948
109 Ga0068858_100699109 3300005842 Unclassified 987
110 Ga0068858_100772469 3300005842 Bacteria 937
111 Ga0068860_100034301 3300005843 Bacteria 4867
112 Ga0068860_100205633 3300005843 Unclassified 1909
113 Ga0068862_100683882 3300005844 Bacteria 992
114 Ga0081455_10007914 3300005937 Bacteria 11125
115 Ga0081455_10011823 3300005937 Bacteria 8741
116 Ga0081455_10301049 3300005937 Unclassified 1150
117 Ga0081540_1090788 3300005983 Bacteria 1344
118 Ga0070717_10090892 3300006028 Bacteria 2577
119 Ga0070717_10094429 3300006028 Bacteria 2530
120 Ga0070716_100027411 3300006173 Bacteria 3061
121 Ga0070716_100034360 3300006173 Bacteria 2780
122 Ga0070712_100000126 3300006175 Bacteria 40420
123 Ga0070712_100329186 3300006175 Bacteria 1244
124 Ga0070712_100499763 3300006175 Bacteria 1019
125 Ga0070712_100524504 3300006175 Unclassified 995
126 Ga0097621_100001183 3300006237 Bacteria 18091
127 Ga0097621_100044344 3300006237 Unclassified 3588
128 Ga0097621_100081920 3300006237 Unclassified 2686
129 Ga0097621_100087397 3300006237 Unclassified 2603
130 Ga0097621_100110053 3300006237 Bacteria 2327
131 Ga0068871_100002620 3300006358 Bacteria 12281
132 Ga0068871_100008279 3300006358 Bacteria 7473
133 Ga0068871_100020028 3300006358 Bacteria 5119
134 Ga0068871_100023967 3300006358 Bacteria 4728
135 Ga0068871_100193277 3300006358 Bacteria 1754
136 Ga0068871_100293170 3300006358 Unclassified 1426
137 Ga0068871_100449906 3300006358 Bacteria 1154
138 Ga0075428_100064170 3300006844 Bacteria 4021
139 Ga0075428_100425350 3300006844 Bacteria 1423
140 Ga0075428_100532296 3300006844 Bacteria 1256
141 Ga0075428_100588623 3300006844 Unclassified 1188
142 Ga0075430_100200516 3300006846 Unclassified 1657
143 Ga0075430_100310420 3300006846 Bacteria 1304
144 Ga0075431_100034997 3300006847 Bacteria 5173
145 Ga0075431_100078586 3300006847 Bacteria 3406
146 Ga0075431_100129454 3300006847 Unclassified 2604
147 Ga0075431_100173170 3300006847 Unclassified 2217
148 Ga0075433_10030886 3300006852 Bacteria 4574
149 Ga0075434_100097072 3300006871 Bacteria 2952
150 Ga0068865_100006954 3300006881 Bacteria 6939
151 Ga0075436_100016054 3300006914 Bacteria 5127
152 Ga0075436_100307372 3300006914 Unclassified 1137
153 Ga0075436_100399858 3300006914 Bacteria 995
154 Ga0097620_100005624 3300006931 Bacteria 12774
155 Ga0097620_100029635 3300006931 Bacteria 5492
156 Ga0097620_100113596 3300006931 Bacteria 2772
157 Ga0097620_100261135 3300006931 Unclassified 1823
158 Ga0097620_100860055 3300006931 Unclassified 993
159 Ga0075435_100371627 3300007076 Bacteria 1227
160 Ga0075435_100881632 3300007076 Unclassified 780
161 Ga0105240_10000808 3300009093 Bacteria 56804
162 Ga0105240_10002182 3300009093 Bacteria 31961
163 Ga0105240_10002475 3300009093 Bacteria 29688
164 Ga0105240_10024483 3300009093 Bacteria 7954
165 Ga0105240_10037065 3300009093 Bacteria 6268
166 Ga0105240_10087848 3300009093 Bacteria 3806
167 Ga0105240_10128451 3300009093 Unclassified 3043
168 Ga0105240_10153171 3300009093 Unclassified 2744
169 Ga0105240_10264011 3300009093 Bacteria 1985
170 Ga0111539_10171927 3300009094 Bacteria 2531
171 Ga0111539_10209189 3300009094 Unclassified 2273
172 Ga0111539_10268344 3300009094 Bacteria 1987
173 Ga0105245_10002191 3300009098 Bacteria 17702
174 Ga0105245_10003761 3300009098 Bacteria 13510
175 Ga0105245_10086761 3300009098 Bacteria 2871
176 Ga0105247_10140766 3300009101 Bacteria 1581
177 Ga0114129_10003069 3300009147 Bacteria 23429
178 Ga0114129_10016006 3300009147 Bacteria 10667
179 Ga0114129_10264792 3300009147 Unclassified 2302
180 Ga0114129_10306051 3300009147 Bacteria 2117
181 Ga0114129_10674007 3300009147 Bacteria 1332
182 Ga0114129_10719238 3300009147 Bacteria 1281
183 Ga0114129_11036378 3300009147 Unclassified 1031
184 Ga0105241_10008427 3300009174 Bacteria 7580
185 Ga0105241_10010295 3300009174 Bacteria 6865
186 Ga0105241_10016313 3300009174 Bacteria 5445
187 Ga0105241_10039359 3300009174 Bacteria 3566
188 Ga0105241_10317180 3300009174 Bacteria 1343
189 Ga0105241_10387620 3300009174 Unclassified 1223
190 Ga0105241_10399457 3300009174 Unclassified 1205
191 Ga0105241_10651913 3300009174 Bacteria 956
192 Ga0105242_10019509 3300009176 Bacteria 5313
193 Ga0105242_10023294 3300009176 Unclassified 4880
194 Ga0105242_10057629 3300009176 Unclassified 3182
195 Ga0105242_10067103 3300009176 Unclassified 2965
196 Ga0105242_10110469 3300009176 Bacteria 2342
197 Ga0105248_10002391 3300009177 Bacteria 20843
198 Ga0105248_10013197 3300009177 Bacteria 9096
199 Ga0105248_10070867 3300009177 Unclassified 3914
200 Ga0105248_10366003 3300009177 Bacteria 1623
201 Ga0105248_10429288 3300009177 Unclassified 1488
202 Ga0105248_11361989 3300009177 Unclassified 803
203 Ga0105237_10003726 3300009545 Bacteria 17950
204 Ga0105237_10005161 3300009545 Bacteria 14779
205 Ga0105237_10011387 3300009545 Bacteria 9408
206 Ga0105237_10048328 3300009545 Unclassified 4277
207 Ga0105237_10057274 3300009545 Bacteria 3900
208 Ga0105237_10076734 3300009545 Bacteria 3332
209 Ga0105237_10086842 3300009545 Unclassified 3118
210 Ga0105238_10035519 3300009551 Bacteria 5067
211 Ga0105238_10132458 3300009551 Bacteria 2471
212 Ga0105238_10190793 3300009551 Bacteria 2025
213 Ga0105238_10223243 3300009551 Bacteria 1860
214 Ga0105238_10229987 3300009551 Bacteria 1831
215 Ga0105238_10563312 3300009551 Bacteria 1145
216 Ga0105238_11044071 3300009551 Unclassified 839
217 Ga0105249_10038284 3300009553 Bacteria 4351
218 Ga0105249_10228350 3300009553 Bacteria 1835
219 Ga0105249_10593695 3300009553 Unclassified 1161
220 Ga0099796_10135462 3300010159 Unclassified 958
221 Ga0105239_10005941 3300010375 Bacteria 14207
222 Ga0105239_10013477 3300010375 Bacteria 9079
223 Ga0105239_10013678 3300010375 Bacteria 9011
224 Ga0105239_10028788 3300010375 Bacteria 6109
225 Ga0105239_10065904 3300010375 Bacteria 3979
226 Ga0105239_10329142 3300010375 Bacteria 1723
227 Ga0105239_11264550 3300010375 Bacteria 851
228 Ga0105246_10064515 3300011119 Unclassified 2559
229 Ga0105246_10089267 3300011119 Unclassified 2217
230 Ga0157373_10001176 3300013100 Bacteria 20026
231 Ga0157371_10013252 3300013102 Bacteria 6273
232 Ga0157370_10004592 3300013104 Bacteria 15804
233 Ga0157370_10015779 3300013104 Bacteria 7667
234 Ga0157370_10173315 3300013104 Bacteria 2005
235 Ga0157370_10228841 3300013104 Bacteria 1721
236 Ga0157370_10304547 3300013104 Unclassified 1471
237 Ga0157369_10003508 3300013105 Bacteria 18633
238 Ga0157369_10008320 3300013105 Bacteria 11891
239 Ga0157369_10023308 3300013105 Bacteria 6895
240 Ga0157369_10040308 3300013105 Bacteria 5098
241 Ga0157369_10050859 3300013105 Bacteria 4486
242 Ga0157369_10180968 3300013105 Bacteria 2218
243 Ga0157369_10189982 3300013105 Bacteria 2158
244 Ga0157369_10223288 3300013105 Unclassified 1971
245 Ga0157369_10583936 3300013105 Unclassified 1154
246 Ga0157374_10000328 3300013296 Bacteria 43754
247 Ga0157374_10010577 3300013296 Bacteria 7942
248 Ga0157374_10012640 3300013296 Bacteria 7351
249 Ga0157374_10031771 3300013296 Unclassified 4802
250 Ga0157374_10031817 3300013296 Unclassified 4799
251 Ga0157374_10136673 3300013296 Unclassified 2377
252 Ga0157374_10193354 3300013296 Bacteria 1990
253 Ga0157374_10342081 3300013296 Bacteria 1485
254 Ga0157378_10003115 3300013297 Bacteria 14741
255 Ga0157378_10012251 3300013297 Bacteria 7508
256 Ga0157378_10016241 3300013297 Bacteria 6519
257 Ga0157378_10109898 3300013297 Bacteria 2526
258 Ga0157378_10175076 3300013297 Bacteria 2015
259 Ga0157378_10376342 3300013297 Bacteria 1393
260 Ga0157378_10638471 3300013297 Bacteria 1079
261 Ga0157378_10703402 3300013297 Unclassified 1030
262 Ga0163162_10002759 3300013306 Bacteria 16685
263 Ga0163162_10008743 3300013306 Bacteria 9851
264 Ga0163162_11281871 3300013306 Unclassified 832
265 Ga0157372_10000391 3300013307 Bacteria 48523
266 Ga0157372_10010458 3300013307 Bacteria 9873
267 Ga0157372_10021286 3300013307 Bacteria 7004
268 Ga0157372_10027663 3300013307 Bacteria 6179
269 Ga0157372_10461301 3300013307 Unclassified 1481
270 Ga0157372_10671477 3300013307 Unclassified 1206
271 Ga0157372_11470733 3300013307 Bacteria 785
272 Ga0157375_10000473 3300013308 Bacteria 36686
273 Ga0157375_10549021 3300013308 Unclassified 1317
274 Ga0157375_11301978 3300013308 Unclassified 854
275 Ga0163163_10002231 3300014325 Bacteria 16310
276 Ga0163163_10014464 3300014325 Bacteria 7253
277 Ga0163163_10026827 3300014325 Bacteria 5510
278 Ga0163163_10295401 3300014325 Bacteria 1672
279 Ga0157379_10023163 3300014968 Bacteria 5507
280 Ga0157379_10042657 3300014968 Bacteria 4051
281 Ga0157379_10091184 3300014968 Unclassified 2734
282 Ga0157376_10044557 3300014969 Unclassified 3648
283 Ga0157376_10062616 3300014969 Unclassified 3131
284 Ga0157376_10080996 3300014969 Bacteria 2786
285 Ga0157376_10173479 3300014969 Bacteria 1965
286 Ga0157376_10200300 3300014969 Bacteria 1836
287 Ga0157376_10391497 3300014969 Unclassified 1341
288 Ga0228598_1000833 3300024227 Bacteria 6661
289 Ga0207710_10274638 3300025900 Unclassified 847
290 Ga0207680_10022092 3300025903 Unclassified 3455
291 Ga0207680_10486610 3300025903 Unclassified 878
292 Ga0207647_10072997 3300025904 Bacteria 2068
293 Ga0207685_10287153 3300025905 Bacteria 809
294 Ga0207699_10030394 3300025906 Bacteria 3022
295 Ga0207699_10272315 3300025906 Bacteria 1174
296 Ga0207699_10353985 3300025906 Bacteria 1037
297 Ga0207645_10176655 3300025907 Bacteria 1400
298 Ga0207645_10316780 3300025907 Bacteria 1040
299 Ga0207705_10191863 3300025909 Unclassified 1545
300 Ga0207684_10018517 3300025910 Bacteria 5961
301 Ga0207684_10391441 3300025910 Unclassified 1195
302 Ga0207654_10006133 3300025911 Bacteria 6038
303 Ga0207654_10006396 3300025911 Bacteria 5927
304 Ga0207654_10023048 3300025911 Bacteria 3330
305 Ga0207654_10052809 3300025911 Unclassified 2344
306 Ga0207654_10325708 3300025911 Unclassified 1051
307 Ga0207707_10008555 3300025912 Bacteria 8872
308 Ga0207707_10076362 3300025912 Bacteria 2924
309 Ga0207707_10313675 3300025912 Unclassified 1355
310 Ga0207695_10001883 3300025913 Bacteria 32807
311 Ga0207695_10004408 3300025913 Bacteria 19238
312 Ga0207695_10011866 3300025913 Bacteria 10505
313 Ga0207695_10024785 3300025913 Bacteria 6736
314 Ga0207695_10163996 3300025913 Bacteria 2151
315 Ga0207695_10172428 3300025913 Unclassified 2088
316 Ga0207695_10174137 3300025913 Bacteria 2075
317 Ga0207695_10174200 3300025913 Bacteria 2075
318 Ga0207695_10176314 3300025913 Bacteria 2060
319 Ga0207695_10201648 3300025913 Bacteria 1903
320 Ga0207671_10027250 3300025914 Unclassified 4272
321 Ga0207671_10030849 3300025914 Unclassified 3996
322 Ga0207671_10193753 3300025914 Bacteria 1585
323 Ga0207671_10317881 3300025914 Bacteria 1232
324 Ga0207693_10000102 3300025915 Bacteria 76687
325 Ga0207693_10244561 3300025915 Bacteria 1408
326 Ga0207663_10172753 3300025916 Bacteria 1536
327 Ga0207660_10014761 3300025917 Bacteria 5147
328 Ga0207660_10298860 3300025917 Unclassified 1282
329 Ga0207657_10008054 3300025919 Bacteria 10745
330 Ga0207657_10085642 3300025919 Bacteria 2639
331 Ga0207657_10294188 3300025919 Bacteria 1287
332 Ga0207652_10040483 3300025921 Bacteria 3958
333 Ga0207646_10001514 3300025922 Bacteria 28621
334 Ga0207646_10088730 3300025922 Bacteria 2767
335 Ga0207646_10153209 3300025922 Bacteria 2079
336 Ga0207681_10173865 3300025923 Unclassified 1635
337 Ga0207694_10016634 3300025924 Bacteria 5557
338 Ga0207694_10044866 3300025924 Bacteria 3413
339 Ga0207694_10288784 3300025924 Bacteria 1349
340 Ga0207650_10182947 3300025925 Unclassified 1671
341 Ga0207687_10002727 3300025927 Bacteria 11957
342 Ga0207687_10026201 3300025927 Unclassified 3902
343 Ga0207687_10083292 3300025927 Bacteria 2315
344 Ga0207687_10123638 3300025927 Bacteria 1939
345 Ga0207687_10191514 3300025927 Bacteria 1592
346 Ga0207700_10000693 3300025928 Bacteria 19604
347 Ga0207700_10014540 3300025928 Bacteria 5159
348 Ga0207664_10000333 3300025929 Bacteria 34825
349 Ga0207664_10012556 3300025929 Bacteria 6061
350 Ga0207644_10040328 3300025931 Bacteria 3300
351 Ga0207690_10186491 3300025932 Unclassified 1566
352 Ga0207690_10199109 3300025932 Bacteria 1520
353 Ga0207706_10537610 3300025933 Unclassified 1007
354 Ga0207686_10021028 3300025934 Unclassified 3738
355 Ga0207686_10053534 3300025934 Bacteria 2523
356 Ga0207686_10100523 3300025934 Bacteria 1930
357 Ga0207686_10130690 3300025934 Unclassified 1722
358 Ga0207670_10124099 3300025936 Bacteria 1882
359 Ga0207670_10429419 3300025936 Unclassified 1062
360 Ga0207704_10013355 3300025938 Unclassified 4108
361 Ga0207665_10116851 3300025939 Bacteria 1880
362 Ga0207665_10116973 3300025939 Bacteria 1880
363 Ga0207665_10206510 3300025939 Unclassified 1433
364 Ga0207691_10184855 3300025940 Unclassified 1820
365 Ga0207711_10013616 3300025941 Bacteria 6757
366 Ga0207711_10376101 3300025941 Unclassified 1318
367 Ga0207711_10573183 3300025941 Bacteria 1053
368 Ga0207711_10705764 3300025941 Unclassified 941
369 Ga0207661_10110180 3300025944 Unclassified 2327
370 Ga0207679_10053691 3300025945 Unclassified 2963
371 Ga0207679_10063059 3300025945 Bacteria 2765
372 Ga0207679_10199968 3300025945 Bacteria 1668
373 Ga0207679_10248858 3300025945 Bacteria 1510
374 Ga0207679_10619674 3300025945 Unclassified 976
375 Ga0207667_10010565 3300025949 Bacteria 10786
376 Ga0207667_10011899 3300025949 Bacteria 10078
377 Ga0207667_10146688 3300025949 Bacteria 2429
378 Ga0207667_10160969 3300025949 Bacteria 2309
379 Ga0207667_10557295 3300025949 Bacteria 1159
380 Ga0207651_10271010 3300025960 Bacteria 1398
381 Ga0207712_10075963 3300025961 Unclassified 2430
382 Ga0207640_10019315 3300025981 Unclassified 4024
383 Ga0207658_10010686 3300025986 Bacteria 6239
384 Ga0207658_10136744 3300025986 Bacteria 1977
385 Ga0207658_10161841 3300025986 Bacteria 1835
386 Ga0207658_10266259 3300025986 Bacteria 1463
387 Ga0207658_10825377 3300025986 Unclassified 842
388 Ga0207677_10019914 3300026023 Unclassified 4062
389 Ga0207677_10174300 3300026023 Bacteria 1685
390 Ga0207677_10252738 3300026023 Bacteria 1432
391 Ga0207677_10408862 3300026023 Bacteria 1153
392 Ga0207677_10455854 3300026023 Bacteria 1097
393 Ga0207703_10002598 3300026035 Bacteria 15588
394 Ga0207703_10013805 3300026035 Bacteria 6295
395 Ga0207703_10295868 3300026035 Bacteria 1475
396 Ga0207703_10409990 3300026035 Unclassified 1259
397 Ga0207703_10530492 3300026035 Bacteria 1108
398 Ga0207639_10040855 3300026041 Unclassified 3465
399 Ga0207678_10627977 3300026067 Bacteria 943
400 Ga0207702_10001519 3300026078 Bacteria 22951
401 Ga0207702_10050643 3300026078 Unclassified 3507
402 Ga0207702_10241533 3300026078 Bacteria 1692
403 Ga0207702_10299154 3300026078 Unclassified 1527
404 Ga0207641_10014861 3300026088 Bacteria 6382
405 Ga0207641_10054907 3300026088 Unclassified 3382
406 Ga0207641_10058630 3300026088 Bacteria 3277
407 Ga0207641_10104658 3300026088 Bacteria 2499
408 Ga0207648_10019395 3300026089 Bacteria 6138
409 Ga0207648_10647847 3300026089 Unclassified 976
410 Ga0207676_10111783 3300026095 Unclassified 2287
411 Ga0207676_10307013 3300026095 Bacteria 1451
412 Ga0207676_10373188 3300026095 Bacteria 1326
413 Ga0207676_10508211 3300026095 Bacteria 1145
414 Ga0207674_10004333 3300026116 Bacteria 17118
415 Ga0207674_10010487 3300026116 Bacteria 10490
416 Ga0207674_10023395 3300026116 Bacteria 6619
417 Ga0207675_100060942 3300026118 Unclassified 3522
418 Ga0207675_100282174 3300026118 Bacteria 1614
419 Ga0207683_10196776 3300026121 Unclassified 1831
420 Ga0207698_10016779 3300026142 Unclassified 4948
421 Ga0207698_10842530 3300026142 Bacteria 921
422 Ga0207428_10006462 3300027907 Bacteria 10821
423 Ga0207428_10153162 3300027907 Bacteria 1754
424 Ga0265356_1000116 3300028017 Bacteria 13835
425 Ga0268266_10014272 3300028379 Bacteria 6832
426 Ga0268266_10029997 3300028379 Bacteria 4622
427 Ga0268266_10467177 3300028379 Unclassified 1201
428 Ga0268266_10739055 3300028379 Bacteria 949
429 Ga0268266_10775077 3300028379 Unclassified 926
430 Ga0268265_10056886 3300028380 Unclassified 2978
431 Ga0268265_10092292 3300028380 Bacteria 2423
432 Ga0268264_10009448 3300028381 Bacteria 8075
433 Ga0268264_10010570 3300028381 Bacteria 7631
434 Ga0268264_10582008 3300028381 Unclassified 1101
435 Ga0265762_1001072 3300030760 Unclassified 4922
436 Ga0265760_10000024 3300031090 Bacteria 66666
437 Ga0265314_10000582 3300031711 Bacteria 45932
438 Ga0373929_0036097 3300035085 Unclassified 1079
439 Ga0373944_0083151 3300035089 Unclassified 1060
440 Ga0373923_0039131 3300035111 Unclassified 1946
441 Ga0373941_0044885 3300035115 Bacteria 1381
442 Ga0373943_0108715 3300035170 Bacteria 1460
443 Ga0373946_0070309 3300035171 Unclassified 1510
444 Ga0373931_0020546 3300035691 Unclassified 3305
445 Ga0373935_0065550 3300035692 Bacteria 2331
446 Ga0373935_0091838 3300035692 Unclassified 1989
447 Ga0373935_0188285 3300035692 Unclassified 1420
448 Ga0373927_0003526 3300035695 Bacteria 11197
449 Ga0373927_0043850 3300035695 Unclassified 2895
450 Ga0373927_0179959 3300035695 Bacteria 1387
451 Ga0373927_0202430 3300035695 Bacteria 1304
452 Ga0373927_0612563 3300035695 Bacteria 720
453 Ga0373947_0000466 3300035725 Bacteria 23099
454 Ga0373947_0007099 3300035725 Bacteria 6495
455 Ga0373937_0009467 3300036401 Bacteria 8469
456 Ga0373937_0256413 3300036401 Bacteria 1649
457 Ga0373937_0929200 3300036401 Unclassified 819
458 Ga0373925_0000446 3300037068 Bacteria 41723
459 Ga0373925_0037601 3300037068 Unclassified 3574
460 Ga0373925_0083212 3300037068 Unclassified 2437
461 Ga0436365_1124698 3300039437 Unclassified 3722
462 Ga0436365_1371246 3300039437 Unclassified 2172
463 Ga0453683_0007067 3300044673 Bacteria 7648
464 Ga0466959_0162629 3300045049 Unclassified 1569
465 Ga0451576_0106582 3300045051 Bacteria 2916
466 Ga0451576_0425282 3300045051 Unclassified 1394
467 Ga0451576_0790285 3300045051 Bacteria 997
468 Ga0466958_0347020 3300045836 Unclassified 955
469 Ga0495651_0131575 3300046462 Bacteria 1826
470 Ga0495580_0049612 3300046472 Bacteria 2970
471 Ga0495580_0075652 3300046472 Bacteria 2349
472 Ga0495580_0182270 3300046472 Bacteria 1450
473 Ga0495580_0230268 3300046472 Unclassified 1272
474 Ga0495582_0163191 3300046473 Unclassified 1268
475 Ga0495594_0204933 3300046499 Bacteria 1124
476 Ga0495628_0226381 3300046516 Bacteria 1403
477 Ga0495658_0339351 3300046683 Bacteria 954
478 Ga0495613_0181226 3300046689 Bacteria 1492
479 Ga0495674_0119667 3300047319 Bacteria 2225
480 Ga0495676_0311249 3300047321 Bacteria 1060
481 Ga0495602_0032837 3300048088 Bacteria 4881
482 Ga0495602_0158763 3300048088 Bacteria 1768
483 Ga0495602_0292212 3300048088 Bacteria 1196
484 Ga0496100_0034520 3300048903 Bacteria 3175
485 Ga0496101_0040724 3300048904 Bacteria 3309
486 Ga0496102_0248781 3300048905 Bacteria 1676
487 Ga0496103_0103470 3300048906 Bacteria 1804
488 Ga0496104_0141524 3300048907 Bacteria 2311
489 Ga0496107_0033501 3300048910 Bacteria 3676
490 Ga0496109_0138459 3300048912 Bacteria 2276
491 Ga0496112_0002955 3300048915 Bacteria 13862
492 Ga0496112_0019399 3300048915 Bacteria 6419
493 Ga0496112_0055618 3300048915 Bacteria 3892
494 Ga0496112_0108205 3300048915 Unclassified 2750
495 Ga0496112_0509988 3300048915 Unclassified 1138
496 Ga0496114_0037258 3300048917 Bacteria 4022
497 Ga0496115_0032314 3300048918 Bacteria 4128
498 Ga0496115_0079962 3300048918 Unclassified 2661
499 Ga0496115_0407162 3300048918 Bacteria 1103
500 Ga0501040_0191913 3300049576 Bacteria 1450
501 Ga0501072_0705775 3300049588 Unclassified 793
502 Ga0501075_0354476 3300049591 Bacteria 1118
503 Ga0501076_0941884 3300049592 Unclassified 712
504 Ga0501083_0518314 3300049744 Unclassified 776
505 Ga0501268_011215 3300049765 Unclassified 1410
506 Ga0501045_0177900 3300049824 Unclassified 1585
507 nmdc:mga05p37_187920_c1 3300050507 Bacteria 2511
508 nmdc:mga05p37_228731_c1 3300050507 Bacteria 2241
509 nmdc:mga05p37_6868_c1 3300050507 Bacteria 13415
510 nmdc:mga0qj67_170690_c1 3300050509 Unclassified 1766
511 nmdc:mga0qj67_335459_c1 3300050509 Bacteria 1223
512 nmdc:mga06r32_245533_c1 3300050510 Bacteria 1778
513 nmdc:mga06r32_275047_c1 3300050510 Unclassified 1671
514 nmdc:mga06r32_284026_c1 3300050510 Bacteria 1642
515 nmdc:mga06r32_331163_c1 3300050510 Bacteria 1508
516 nmdc:mga06r32_992367_c1 3300050510 Unclassified 793
517 nmdc:mga08y16_1267_c1 3300050511 Bacteria 25093
518 nmdc:mga08y16_232149_c1 3300050511 Bacteria 1908
519 nmdc:mga08y16_31346_c1 3300050511 Bacteria 5591
520 nmdc:mga0n895_1138240_c1 3300050512 Bacteria 756
521 nmdc:mga0n895_12378_c1 3300050512 Bacteria 7653
522 nmdc:mga0n895_610245_c1 3300050512 Unclassified 1093
523 nmdc:mga0rr50_776347_c1 3300050513 Bacteria 818
524 nmdc:mga0a205_30593_c1 3300050515 Bacteria 5156
525 nmdc:mga0a205_370195_c1 3300050515 Bacteria 1299
526 nmdc:mga0a205_785688_c1 3300050515 Bacteria 800
527 Ga0495601_0420863 3300053077 Unclassified 865
528 Ga0495612_0079636 3300053078 Bacteria 1376
529 Ga0501084_0235364 3300054114 Unclassified 1546
530 Ga0530510_0173568 3300061734 Bacteria 1597
531 Ga0070714_100016421
532 Ga0058862_11914007
533 Ga0065707_10316748
534 Ga0070658_10424178
535 Ga0070676_10232177
536 Ga0070683_100168800
537 Ga0070670_100435711
538 Ga0070666_10000600
539 Ga0070680_100196004
540 Ga0068868_100013112
541 Ga0068868_100016610
542 Ga0068868_100033098
543 Ga0070660_100012224
544 Ga0070660_100021301
545 Ga0070660_100065351
546 Ga0070689_100055086
547 Ga0070689_100432902
548 Ga0070661_100155686
549 Ga0070661_100354131
550 Ga0070675_100168234
551 Ga0070671_100558867
552 Ga0070688_100360738
553 Ga0070659_100220938
554 Ga0070659_100393293
555 Ga0070667_100022540
556 Ga0070667_100050155
557 Ga0070667_100331936
558 Ga0070667_100468739
559 Ga0070667_100512361
560 Ga0070703_10080714
561 Ga0070714_100000346
562 Ga0070714_100289876
563 Ga0070713_100000362
564 Ga0070710_10039894
565 Ga0070701_10049937
566 Ga0070711_100001935
567 Ga0070711_100244345
568 Ga0070705_100056085
569 Ga0070708_100125904
570 Ga0070662_100630736
571 Ga0070681_10019341
572 Ga0070681_10031100
573 Ga0070681_10069262
574 Ga0070681_10096109
575 Ga0068867_100009879
576 Ga0070706_100001255
577 Ga0070707_100028996
578 Ga0070707_100078587
579 Ga0070707_100292045
580 Ga0070699_100119590
581 Ga0070699_100193509
582 Ga0070679_100080397
583 Ga0070679_100125671
584 Ga0070684_100095781
585 Ga0070684_100206819
586 Ga0070684_100504823
587 Ga0070697_100002150
588 Ga0068853_100503520
589 Ga0068853_100510088
590 Ga0070672_100024017
591 Ga0070672_100328343
592 Ga0070672_100786877
593 Ga0070686_100079035
594 Ga0070665_100064598
595 Ga0070665_100166683
596 Ga0070665_100535222
597 Ga0070665_100729286
598 Ga0070665_100799288
599 Ga0070704_100037152
600 Ga0068855_100078678
601 Ga0068855_100110995
602 Ga0068855_100348561
603 Ga0068855_100399323
604 Ga0068855_100490286
605 Ga0068855_100509846
606 Ga0070664_100088616
607 Ga0070664_100108029
608 Ga0070664_100426765
609 Ga0068857_100005968
610 Ga0068857_100058106
611 Ga0068854_100034014
612 Ga0068856_100001322
613 Ga0068856_100007250
614 Ga0068856_100014314
615 Ga0068856_100070738
616 Ga0068856_100098498
617 Ga0068856_100157205
618 Ga0068856_100307643
619 Ga0068852_100107500
620 Ga0068852_100263379
621 Ga0068859_100005624
622 Ga0068859_100029634
623 Ga0068859_100113598
624 Ga0068859_100261132
625 Ga0068859_100860035
626 Ga0068864_100018005
627 Ga0068864_100476952
628 Ga0068864_100502345
629 Ga0068866_10004248
630 Ga0068866_10069534
631 Ga0068861_100143723
632 Ga0068863_100006016
633 Ga0068863_100038986
634 Ga0068863_100094201
635 Ga0068863_100115271
636 Ga0068858_100003398
637 Ga0068858_100008861
638 Ga0068858_100010130
639 Ga0068858_100699109
640 Ga0068858_100772469
641 Ga0068860_100034301
642 Ga0068860_100205633
643 Ga0068862_100683882
644 Ga0081455_10007914
645 Ga0081455_10011823
646 Ga0081455_10301049
647 Ga0081540_1090788
648 Ga0070717_10090892
649 Ga0070717_10094429
650 Ga0070716_100027411
651 Ga0070716_100034360
652 Ga0070712_100000126
653 Ga0070712_100329186
654 Ga0070712_100499763
655 Ga0070712_100524504
656 Ga0097621_100001183
657 Ga0097621_100044344
658 Ga0097621_100081920
659 Ga0097621_100087397
660 Ga0097621_100110053
661 Ga0068871_100002620
662 Ga0068871_100008279
663 Ga0068871_100020028
664 Ga0068871_100023967
665 Ga0068871_100193277
666 Ga0068871_100293170
667 Ga0068871_100449906
668 Ga0075428_100064170
669 Ga0075428_100425350
670 Ga0075428_100532296
671 Ga0075428_100588623
672 Ga0075430_100200516
673 Ga0075430_100310420
674 Ga0075431_100034997
675 Ga0075431_100078586
676 Ga0075431_100129454
677 Ga0075431_100173170
678 Ga0075433_10030886
679 Ga0075434_100097072
680 Ga0068865_100006954
681 Ga0075436_100016054
682 Ga0075436_100307372
683 Ga0075436_100399858
684 Ga0097620_100005624
685 Ga0097620_100029635
686 Ga0097620_100113596
687 Ga0097620_100261135
688 Ga0097620_100860055
689 Ga0075435_100371627
690 Ga0075435_100881632
691 Ga0105240_10000808
692 Ga0105240_10002182
693 Ga0105240_10002475
694 Ga0105240_10024483
695 Ga0105240_10037065
696 Ga0105240_10087848
697 Ga0105240_10128451
698 Ga0105240_10153171
699 Ga0105240_10264011
700 Ga0111539_10171927
701 Ga0111539_10209189
702 Ga0111539_10268344
703 Ga0105245_10002191
704 Ga0105245_10003761
705 Ga0105245_10086761
706 Ga0105247_10140766
707 Ga0114129_10003069
708 Ga0114129_10016006
709 Ga0114129_10264792
710 Ga0114129_10306051
711 Ga0114129_10674007
712 Ga0114129_10719238
713 Ga0114129_11036378
714 Ga0105241_10008427
715 Ga0105241_10010295
716 Ga0105241_10016313
717 Ga0105241_10039359
718 Ga0105241_10317180
719 Ga0105241_10387620
720 Ga0105241_10399457
721 Ga0105241_10651913
722 Ga0105242_10019509
723 Ga0105242_10023294
724 Ga0105242_10057629
725 Ga0105242_10067103
726 Ga0105242_10110469
727 Ga0105248_10002391
728 Ga0105248_10013197
729 Ga0105248_10070867
730 Ga0105248_10366003
731 Ga0105248_10429288
732 Ga0105248_11361989
733 Ga0105237_10003726
734 Ga0105237_10005161
735 Ga0105237_10011387
736 Ga0105237_10048328
737 Ga0105237_10057274
738 Ga0105237_10076734
739 Ga0105237_10086842
740 Ga0105238_10035519
741 Ga0105238_10132458
742 Ga0105238_10190793
743 Ga0105238_10223243
744 Ga0105238_10229987
745 Ga0105238_10563312
746 Ga0105238_11044071
747 Ga0105249_10038284
748 Ga0105249_10228350
749 Ga0105249_10593695
750 Ga0099796_10135462
751 Ga0105239_10005941
752 Ga0105239_10013477
753 Ga0105239_10013678
754 Ga0105239_10028788
755 Ga0105239_10065904
756 Ga0105239_10329142
757 Ga0105239_11264550
758 Ga0105246_10064515
759 Ga0105246_10089267
760 Ga0157373_10001176
761 Ga0157371_10013252
762 Ga0157370_10004592
763 Ga0157370_10015779
764 Ga0157370_10173315
765 Ga0157370_10228841
766 Ga0157370_10304547
767 Ga0157369_10003508
768 Ga0157369_10008320
769 Ga0157369_10023308
770 Ga0157369_10040308
771 Ga0157369_10050859
772 Ga0157369_10180968
773 Ga0157369_10189982
774 Ga0157369_10223288
775 Ga0157369_10583936
776 Ga0157374_10000328
777 Ga0157374_10010577
778 Ga0157374_10012640
779 Ga0157374_10031771
780 Ga0157374_10031817
781 Ga0157374_10136673
782 Ga0157374_10193354
783 Ga0157374_10342081
784 Ga0157378_10003115
785 Ga0157378_10012251
786 Ga0157378_10016241
787 Ga0157378_10109898
788 Ga0157378_10175076
789 Ga0157378_10376342
790 Ga0157378_10638471
791 Ga0157378_10703402
792 Ga0163162_10002759
793 Ga0163162_10008743
794 Ga0163162_11281871
795 Ga0157372_10000391
796 Ga0157372_10010458
797 Ga0157372_10021286
798 Ga0157372_10027663
799 Ga0157372_10461301
800 Ga0157372_10671477
801 Ga0157372_11470733
802 Ga0157375_10000473
803 Ga0157375_10549021
804 Ga0157375_11301978
805 Ga0163163_10002231
806 Ga0163163_10014464
807 Ga0163163_10026827
808 Ga0163163_10295401
809 Ga0157379_10023163
810 Ga0157379_10042657
811 Ga0157379_10091184
812 Ga0157376_10044557
813 Ga0157376_10062616
814 Ga0157376_10080996
815 Ga0157376_10173479
816 Ga0157376_10200300
817 Ga0157376_10391497
818 Ga0228598_1000833
819 Ga0207710_10274638
820 Ga0207680_10022092
821 Ga0207680_10486610
822 Ga0207647_10072997
823 Ga0207685_10287153
824 Ga0207699_10030394
825 Ga0207699_10272315
826 Ga0207699_10353985
827 Ga0207645_10176655
828 Ga0207645_10316780
829 Ga0207705_10191863
830 Ga0207684_10018517
831 Ga0207684_10391441
832 Ga0207654_10006133
833 Ga0207654_10006396
834 Ga0207654_10023048
835 Ga0207654_10052809
836 Ga0207654_10325708
837 Ga0207707_10008555
838 Ga0207707_10076362
839 Ga0207707_10313675
840 Ga0207695_10001883
841 Ga0207695_10004408
842 Ga0207695_10011866
843 Ga0207695_10024785
844 Ga0207695_10163996
845 Ga0207695_10172428
846 Ga0207695_10174137
847 Ga0207695_10174200
848 Ga0207695_10176314
849 Ga0207695_10201648
850 Ga0207671_10027250
851 Ga0207671_10030849
852 Ga0207671_10193753
853 Ga0207671_10317881
854 Ga0207693_10000102
855 Ga0207693_10244561
856 Ga0207663_10172753
857 Ga0207660_10014761
858 Ga0207660_10298860
859 Ga0207657_10008054
860 Ga0207657_10085642
861 Ga0207657_10294188
862 Ga0207652_10040483
863 Ga0207646_10001514
864 Ga0207646_10088730
865 Ga0207646_10153209
866 Ga0207681_10173865
867 Ga0207694_10016634
868 Ga0207694_10044866
869 Ga0207694_10288784
870 Ga0207650_10182947
871 Ga0207687_10002727
872 Ga0207687_10026201
873 Ga0207687_10083292
874 Ga0207687_10123638
875 Ga0207687_10191514
876 Ga0207700_10000693
877 Ga0207700_10014540
878 Ga0207664_10000333
879 Ga0207664_10012556
880 Ga0207644_10040328
881 Ga0207690_10186491
882 Ga0207690_10199109
883 Ga0207706_10537610
884 Ga0207686_10021028
885 Ga0207686_10053534
886 Ga0207686_10100523
887 Ga0207686_10130690
888 Ga0207670_10124099
889 Ga0207670_10429419
890 Ga0207704_10013355
891 Ga0207665_10116851
892 Ga0207665_10116973
893 Ga0207665_10206510
894 Ga0207691_10184855
895 Ga0207711_10013616
896 Ga0207711_10376101
897 Ga0207711_10573183
898 Ga0207711_10705764
899 Ga0207661_10110180
900 Ga0207679_10053691
901 Ga0207679_10063059
902 Ga0207679_10199968
903 Ga0207679_10248858
904 Ga0207679_10619674
905 Ga0207667_10010565
906 Ga0207667_10011899
907 Ga0207667_10146688
908 Ga0207667_10160969
909 Ga0207667_10557295
910 Ga0207651_10271010
911 Ga0207712_10075963
912 Ga0207640_10019315
913 Ga0207658_10010686
914 Ga0207658_10136744
915 Ga0207658_10161841
916 Ga0207658_10266259
917 Ga0207658_10825377
918 Ga0207677_10019914
919 Ga0207677_10174300
920 Ga0207677_10252738
921 Ga0207677_10408862
922 Ga0207677_10455854
923 Ga0207703_10002598
924 Ga0207703_10013805
925 Ga0207703_10295868
926 Ga0207703_10409990
927 Ga0207703_10530492
928 Ga0207639_10040855
929 Ga0207678_10627977
930 Ga0207702_10001519
931 Ga0207702_10050643
932 Ga0207702_10241533
933 Ga0207702_10299154
934 Ga0207641_10014861
935 Ga0207641_10054907
936 Ga0207641_10058630
937 Ga0207641_10104658
938 Ga0207648_10019395
939 Ga0207648_10647847
940 Ga0207676_10111783
941 Ga0207676_10307013
942 Ga0207676_10373188
943 Ga0207676_10508211
944 Ga0207674_10004333
945 Ga0207674_10010487
946 Ga0207674_10023395
947 Ga0207675_100060942
948 Ga0207675_100282174
949 Ga0207683_10196776
950 Ga0207698_10016779
951 Ga0207698_10842530
952 Ga0207428_10006462
953 Ga0207428_10153162
954 Ga0265356_1000116
955 Ga0268266_10014272
956 Ga0268266_10029997
957 Ga0268266_10467177
958 Ga0268266_10739055
959 Ga0268266_10775077
960 Ga0268265_10056886
961 Ga0268265_10092292
962 Ga0268264_10009448
963 Ga0268264_10010570
964 Ga0268264_10582008
965 Ga0265762_1001072
966 Ga0265760_10000024
967 Ga0265314_10000582
968 Ga0373929_0036097
969 Ga0373944_0083151
970 Ga0373923_0039131
971 Ga0373941_0044885
972 Ga0373943_0108715
973 Ga0373946_0070309
974 Ga0373931_0020546
975 Ga0373935_0065550
976 Ga0373935_0091838
977 Ga0373935_0188285
978 Ga0373927_0003526
979 Ga0373927_0043850
980 Ga0373927_0179959
981 Ga0373927_0202430
982 Ga0373927_0612563
983 Ga0373947_0000466
984 Ga0373947_0007099
985 Ga0373937_0009467
986 Ga0373937_0256413
987 Ga0373937_0929200
988 Ga0373925_0000446
989 Ga0373925_0037601
990 Ga0373925_0083212
991 Ga0436365_1124698
992 Ga0436365_1371246
993 Ga0453683_0007067
994 Ga0466959_0162629
995 Ga0451576_0106582
996 Ga0451576_0425282
997 Ga0451576_0790285
998 Ga0466958_0347020
999 Ga0495651_0131575
1000 Ga0495580_0049612
1001 Ga0495580_0075652
1002 Ga0495580_0182270
1003 Ga0495580_0230268
1004 Ga0495582_0163191
1005 Ga0495594_0204933
1006 Ga0495628_0226381
1007 Ga0495658_0339351
1008 Ga0495613_0181226
1009 Ga0495674_0119667
1010 Ga0495676_0311249
1011 Ga0495602_0032837
1012 Ga0495602_0158763
1013 Ga0495602_0292212
1014 Ga0496100_0034520
1015 Ga0496101_0040724
1016 Ga0496102_0248781
1017 Ga0496103_0103470
1018 Ga0496104_0141524
1019 Ga0496107_0033501
1020 Ga0496109_0138459
1021 Ga0496112_0002955
1022 Ga0496112_0019399
1023 Ga0496112_0055618
1024 Ga0496112_0108205
1025 Ga0496112_0509988
1026 Ga0496114_0037258
1027 Ga0496115_0032314
1028 Ga0496115_0079962
1029 Ga0496115_0407162
1030 Ga0501040_0191913
1031 Ga0501072_0705775
1032 Ga0501075_0354476
1033 Ga0501076_0941884
1034 Ga0501083_0518314
1035 Ga0501268_011215
1036 Ga0501045_0177900
1037 nmdc:mga05p37_187920_c1
1038 nmdc:mga05p37_228731_c1
1039 nmdc:mga05p37_6868_c1
1040 nmdc:mga0qj67_170690_c1
1041 nmdc:mga0qj67_335459_c1
1042 nmdc:mga06r32_245533_c1
1043 nmdc:mga06r32_275047_c1
1044 nmdc:mga06r32_284026_c1
1045 nmdc:mga06r32_331163_c1
1046 nmdc:mga06r32_992367_c1
1047 nmdc:mga08y16_1267_c1
1048 nmdc:mga08y16_232149_c1
1049 nmdc:mga08y16_31346_c1
1050 nmdc:mga0n895_1138240_c1
1051 nmdc:mga0n895_12378_c1
1052 nmdc:mga0n895_610245_c1
1053 nmdc:mga0rr50_776347_c1
1054 nmdc:mga0a205_30593_c1
1055 nmdc:mga0a205_370195_c1
1056 nmdc:mga0a205_785688_c1
1057 Ga0495601_0420863
1058 Ga0495612_0079636
1059 Ga0501084_0235364
1060 Ga0530510_0173568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tcf-assembly1.cif.gz_C integrin alpha-v beta-8 in complex with minibinder b8_bp_dsulf 0.7478 17 123
8tcf-assembly1.cif.gz_C integrin alpha-v beta-8 in complex with minibinder b8_bp_dsulf 0.7066 17 123
7lmx-assembly1.cif.gz_A a highly specific inhibitor of integrin alpha-v beta-6 with a disulfide 0.7026 17 124
2n2t-assembly1.cif.gz_A solution nmr structure of de novo designed protein (fda_60), northeast structural genomics consortium (nesg) target or303 0.6834 17 125
3k58-assembly1.cif.gz_A crystal structure of e.coli pol ii-normal dna-dttp ternary complex 0.6724 17 120
ID Description Score Start End Superfamily
3dfeF00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6931 17 124 3.30.70.120
af_Q9USZ1_675_770_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6524 17 124 3.30.70.240
af_A0A1D6P3B9_828_949_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6439 17 124 3.30.70.240
af_Q58857_3_83_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6364 17 123 3.30.70.100
af_Q4D7E6_184_271_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6267 17 124 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A846Q446-F1-model_v4 Uncharacterized protein 0.9641 162 222
AF-A0A317IIG1-F1-model_v4 Uncharacterized protein 0.952 1 225
AF-A0A1F4QIX7-F1-model_v4 Uncharacterized protein 0.9494 1 221
AF-A0A0S8CII0-F1-model_v4 Uncharacterized protein 0.9387 98 223
AF-A0A154BLX1-F1-model_v4 Uncharacterized protein 0.9379 1 219

Map