F459688

General Info

Members Datasets Scaffolds Average Seq Length
528 216 510 78

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10001207|Ga0265338_1000120725
Length 91
Sequence MAEALLTVTVDGQTVRVAPGSSVVAAVAQAARVAKTGVVTRRSVSGELRGPLCGMGVCQECRVTIDGVRHRLACQTLCAQGMTVRTGRAEP

Samples

Sample ID Description Type Environment
1 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2511231008 Pseudomonas sp. GM21 Isolate Nodule
4 2511231019 Pseudomonas sp. GM67 Isolate Nodule
5 2511231021 Pseudomonas sp. GM78 Isolate Nodule
6 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
7 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
8 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
9 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
10 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
11 2773857670 Pseudomonas sp. 478 Isolate Unclassified
12 2784132072 Pseudomonas sp. 460 Isolate Unclassified
13 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
14 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
15 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
16 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
17 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
18 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
97 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
102 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
103 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
104 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
105 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
106 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
107 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
108 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
109 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
110 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
115 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
193 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
212 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
215 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
216 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.59
Metatranscriptomes 0
Isolates 3.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0.57
Rhizoplane 3.22
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 5.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1a_Contig_2496 2124908026 Bacteria 874
2 MRS2a_Contig_27032 2124908027 Bacteria 798
3 MRS2a_Contig_8 2124908027 Bacteria 21551
4 MRS2a_Contig_9003 2124908027 Bacteria 4639
5 rootH1_10211760 3300003323 Unclassified 3019
6 Ga0065714_10000403 3300005288 Bacteria 4968
7 Ga0065714_10016458 3300005288 Bacteria 1903
8 Ga0065714_10041939 3300005288 Bacteria 852
9 Ga0065714_10064425 3300005288 Bacteria 189652
10 Ga0065714_10068548 3300005288 Bacteria 4663
11 Ga0065714_10081838 3300005288 Bacteria 2340
12 Ga0065714_10114264 3300005288 Bacteria 1431
13 Ga0065714_10164523 3300005288 Bacteria 1008
14 Ga0065714_10539108 3300005288 Bacteria 503
15 Ga0065712_10020154 3300005290 Bacteria 2584
16 Ga0065715_10318689 3300005293 Bacteria 1006
17 Ga0070658_10039919 3300005327 Unclassified 3787
18 Ga0070683_100265656 3300005329 Bacteria 1632
19 Ga0070683_100644370 3300005329 Bacteria 1014
20 Ga0070661_100573959 3300005344 Bacteria 910
21 Ga0070671_100069088 3300005355 Bacteria 2946
22 Ga0070709_10418637 3300005434 Bacteria 1003
23 Ga0070714_100455112 3300005435 Bacteria 1216
24 Ga0070713_101179129 3300005436 Unclassified 741
25 Ga0070710_11134126 3300005437 Bacteria 575
26 Ga0070711_100002406 3300005439 Bacteria 10676
27 Ga0070711_101431366 3300005439 Bacteria 602
28 Ga0070697_100414864 3300005536 Bacteria 1169
29 Ga0070697_101816549 3300005536 Bacteria 545
30 Ga0068853_100198143 3300005539 Bacteria 1827
31 Ga0070665_100559428 3300005548 Unclassified 1156
32 Ga0070704_100813314 3300005549 Bacteria 836
33 Ga0068855_100115201 3300005563 Bacteria 3081
34 Ga0068857_100897436 3300005577 Bacteria 850
35 Ga0068854_100079622 3300005578 Unclassified 2416
36 Ga0068856_100115570 3300005614 Bacteria 2683
37 Ga0068852_100359556 3300005616 Bacteria 1424
38 Ga0068851_10022953 3300005834 Bacteria 3045
39 Ga0068858_100225354 3300005842 Unclassified 1776
40 Ga0075432_10225920 3300006058 Bacteria 751
41 Ga0070715_10005678 3300006163 Bacteria 4183
42 Ga0070716_100003303 3300006173 Bacteria 7581
43 Ga0070712_100002207 3300006175 Bacteria 11978
44 Ga0075367_10692052 3300006178 Bacteria 648
45 Ga0075433_10829906 3300006852 Unclassified 807
46 Ga0105251_10363657 3300009011 Bacteria 661
47 Ga0105251_10559618 3300009011 Bacteria 539
48 Ga0105244_10003182 3300009036 Bacteria 11920
49 Ga0105244_10058748 3300009036 Bacteria 1939
50 Ga0105244_10086070 3300009036 Bacteria 1550
51 Ga0105244_10322411 3300009036 Bacteria 713
52 Ga0105250_10037679 3300009092 Bacteria 1940
53 Ga0105250_10110011 3300009092 Bacteria 1128
54 Ga0105243_11860821 3300009148 Bacteria 634
55 Ga0105241_10877008 3300009174 Unclassified 832
56 Ga0105241_11162200 3300009174 Bacteria 729
57 Ga0105237_11379529 3300009545 Unclassified 711
58 Ga0105239_10767348 3300010375 Bacteria 1104
59 Ga0157373_10037483 3300013100 Bacteria 3475
60 Ga0157370_10001147 3300013104 Bacteria 33013
61 Ga0157370_10090568 3300013104 Bacteria 2872
62 Ga0157369_10745544 3300013105 Bacteria 1008
63 Ga0163162_10324219 3300013306 Bacteria 1673
64 Ga0163162_13052029 3300013306 Bacteria 538
65 Ga0157372_10200901 3300013307 Bacteria 2309
66 Ga0157375_10304095 3300013308 Bacteria 1758
67 Ga0157375_10743367 3300013308 Bacteria 1133
68 Ga0157375_10925500 3300013308 Bacteria 1015
69 Ga0157375_12463869 3300013308 Bacteria 621
70 Ga0182008_10017721 3300014497 Bacteria 3691
71 Ga0182008_10037154 3300014497 Bacteria 2437
72 Ga0182008_10532430 3300014497 Bacteria 650
73 Ga0182006_1227926 3300015261 Bacteria 613
74 Ga0182005_1006006 3300015265 Bacteria 3753
75 Ga0182005_1035735 3300015265 Bacteria 1351
76 Ga0182005_1183291 3300015265 Bacteria 623
77 Ga0182005_1233269 3300015265 Bacteria 564
78 Ga0163161_10000744 3300017792 Bacteria 25621
79 Ga0163161_10029579 3300017792 Bacteria 3894
80 Ga0163161_10044590 3300017792 Bacteria 3195
81 Ga0163161_10079296 3300017792 Bacteria 2414
82 Ga0163161_10325070 3300017792 Bacteria 1217
83 Ga0163161_11051526 3300017792 Bacteria 697
84 Ga0209759_1002797 3300025256 Bacteria 7372
85 Ga0209257_1012954 3300025304 Bacteria 3772
86 Ga0207656_10047750 3300025321 Bacteria 1841
87 Ga0207655_1000006 3300025728 Bacteria 861092
88 Ga0207655_1023365 3300025728 Bacteria 3069
89 Ga0207655_1029352 3300025728 Bacteria 2576
90 Ga0207713_1046078 3300025735 Bacteria 1776
91 Ga0207692_11026229 3300025898 Bacteria 545
92 Ga0207685_10229796 3300025905 Bacteria 887
93 Ga0207699_10370551 3300025906 Bacteria 1015
94 Ga0207654_10014996 3300025911 Bacteria 4013
95 Ga0207654_10944939 3300025911 Unclassified 626
96 Ga0207654_11147830 3300025911 Bacteria 566
97 Ga0207693_10000241 3300025915 Bacteria 50544
98 Ga0207663_10005184 3300025916 Bacteria 6555
99 Ga0207649_11455334 3300025920 Unclassified 542
100 Ga0207664_10454920 3300025929 Bacteria 1143
101 Ga0207644_10056599 3300025931 Bacteria 2830
102 Ga0207665_10048755 3300025939 Unclassified 2845
103 Ga0207667_10855944 3300025949 Unclassified 903
104 Ga0207640_10778380 3300025981 Bacteria 827
105 Ga0207703_10149167 3300026035 Unclassified 2037
106 Ga0207702_10247312 3300026078 Unclassified 1673
107 Ga0207428_11119272 3300027907 Bacteria 550
108 Ga0307517_10632331 3300028786 Bacteria 523
109 Ga0265338_10001207 3300028800 Bacteria 42733
110 Ga0265338_10072701 3300028800 Bacteria 2935
111 Ga0265332_10013626 3300031238 Bacteria 3602
112 Ga0265320_10198632 3300031240 Unclassified 896
113 Ga0307408_100000085 3300031548 Bacteria 104335
114 Ga0307408_100027559 3300031548 Bacteria 3917
115 Ga0307408_101285003 3300031548 Bacteria 685
116 Ga0265314_10315190 3300031711 Bacteria 872
117 Ga0307405_10103984 3300031731 Bacteria 1910
118 Ga0307405_10199746 3300031731 Bacteria 1451
119 Ga0307413_10560492 3300031824 Bacteria 928
120 Ga0307413_11748273 3300031824 Bacteria 555
121 Ga0307412_10000750 3300031911 Bacteria 18812
122 Ga0307412_10001735 3300031911 Bacteria 12052
123 Ga0307414_10186946 3300032004 Bacteria 1672
124 Ga0307414_10276518 3300032004 Bacteria 1409
125 Ga0439438_000510 3300041405 Bacteria 17619
126 Ga0439438_007096 3300041405 Bacteria 3866
127 Ga0439438_010116 3300041405 Bacteria 3006
128 Ga0439438_041391 3300041405 Bacteria 1194
129 Ga0439447_029103 3300041407 Bacteria 1400
130 Ga0439447_054131 3300041407 Bacteria 952
131 Ga0439447_081749 3300041407 Bacteria 745
132 Ga0439466_0000324 3300041411 Bacteria 18343
133 Ga0439466_0003650 3300041411 Bacteria 5941
134 Ga0439466_0018773 3300041411 Bacteria 2478
135 Ga0451806_464398 3300041462 Bacteria 713
136 Ga0439432_005513 3300042006 Bacteria 4550
137 Ga0439432_010614 3300042006 Bacteria 3185
138 Ga0439451_104336 3300042009 Bacteria 573
139 Ga0439452_000147 3300042010 Bacteria 52317
140 Ga0439452_006893 3300042010 Bacteria 3520
141 Ga0439452_066116 3300042010 Bacteria 803
142 Ga0439456_027333 3300042013 Bacteria 1215
143 Ga0439463_008067 3300042016 Bacteria 2598
144 Ga0439463_036652 3300042016 Bacteria 1243
145 Ga0439463_042823 3300042016 Bacteria 1152
146 Ga0450911_011786 3300042115 Bacteria 1190
147 Ga0450902_055267 3300042137 Bacteria 683
148 Ga0450903_026427 3300042138 Bacteria 885
149 Ga0450904_035350 3300042139 Bacteria 529
150 Ga0450907_000003 3300042146 Bacteria 138102
151 Ga0450907_009783 3300042146 Bacteria 1590
152 Ga0450910_005646 3300042147 Bacteria 1713
153 Ga0439446_0008634 3300042156 Bacteria 2711
154 Ga0439446_0244761 3300042156 Bacteria 617
155 Ga0450909_002386 3300042185 Bacteria 2655
156 Ga0439434_0000019 3300042435 Bacteria 41172
157 Ga0439460_0004859 3300042461 Bacteria 3283
158 Ga0439440_0000787 3300042993 Bacteria 5476
159 Ga0495617_025231 3300046452 Bacteria 2004
160 Ga0495617_069742 3300046452 Bacteria 1156
161 Ga0495617_084236 3300046452 Bacteria 1040
162 Ga0495617_087629 3300046452 Bacteria 1017
163 Ga0495617_104944 3300046452 Bacteria 916
164 Ga0495627_000130 3300046453 Bacteria 91090
165 Ga0495627_044739 3300046453 Bacteria 1350
166 Ga0495603_0000535 3300046455 Bacteria 21117
167 Ga0495603_0011885 3300046455 Bacteria 5268
168 Ga0495603_0154289 3300046455 Bacteria 1333
169 Ga0495603_0263707 3300046455 Bacteria 991
170 Ga0495603_0488025 3300046455 Bacteria 705
171 Ga0495590_0012264 3300046457 Bacteria 3183
172 Ga0495590_0027834 3300046457 Bacteria 1983
173 Ga0495590_0267296 3300046457 Bacteria 639
174 Ga0495591_000606 3300046458 Bacteria 27134
175 Ga0495591_002805 3300046458 Bacteria 9388
176 Ga0495591_003414 3300046458 Bacteria 8228
177 Ga0495591_011602 3300046458 Bacteria 3324
178 Ga0495591_019926 3300046458 Bacteria 2231
179 Ga0495591_030982 3300046458 Bacteria 1609
180 Ga0495591_078845 3300046458 Bacteria 842
181 Ga0495629_0001031 3300046459 Bacteria 22316
182 Ga0495629_0403637 3300046459 Bacteria 929
183 Ga0495638_0011506 3300046460 Bacteria 6094
184 Ga0495638_0026435 3300046460 Bacteria 3761
185 Ga0495638_0087609 3300046460 Bacteria 1880
186 Ga0495638_0359551 3300046460 Bacteria 766
187 Ga0495653_0341774 3300046463 Bacteria 964
188 Ga0495650_0001229 3300046471 Bacteria 26770
189 Ga0495650_0002952 3300046471 Bacteria 12874
190 Ga0495650_0015293 3300046471 Bacteria 3941
191 Ga0495650_0020295 3300046471 Bacteria 3243
192 Ga0495650_0144860 3300046471 Bacteria 857
193 Ga0495605_0000155 3300046474 Bacteria 88662
194 Ga0495605_0002003 3300046474 Bacteria 12878
195 Ga0495605_0002096 3300046474 Bacteria 12514
196 Ga0495605_0005737 3300046474 Bacteria 7201
197 Ga0495605_0117306 3300046474 Bacteria 1209
198 Ga0495605_0269964 3300046474 Bacteria 724
199 Ga0495605_0292553 3300046474 Bacteria 690
200 Ga0495605_0416838 3300046474 Bacteria 556
201 Ga0495639_0008594 3300046475 Bacteria 4379
202 Ga0495639_0049671 3300046475 Bacteria 1904
203 Ga0495664_0819404 3300046477 Bacteria 547
204 Ga0495584_0000038 3300046491 Bacteria 93590
205 Ga0495584_0000652 3300046491 Bacteria 23158
206 Ga0495584_0003752 3300046491 Bacteria 8280
207 Ga0495584_0004441 3300046491 Bacteria 7546
208 Ga0495584_0011316 3300046491 Bacteria 4569
209 Ga0495584_0023194 3300046491 Bacteria 3146
210 Ga0495584_0207679 3300046491 Bacteria 995
211 Ga0495584_0340671 3300046491 Bacteria 761
212 Ga0495584_0695108 3300046491 Bacteria 518
213 Ga0495585_0002340 3300046492 Bacteria 13619
214 Ga0495585_0041585 3300046492 Bacteria 2577
215 Ga0495585_0055890 3300046492 Bacteria 2180
216 Ga0495585_0061164 3300046492 Bacteria 2071
217 Ga0495585_0222617 3300046492 Bacteria 951
218 Ga0495585_0239002 3300046492 Bacteria 910
219 Ga0495594_0000712 3300046499 Bacteria 17131
220 Ga0495594_0004518 3300046499 Bacteria 7157
221 Ga0495594_0010354 3300046499 Bacteria 4835
222 Ga0495596_0062384 3300046500 Bacteria 1450
223 Ga0495596_0106478 3300046500 Bacteria 1089
224 Ga0495607_0003552 3300046501 Bacteria 11873
225 Ga0495607_0012853 3300046501 Bacteria 5506
226 Ga0495607_0017020 3300046501 Bacteria 4679
227 Ga0495607_0029755 3300046501 Bacteria 3359
228 Ga0495607_0030640 3300046501 Bacteria 3301
229 Ga0495607_0039856 3300046501 Bacteria 2802
230 Ga0495607_0089655 3300046501 Bacteria 1669
231 Ga0495607_0099090 3300046501 Bacteria 1564
232 Ga0495583_0000112 3300046506 Bacteria 138078
233 Ga0495583_0001496 3300046506 Bacteria 23334
234 Ga0495583_0004961 3300046506 Bacteria 9236
235 Ga0495583_0007952 3300046506 Bacteria 6565
236 Ga0495583_0023726 3300046506 Bacteria 3096
237 Ga0495583_0045612 3300046506 Bacteria 2026
238 Ga0495583_0087519 3300046506 Bacteria 1345
239 Ga0495606_0001612 3300046507 Bacteria 29428
240 Ga0495606_0002913 3300046507 Bacteria 18889
241 Ga0495606_0009900 3300046507 Bacteria 7985
242 Ga0495610_0006941 3300046512 Bacteria 7662
243 Ga0495610_0017656 3300046512 Bacteria 4061
244 Ga0495610_0039198 3300046512 Bacteria 2398
245 Ga0495610_0082846 3300046512 Bacteria 1469
246 Ga0495610_0265866 3300046512 Bacteria 673
247 Ga0495616_0000730 3300046513 Bacteria 24186
248 Ga0495616_0010972 3300046513 Bacteria 5215
249 Ga0495616_0013688 3300046513 Bacteria 4568
250 Ga0495616_0020371 3300046513 Bacteria 3610
251 Ga0495616_0030928 3300046513 Bacteria 2808
252 Ga0495616_0102906 3300046513 Bacteria 1337
253 Ga0495620_0000914 3300046515 Bacteria 18126
254 Ga0495620_0010304 3300046515 Bacteria 4932
255 Ga0495620_0018302 3300046515 Bacteria 3471
256 Ga0495620_0416424 3300046515 Bacteria 508
257 Ga0495628_0109007 3300046516 Bacteria 2131
258 Ga0495630_0014349 3300046517 Bacteria 5770
259 Ga0495631_0000005 3300046518 Bacteria 159179
260 Ga0495631_0002523 3300046518 Bacteria 10285
261 Ga0495631_0031778 3300046518 Bacteria 2383
262 Ga0495631_0157748 3300046518 Bacteria 973
263 Ga0495632_0000058 3300046519 Bacteria 122648
264 Ga0495632_0001944 3300046519 Bacteria 16500
265 Ga0495632_0027781 3300046519 Bacteria 2958
266 Ga0495632_0062481 3300046519 Bacteria 1805
267 Ga0495632_0314804 3300046519 Bacteria 692
268 Ga0495637_0000204 3300046520 Bacteria 46396
269 Ga0495637_0001432 3300046520 Bacteria 14062
270 Ga0495637_0001868 3300046520 Bacteria 12036
271 Ga0495637_0004037 3300046520 Bacteria 7666
272 Ga0495637_0029709 3300046520 Bacteria 2430
273 Ga0495637_0091821 3300046520 Bacteria 1196
274 Ga0495637_0235589 3300046520 Bacteria 662
275 Ga0495643_0017733 3300046522 Bacteria 4154
276 Ga0495643_0023309 3300046522 Bacteria 3520
277 Ga0495643_0029724 3300046522 Bacteria 3056
278 Ga0495643_0055138 3300046522 Bacteria 2125
279 Ga0495643_0160156 3300046522 Bacteria 1108
280 Ga0495643_0186741 3300046522 Bacteria 1003
281 Ga0495644_0016983 3300046523 Bacteria 2785
282 Ga0495644_0080023 3300046523 Bacteria 1231
283 Ga0495644_0108987 3300046523 Bacteria 1050
284 Ga0495648_0000392 3300046524 Bacteria 47998
285 Ga0495648_0005599 3300046524 Bacteria 10417
286 Ga0495648_0027196 3300046524 Bacteria 3834
287 Ga0495648_0080313 3300046524 Bacteria 1858
288 Ga0495648_0092493 3300046524 Bacteria 1688
289 Ga0495648_0100798 3300046524 Bacteria 1594
290 Ga0495648_0143442 3300046524 Bacteria 1254
291 Ga0495648_0334965 3300046524 Bacteria 696
292 Ga0495666_0003043 3300046526 Bacteria 8425
293 Ga0495666_0003373 3300046526 Bacteria 8054
294 Ga0495666_0128424 3300046526 Bacteria 1185
295 Ga0495642_0000003 3300046528 Bacteria 185425
296 Ga0495652_0354926 3300046529 Bacteria 1049
297 Ga0495654_0009800 3300046530 Bacteria 5235
298 Ga0495654_0026438 3300046530 Bacteria 2982
299 Ga0495654_0038356 3300046530 Bacteria 2396
300 Ga0495654_0045546 3300046530 Bacteria 2163
301 Ga0495654_0265348 3300046530 Bacteria 710
302 Ga0495654_0336391 3300046530 Bacteria 609
303 Ga0495654_0403508 3300046530 Bacteria 542
304 Ga0495586_0356357 3300046535 Bacteria 840
305 Ga0495609_0000141 3300046538 Bacteria 75953
306 Ga0495609_0002893 3300046538 Bacteria 10237
307 Ga0495609_0008493 3300046538 Bacteria 5028
308 Ga0495609_0062433 3300046538 Bacteria 1645
309 Ga0495609_0100539 3300046538 Bacteria 1253
310 Ga0495597_0003145 3300046542 Bacteria 9885
311 Ga0495597_0009895 3300046542 Bacteria 4689
312 Ga0495597_0042286 3300046542 Bacteria 2032
313 Ga0495597_0050941 3300046542 Bacteria 1826
314 Ga0495597_0066998 3300046542 Bacteria 1554
315 Ga0495597_0067625 3300046542 Bacteria 1545
316 Ga0495597_0103946 3300046542 Bacteria 1195
317 Ga0495645_0045985 3300046543 Bacteria 3183
318 Ga0495622_0000612 3300046557 Bacteria 20710
319 Ga0495622_0036963 3300046557 Bacteria 2275
320 Ga0495622_0066181 3300046557 Bacteria 1670
321 Ga0495622_0148275 3300046557 Bacteria 1062
322 Ga0495633_0008376 3300046558 Bacteria 5833
323 Ga0495633_0035290 3300046558 Bacteria 2402
324 Ga0495656_0005248 3300046615 Bacteria 4464
325 Ga0495656_0288966 3300046615 Bacteria 837
326 Ga0495656_0299765 3300046615 Bacteria 823
327 Ga0495668_0003802 3300046616 Bacteria 11063
328 Ga0495668_0047933 3300046616 Bacteria 2372
329 Ga0495668_0110335 3300046616 Bacteria 1504
330 Ga0495634_0032251 3300046642 Bacteria 3604
331 Ga0495611_0000518 3300046648 Bacteria 22917
332 Ga0495611_0007062 3300046648 Bacteria 4768
333 Ga0495611_0016592 3300046648 Bacteria 3147
334 Ga0495625_0000145 3300046660 Bacteria 108480
335 Ga0495625_0002980 3300046660 Bacteria 17561
336 Ga0495625_0050586 3300046660 Bacteria 2981
337 Ga0495625_0528497 3300046660 Bacteria 717
338 Ga0495635_0279894 3300046663 Bacteria 1120
339 Ga0495659_0001085 3300046664 Bacteria 9476
340 Ga0495659_0008956 3300046664 Bacteria 3188
341 Ga0495659_0161673 3300046664 Bacteria 904
342 Ga0495661_0000332 3300046665 Bacteria 51357
343 Ga0495661_0006372 3300046665 Bacteria 8306
344 Ga0495661_0008324 3300046665 Bacteria 7181
345 Ga0495661_0056042 3300046665 Bacteria 2359
346 Ga0495661_0226496 3300046665 Bacteria 966
347 Ga0495661_0420063 3300046665 Bacteria 647
348 Ga0495588_0003722 3300046674 Bacteria 6670
349 Ga0495588_0017884 3300046674 Bacteria 3450
350 Ga0495588_0079076 3300046674 Bacteria 1716
351 Ga0495588_0311607 3300046674 Bacteria 828
352 Ga0495657_0220037 3300046675 Bacteria 1151
353 Ga0495599_0715842 3300046678 Bacteria 576
354 Ga0495623_0002926 3300046679 Bacteria 11229
355 Ga0495646_0493346 3300046680 Bacteria 629
356 Ga0495669_0010808 3300046684 Bacteria 3863
357 Ga0495669_0085482 3300046684 Bacteria 1451
358 Ga0495669_0284170 3300046684 Bacteria 796
359 Ga0495670_0000120 3300046691 Bacteria 34491
360 Ga0495670_0017891 3300046691 Bacteria 3490
361 Ga0495670_0155883 3300046691 Bacteria 1198
362 Ga0495670_0382607 3300046691 Bacteria 759
363 Ga0495670_0419929 3300046691 Bacteria 723
364 Ga0495670_0427957 3300046691 Bacteria 716
365 Ga0495671_0001805 3300046692 Bacteria 13849
366 Ga0495671_0010103 3300046692 Bacteria 5246
367 Ga0495671_0015533 3300046692 Bacteria 4078
368 Ga0495671_0051279 3300046692 Bacteria 2052
369 Ga0495671_0067621 3300046692 Bacteria 1757
370 Ga0495671_0090067 3300046692 Bacteria 1501
371 Ga0495671_0102856 3300046692 Bacteria 1395
372 Ga0495671_0108514 3300046692 Bacteria 1355
373 Ga0495671_0221101 3300046692 Bacteria 916
374 Ga0495649_0007033 3300046694 Bacteria 6927
375 Ga0495649_0024674 3300046694 Bacteria 3352
376 Ga0495649_0024751 3300046694 Bacteria 3347
377 Ga0495649_0093755 3300046694 Bacteria 1598
378 Ga0495649_0312443 3300046694 Bacteria 798
379 Ga0495649_0368335 3300046694 Bacteria 724
380 Ga0495589_0002000 3300046794 Bacteria 11543
381 Ga0495589_0008458 3300046794 Bacteria 5373
382 Ga0495589_0339602 3300046794 Bacteria 692
383 Ga0495600_0028197 3300046809 Bacteria 3632
384 Ga0495600_0216687 3300046809 Bacteria 1225
385 Ga0495660_0003690 3300046810 Bacteria 9414
386 Ga0495660_0004097 3300046810 Bacteria 8899
387 Ga0495660_0005016 3300046810 Bacteria 7964
388 Ga0495660_0018950 3300046810 Bacteria 3950
389 Ga0495660_0035951 3300046810 Bacteria 2764
390 Ga0495660_0084393 3300046810 Bacteria 1661
391 Ga0495660_0088628 3300046810 Bacteria 1611
392 Ga0495660_0142034 3300046810 Bacteria 1193
393 Ga0495660_0173449 3300046810 Bacteria 1048
394 Ga0495660_0230810 3300046810 Bacteria 867
395 Ga0495581_0012448 3300047315 Bacteria 4927
396 Ga0495604_0001437 3300047317 Bacteria 19546
397 Ga0495604_0009038 3300047317 Bacteria 7883
398 Ga0495636_0053670 3300047318 Bacteria 1692
399 Ga0495636_0094270 3300047318 Bacteria 1302
400 Ga0495636_0126682 3300047318 Bacteria 1133
401 Ga0495636_0328119 3300047318 Bacteria 719
402 Ga0495674_0599281 3300047319 Bacteria 873
403 Ga0495672_0000261 3300047320 Bacteria 73207
404 Ga0495672_0011943 3300047320 Bacteria 6089
405 Ga0495672_0012301 3300047320 Bacteria 5980
406 Ga0495672_0013408 3300047320 Bacteria 5656
407 Ga0495672_0096570 3300047320 Bacteria 1611
408 Ga0495672_0124593 3300047320 Bacteria 1364
409 Ga0495672_0176623 3300047320 Bacteria 1085
410 Ga0495676_0000198 3300047321 Bacteria 47538
411 Ga0495680_0001302 3300047322 Bacteria 27175
412 Ga0495680_0009213 3300047322 Bacteria 8900
413 Ga0495680_0121763 3300047322 Bacteria 1925
414 Ga0495680_0157922 3300047322 Bacteria 1648
415 Ga0495683_0000010 3300047323 Bacteria 223494
416 Ga0495683_0006853 3300047323 Bacteria 6192
417 Ga0495683_0011577 3300047323 Bacteria 4640
418 Ga0495683_0030683 3300047323 Bacteria 2742
419 Ga0495683_0093005 3300047323 Bacteria 1458
420 Ga0495683_0173766 3300047323 Bacteria 988
421 Ga0495677_0001539 3300047445 Bacteria 9282
422 Ga0495679_001029 3300047446 Bacteria 17123
423 Ga0495679_007523 3300047446 Bacteria 4528
424 Ga0495679_027510 3300047446 Bacteria 1875
425 Ga0495685_049282 3300047447 Bacteria 1430
426 Ga0495673_0000242 3300047469 Bacteria 77375
427 Ga0495673_0000407 3300047469 Bacteria 50254
428 Ga0495673_0003142 3300047469 Bacteria 11058
429 Ga0495673_0007995 3300047469 Bacteria 5996
430 Ga0495673_0009555 3300047469 Bacteria 5363
431 Ga0495673_0010298 3300047469 Bacteria 5095
432 Ga0495673_0026388 3300047469 Bacteria 2778
433 Ga0495673_0050969 3300047469 Bacteria 1814
434 Ga0495673_0074377 3300047469 Bacteria 1421
435 Ga0495673_0116800 3300047469 Bacteria 1060
436 Ga0495673_0147358 3300047469 Bacteria 912
437 Ga0495681_0000134 3300047470 Bacteria 63782
438 Ga0495681_0004485 3300047470 Bacteria 9529
439 Ga0495681_0016528 3300047470 Bacteria 4131
440 Ga0495681_0022655 3300047470 Bacteria 3356
441 Ga0495681_0032466 3300047470 Bacteria 2628
442 Ga0495681_0034510 3300047470 Bacteria 2520
443 Ga0495681_0050481 3300047470 Bacteria 1960
444 Ga0495681_0096515 3300047470 Bacteria 1298
445 Ga0495681_0303469 3300047470 Bacteria 617
446 Ga0495684_0060164 3300047471 Bacteria 2892
447 Ga0495686_0089255 3300047472 Bacteria 1873
448 Ga0495686_0178136 3300047472 Bacteria 1233
449 Ga0495686_0314281 3300047472 Bacteria 860
450 Ga0495593_0005954 3300047673 Bacteria 7185
451 Ga0495593_0016560 3300047673 Bacteria 4156
452 Ga0495593_0063073 3300047673 Bacteria 1936
453 Ga0495593_0266131 3300047673 Bacteria 858
454 Ga0495593_0523840 3300047673 Bacteria 594
455 Ga0495615_0096357 3300048090 Bacteria 831
456 Ga0495626_0000372 3300048091 Bacteria 46880
457 Ga0495626_0000801 3300048091 Bacteria 28424
458 Ga0495626_0037585 3300048091 Bacteria 2299
459 Ga0495626_0073587 3300048091 Bacteria 1530
460 Ga0495626_0099692 3300048091 Bacteria 1267
461 Ga0495626_0261115 3300048091 Bacteria 692
462 Ga0496102_0044086 3300048905 Bacteria 4047
463 Ga0496102_0463696 3300048905 Bacteria 1188
464 Ga0496102_1151163 3300048905 Bacteria 695
465 Ga0496103_0429058 3300048906 Bacteria 848
466 Ga0496104_0390981 3300048907 Bacteria 1303
467 Ga0496107_0074668 3300048910 Bacteria 2467
468 Ga0496110_0197052 3300048913 Bacteria 1829
469 Ga0496110_0211225 3300048913 Bacteria 1764
470 Ga0496110_0587563 3300048913 Bacteria 1011
471 Ga0496110_0889979 3300048913 Bacteria 796
472 Ga0496110_1840071 3300048913 Bacteria 515
473 Ga0496111_0069867 3300048914 Bacteria 2554
474 Ga0496111_0201424 3300048914 Bacteria 1480
475 Ga0496112_0097153 3300048915 Bacteria 2916
476 Ga0496117_0087465 3300048920 Bacteria 2020
477 Ga0496117_0340853 3300048920 Bacteria 778
478 Ga0496118_0099889 3300048921 Bacteria 1965
479 Ga0496118_0511395 3300048921 Bacteria 595
480 Ga0496118_0519560 3300048921 Bacteria 588
481 Ga0496121_0003161 3300048924 Bacteria 23741
482 Ga0496121_0060862 3300048924 Bacteria 3103
483 Ga0496121_0096910 3300048924 Bacteria 2287
484 Ga0496122_0006850 3300048925 Bacteria 12911
485 Ga0496123_0010150 3300048926 Bacteria 8364
486 Ga0496124_0001964 3300048927 Bacteria 28105
487 Ga0496124_0013492 3300048927 Bacteria 7973
488 Ga0496124_0258666 3300048927 Bacteria 1283
489 Ga0496124_0269033 3300048927 Bacteria 1249
490 Ga0496125_0011582 3300048928 Bacteria 8811
491 Ga0496125_0036304 3300048928 Bacteria 4307
492 Ga0496125_0048774 3300048928 Bacteria 3526
493 Ga0496125_0108998 3300048928 Bacteria 2012
494 Ga0496126_0799662 3300048929 Bacteria 724
495 Ga0495678_008803 3300049459 Bacteria 5053
496 Ga0495678_012988 3300049459 Bacteria 3926
497 Ga0495678_038567 3300049459 Bacteria 1932
498 Ga0495678_040158 3300049459 Bacteria 1882
499 Ga0495678_078106 3300049459 Bacteria 1195
500 Ga0495678_111759 3300049459 Bacteria 930
501 Ga0495678_152072 3300049459 Bacteria 746
502 Ga0495682_0008429 3300049460 Bacteria 4059
503 Ga0495682_0148721 3300049460 Bacteria 835
504 Ga0495682_0148749 3300049460 Bacteria 835
505 Ga0495682_0209086 3300049460 Bacteria 691
506 Ga0495682_0244633 3300049460 Bacteria 634
507 Ga0501263_025914 3300049760 Bacteria 809
508 Ga0501226_011160 3300049853 Bacteria 994
509 nmdc:mga0a205_875603_c1 3300050515 Bacteria 745
510 Ga0500573_0011219 3300053140 Bacteria 5014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0000914 Ga0495620_0000914_1581_1805 74
2 3300046809 Ga0495600_0216687 Ga0495600_0216687_12_236 74
3 3300047469 Ga0495673_0026388 Ga0495673_0026388_578_802 74
4 iso_pu_bacteria 2511231008 2511275204 74
5 iso_pu_bacteria 2511231019 2511346192 74
6 iso_pu_bacteria 2511231021 2511356770 74
7 iso_pu_bacteria 2599185307 2599974910 74
8 iso_pu_bacteria 2600255283 2601625531 74
9 iso_pu_bacteria 2643221633 2644189444 74
10 iso_pu_bacteria 2738541271 2738689207 74
11 iso_pu_bacteria 2738543016 2739264594 74
12 iso_pu_bacteria 2773857670 2774118726 74
13 iso_pu_bacteria 2784132072 2784312363 74
14 iso_pu_bacteria 2842854478 2842858119 74
15 iso_pu_bacteria 2919456309 2919461190 74
16 iso_pu_bacteria 2939651529 2939655590 74
17 iso_pu_bacteria 3007252601 3007254854 74
18 iso_pu_bacteria 3007419365 3007422349 74
19 iso_pu_bacteria 8055878733 8055881014 74
20 iso_pu_bacteria 8056143049 8056146233 74
21 3300028800 Ga0265338_10072701 Ga0265338_100727012 76
22 3300031240 Ga0265320_10198632 Ga0265320_101986321 76
23 3300031711 Ga0265314_10315190 Ga0265314_103151902 76
24 iso_pu_bacteria 2888373701 2888374009 76
25 3300041405 Ga0439438_000510 Ga0439438_000510_11612_11845 77
26 3300041407 Ga0439447_081749 Ga0439447_081749_448_681 77
27 3300041411 Ga0439466_0003650 Ga0439466_0003650_2990_3223 77
28 3300042010 Ga0439452_000147 Ga0439452_000147_30137_30370 77
29 3300046452 Ga0495617_025231 Ga0495617_025231_1562_1795 77
30 3300046457 Ga0495590_0267296 Ga0495590_0267296_371_604 77
31 3300046458 Ga0495591_002805 Ga0495591_002805_7681_7914 77
32 3300046471 Ga0495650_0001229 Ga0495650_0001229_3939_4172 77
33 3300046474 Ga0495605_0117306 Ga0495605_0117306_553_786 77
34 3300046491 Ga0495584_0004441 Ga0495584_0004441_6304_6537 77
35 3300046492 Ga0495585_0041585 Ga0495585_0041585_1731_1964 77
36 3300046500 Ga0495596_0062384 Ga0495596_0062384_857_1090 77
37 3300046501 Ga0495607_0039856 Ga0495607_0039856_1069_1302 77
38 3300046506 Ga0495583_0001496 Ga0495583_0001496_13118_13351 77
39 3300046507 Ga0495606_0001612 Ga0495606_0001612_3416_3649 77
40 3300046513 Ga0495616_0102906 Ga0495616_0102906_74_307 77
41 3300046515 Ga0495620_0018302 Ga0495620_0018302_2376_2609 77
42 3300046518 Ga0495631_0002523 Ga0495631_0002523_4644_4877 77
43 3300046519 Ga0495632_0001944 Ga0495632_0001944_7366_7599 77
44 3300046520 Ga0495637_0000204 Ga0495637_0000204_25266_25499 77
45 3300046522 Ga0495643_0023309 Ga0495643_0023309_394_627 77
46 3300046523 Ga0495644_0016983 Ga0495644_0016983_359_592 77
47 3300046524 Ga0495648_0005599 Ga0495648_0005599_3630_3863 77
48 3300046530 Ga0495654_0045546 Ga0495654_0045546_1640_1873 77
49 3300046530 Ga0495654_0403508 Ga0495654_0403508_221_454 77
50 3300046538 Ga0495609_0000141 Ga0495609_0000141_65680_65913 77
51 3300046542 Ga0495597_0067625 Ga0495597_0067625_63_296 77
52 3300046616 Ga0495668_0110335 Ga0495668_0110335_901_1134 77
53 3300046648 Ga0495611_0000518 Ga0495611_0000518_8230_8463 77
54 3300046660 Ga0495625_0000145 Ga0495625_0000145_26716_26949 77
55 3300046665 Ga0495661_0000332 Ga0495661_0000332_44587_44820 77
56 3300046691 Ga0495670_0427957 Ga0495670_0427957_57_290 77
57 3300046692 Ga0495671_0108514 Ga0495671_0108514_698_931 77
58 3300046694 Ga0495649_0312443 Ga0495649_0312443_162_395 77
59 3300046810 Ga0495660_0003690 Ga0495660_0003690_7206_7439 77
60 3300047321 Ga0495676_0000198 Ga0495676_0000198_26153_26386 77
61 3300047323 Ga0495683_0011577 Ga0495683_0011577_4049_4282 77
62 3300047446 Ga0495679_001029 Ga0495679_001029_6178_6411 77
63 3300047470 Ga0495681_0016528 Ga0495681_0016528_1701_1934 77
64 3300047472 Ga0495686_0314281 Ga0495686_0314281_58_291 77
65 3300048091 Ga0495626_0000372 Ga0495626_0000372_25256_25489 77
66 3300049459 Ga0495678_040158 Ga0495678_040158_689_922 77
67 2124908027 MRS2a_Contig_8 MRS2a_00655240 78
68 2124908027 MRS2a_Contig_9003 MRS2a_00198660 78
69 3300005288 Ga0065714_10000403 Ga0065714_100004035 78
70 3300005288 Ga0065714_10016458 Ga0065714_100164582 78
71 3300005288 Ga0065714_10041939 Ga0065714_100419391 78
72 3300005288 Ga0065714_10068548 Ga0065714_100685483 78
73 3300005288 Ga0065714_10081838 Ga0065714_100818382 78
74 3300005288 Ga0065714_10114264 Ga0065714_101142641 78
75 3300005288 Ga0065714_10164523 Ga0065714_101645232 78
76 3300005288 Ga0065714_10539108 Ga0065714_105391081 78
77 3300005290 Ga0065712_10020154 Ga0065712_100201542 78
78 3300005293 Ga0065715_10318689 Ga0065715_103186892 78
79 3300005435 Ga0070714_100455112 Ga0070714_1004551122 78
80 3300006058 Ga0075432_10225920 Ga0075432_102259202 78
81 3300009011 Ga0105251_10363657 Ga0105251_103636572 78
82 3300009011 Ga0105251_10559618 Ga0105251_105596181 78
83 3300009036 Ga0105244_10003182 Ga0105244_100031822 78
84 3300009036 Ga0105244_10058748 Ga0105244_100587482 78
85 3300009036 Ga0105244_10086070 Ga0105244_100860702 78
86 3300009036 Ga0105244_10322411 Ga0105244_103224112 78
87 3300009092 Ga0105250_10037679 Ga0105250_100376791 78
88 3300009092 Ga0105250_10110011 Ga0105250_101100112 78
89 3300009148 Ga0105243_11860821 Ga0105243_118608212 78
90 3300013100 Ga0157373_10037483 Ga0157373_100374832 78
91 3300013104 Ga0157370_10001147 Ga0157370_100011475 78
92 3300013104 Ga0157370_10090568 Ga0157370_100905683 78
93 3300013105 Ga0157369_10745544 Ga0157369_107455442 78
94 3300013306 Ga0163162_10324219 Ga0163162_103242193 78
95 3300013306 Ga0163162_13052029 Ga0163162_130520292 78
96 3300013308 Ga0157375_10743367 Ga0157375_107433672 78
97 3300013308 Ga0157375_10925500 Ga0157375_109255002 78
98 3300013308 Ga0157375_12463869 Ga0157375_124638692 78
99 3300014497 Ga0182008_10017721 Ga0182008_100177213 78
100 3300014497 Ga0182008_10037154 Ga0182008_100371542 78
101 3300014497 Ga0182008_10532430 Ga0182008_105324302 78
102 3300015261 Ga0182006_1227926 Ga0182006_12279262 78
103 3300015265 Ga0182005_1006006 Ga0182005_10060063 78
104 3300015265 Ga0182005_1035735 Ga0182005_10357352 78
105 3300015265 Ga0182005_1183291 Ga0182005_11832912 78
106 3300015265 Ga0182005_1233269 Ga0182005_12332692 78
107 3300017792 Ga0163161_10000744 Ga0163161_1000074411 78
108 3300017792 Ga0163161_10029579 Ga0163161_100295794 78
109 3300017792 Ga0163161_10044590 Ga0163161_100445902 78
110 3300017792 Ga0163161_10079296 Ga0163161_100792962 78
111 3300017792 Ga0163161_10325070 Ga0163161_103250702 78
112 3300017792 Ga0163161_11051526 Ga0163161_110515262 78
113 3300025256 Ga0209759_1002797 Ga0209759_10027972 78
114 3300025304 Ga0209257_1012954 Ga0209257_10129543 78
115 3300025728 Ga0207655_1000006 Ga0207655_1000006300 78
116 3300025728 Ga0207655_1023365 Ga0207655_10233654 78
117 3300025728 Ga0207655_1029352 Ga0207655_10293523 78
118 3300025735 Ga0207713_1046078 Ga0207713_10460782 78
119 3300025929 Ga0207664_10454920 Ga0207664_104549202 78
120 3300027907 Ga0207428_11119272 Ga0207428_111192722 78
121 3300028786 Ga0307517_10632331 Ga0307517_106323312 78
122 3300031548 Ga0307408_100000085 Ga0307408_10000008583 78
123 3300031548 Ga0307408_100027559 Ga0307408_1000275594 78
124 3300031548 Ga0307408_101285003 Ga0307408_1012850032 78
125 3300031731 Ga0307405_10103984 Ga0307405_101039842 78
126 3300031731 Ga0307405_10199746 Ga0307405_101997462 78
127 3300031824 Ga0307413_10560492 Ga0307413_105604921 78
128 3300031824 Ga0307413_11748273 Ga0307413_117482731 78
129 3300031911 Ga0307412_10000750 Ga0307412_1000075011 78
130 3300031911 Ga0307412_10001735 Ga0307412_100017358 78
131 3300032004 Ga0307414_10186946 Ga0307414_101869461 78
132 3300032004 Ga0307414_10276518 Ga0307414_102765182 78
133 3300041405 Ga0439438_007096 Ga0439438_007096_391_627 78
134 3300041405 Ga0439438_010116 Ga0439438_010116_1367_1603 78
135 3300041405 Ga0439438_041391 Ga0439438_041391_172_408 78
136 3300041407 Ga0439447_029103 Ga0439447_029103_805_1041 78
137 3300041407 Ga0439447_054131 Ga0439447_054131_487_723 78
138 3300041411 Ga0439466_0000324 Ga0439466_0000324_230_466 78
139 3300041411 Ga0439466_0018773 Ga0439466_0018773_556_792 78
140 3300041462 Ga0451806_464398 Ga0451806_464398_290_526 78
141 3300042006 Ga0439432_005513 Ga0439432_005513_2819_3055 78
142 3300042006 Ga0439432_010614 Ga0439432_010614_1739_1975 78
143 3300042009 Ga0439451_104336 Ga0439451_104336_241_477 78
144 3300042010 Ga0439452_006893 Ga0439452_006893_752_988 78
145 3300042010 Ga0439452_066116 Ga0439452_066116_337_573 78
146 3300042013 Ga0439456_027333 Ga0439456_027333_129_365 78
147 3300042016 Ga0439463_008067 Ga0439463_008067_2072_2308 78
148 3300042016 Ga0439463_036652 Ga0439463_036652_114_350 78
149 3300042016 Ga0439463_042823 Ga0439463_042823_525_761 78
150 3300042115 Ga0450911_011786 Ga0450911_011786_253_489 78
151 3300042137 Ga0450902_055267 Ga0450902_055267_234_470 78
152 3300042138 Ga0450903_026427 Ga0450903_026427_588_824 78
153 3300042139 Ga0450904_035350 Ga0450904_035350_239_475 78
154 3300042146 Ga0450907_000003 Ga0450907_000003_32073_32309 78
155 3300042146 Ga0450907_009783 Ga0450907_009783_708_944 78
156 3300042147 Ga0450910_005646 Ga0450910_005646_783_1019 78
157 3300042156 Ga0439446_0008634 Ga0439446_0008634_588_824 78
158 3300042185 Ga0450909_002386 Ga0450909_002386_860_1096 78
159 3300042435 Ga0439434_0000019 Ga0439434_0000019_9148_9384 78
160 3300042461 Ga0439460_0004859 Ga0439460_0004859_1651_1887 78
161 3300042993 Ga0439440_0000787 Ga0439440_0000787_3918_4154 78
162 3300046452 Ga0495617_069742 Ga0495617_069742_741_977 78
163 3300046452 Ga0495617_084236 Ga0495617_084236_528_764 78
164 3300046452 Ga0495617_087629 Ga0495617_087629_502_738 78
165 3300046452 Ga0495617_104944 Ga0495617_104944_280_516 78
166 3300046453 Ga0495627_000130 Ga0495627_000130_15274_15510 78
167 3300046453 Ga0495627_044739 Ga0495627_044739_842_1078 78
168 3300046455 Ga0495603_0000535 Ga0495603_0000535_16831_17067 78
169 3300046455 Ga0495603_0011885 Ga0495603_0011885_2056_2292 78
170 3300046455 Ga0495603_0154289 Ga0495603_0154289_430_666 78
171 3300046455 Ga0495603_0263707 Ga0495603_0263707_549_785 78
172 3300046455 Ga0495603_0488025 Ga0495603_0488025_334_570 78
173 3300046457 Ga0495590_0012264 Ga0495590_0012264_1520_1756 78
174 3300046457 Ga0495590_0027834 Ga0495590_0027834_620_856 78
175 3300046458 Ga0495591_000606 Ga0495591_000606_8626_8862 78
176 3300046458 Ga0495591_003414 Ga0495591_003414_1806_2042 78
177 3300046458 Ga0495591_011602 Ga0495591_011602_2730_2966 78
178 3300046458 Ga0495591_019926 Ga0495591_019926_1121_1357 78
179 3300046458 Ga0495591_030982 Ga0495591_030982_1344_1580 78
180 3300046458 Ga0495591_078845 Ga0495591_078845_398_634 78
181 3300046459 Ga0495629_0001031 Ga0495629_0001031_17330_17566 78
182 3300046459 Ga0495629_0403637 Ga0495629_0403637_73_309 78
183 3300046460 Ga0495638_0011506 Ga0495638_0011506_415_651 78
184 3300046460 Ga0495638_0026435 Ga0495638_0026435_858_1094 78
185 3300046460 Ga0495638_0087609 Ga0495638_0087609_556_792 78
186 3300046460 Ga0495638_0359551 Ga0495638_0359551_450_686 78
187 3300046463 Ga0495653_0341774 Ga0495653_0341774_92_328 78
188 3300046471 Ga0495650_0002952 Ga0495650_0002952_6199_6435 78
189 3300046471 Ga0495650_0015293 Ga0495650_0015293_1306_1542 78
190 3300046471 Ga0495650_0020295 Ga0495650_0020295_763_999 78
191 3300046471 Ga0495650_0144860 Ga0495650_0144860_470_706 78
192 3300046474 Ga0495605_0000155 Ga0495605_0000155_26944_27180 78
193 3300046474 Ga0495605_0002003 Ga0495605_0002003_10271_10507 78
194 3300046474 Ga0495605_0002096 Ga0495605_0002096_4862_5098 78
195 3300046474 Ga0495605_0005737 Ga0495605_0005737_4272_4508 78
196 3300046474 Ga0495605_0269964 Ga0495605_0269964_71_307 78
197 3300046474 Ga0495605_0292553 Ga0495605_0292553_420_656 78
198 3300046474 Ga0495605_0416838 Ga0495605_0416838_255_491 78
199 3300046475 Ga0495639_0008594 Ga0495639_0008594_243_479 78
200 3300046475 Ga0495639_0049671 Ga0495639_0049671_1156_1392 78
201 3300046477 Ga0495664_0819404 Ga0495664_0819404_128_364 78
202 3300046491 Ga0495584_0000038 Ga0495584_0000038_50271_50507 78
203 3300046491 Ga0495584_0000652 Ga0495584_0000652_19575_19811 78
204 3300046491 Ga0495584_0003752 Ga0495584_0003752_2504_2740 78
205 3300046491 Ga0495584_0011316 Ga0495584_0011316_423_659 78
206 3300046491 Ga0495584_0023194 Ga0495584_0023194_874_1110 78
207 3300046491 Ga0495584_0207679 Ga0495584_0207679_378_614 78
208 3300046491 Ga0495584_0340671 Ga0495584_0340671_425_661 78
209 3300046491 Ga0495584_0695108 Ga0495584_0695108_75_311 78
210 3300046492 Ga0495585_0002340 Ga0495585_0002340_4628_4864 78
211 3300046492 Ga0495585_0055890 Ga0495585_0055890_1312_1548 78
212 3300046492 Ga0495585_0061164 Ga0495585_0061164_774_1010 78
213 3300046492 Ga0495585_0222617 Ga0495585_0222617_351_587 78
214 3300046492 Ga0495585_0239002 Ga0495585_0239002_587_823 78
215 3300046499 Ga0495594_0000712 Ga0495594_0000712_11753_11989 78
216 3300046499 Ga0495594_0004518 Ga0495594_0004518_3897_4133 78
217 3300046499 Ga0495594_0010354 Ga0495594_0010354_2331_2567 78
218 3300046500 Ga0495596_0106478 Ga0495596_0106478_315_551 78
219 3300046501 Ga0495607_0003552 Ga0495607_0003552_11369_11605 78
220 3300046501 Ga0495607_0012853 Ga0495607_0012853_2450_2686 78
221 3300046501 Ga0495607_0017020 Ga0495607_0017020_1154_1390 78
222 3300046501 Ga0495607_0029755 Ga0495607_0029755_3035_3271 78
223 3300046501 Ga0495607_0030640 Ga0495607_0030640_1825_2061 78
224 3300046501 Ga0495607_0089655 Ga0495607_0089655_367_603 78
225 3300046501 Ga0495607_0099090 Ga0495607_0099090_1136_1372 78
226 3300046506 Ga0495583_0000112 Ga0495583_0000112_48873_49109 78
227 3300046506 Ga0495583_0004961 Ga0495583_0004961_6756_6992 78
228 3300046506 Ga0495583_0007952 Ga0495583_0007952_3578_3814 78
229 3300046506 Ga0495583_0023726 Ga0495583_0023726_1459_1695 78
230 3300046506 Ga0495583_0045612 Ga0495583_0045612_236_472 78
231 3300046506 Ga0495583_0087519 Ga0495583_0087519_990_1226 78
232 3300046507 Ga0495606_0002913 Ga0495606_0002913_8841_9077 78
233 3300046507 Ga0495606_0009900 Ga0495606_0009900_4755_4991 78
234 3300046512 Ga0495610_0006941 Ga0495610_0006941_2313_2549 78
235 3300046512 Ga0495610_0017656 Ga0495610_0017656_3530_3766 78
236 3300046512 Ga0495610_0039198 Ga0495610_0039198_785_1021 78
237 3300046512 Ga0495610_0082846 Ga0495610_0082846_357_593 78
238 3300046512 Ga0495610_0265866 Ga0495610_0265866_14_250 78
239 3300046513 Ga0495616_0000730 Ga0495616_0000730_4862_5098 78
240 3300046513 Ga0495616_0010972 Ga0495616_0010972_1897_2133 78
241 3300046513 Ga0495616_0013688 Ga0495616_0013688_4004_4240 78
242 3300046513 Ga0495616_0020371 Ga0495616_0020371_1104_1340 78
243 3300046513 Ga0495616_0030928 Ga0495616_0030928_327_563 78
244 3300046515 Ga0495620_0010304 Ga0495620_0010304_1879_2115 78
245 3300046515 Ga0495620_0416424 Ga0495620_0416424_87_323 78
246 3300046516 Ga0495628_0109007 Ga0495628_0109007_1345_1581 78
247 3300046517 Ga0495630_0014349 Ga0495630_0014349_3988_4224 78
248 3300046518 Ga0495631_0000005 Ga0495631_0000005_146391_146627 78
249 3300046518 Ga0495631_0031778 Ga0495631_0031778_247_483 78
250 3300046518 Ga0495631_0157748 Ga0495631_0157748_358_594 78
251 3300046519 Ga0495632_0000058 Ga0495632_0000058_68771_69007 78
252 3300046519 Ga0495632_0027781 Ga0495632_0027781_1153_1389 78
253 3300046519 Ga0495632_0062481 Ga0495632_0062481_190_426 78
254 3300046519 Ga0495632_0314804 Ga0495632_0314804_168_404 78
255 3300046520 Ga0495637_0001432 Ga0495637_0001432_4909_5145 78
256 3300046520 Ga0495637_0001868 Ga0495637_0001868_3619_3855 78
257 3300046520 Ga0495637_0004037 Ga0495637_0004037_3290_3526 78
258 3300046520 Ga0495637_0029709 Ga0495637_0029709_304_540 78
259 3300046520 Ga0495637_0091821 Ga0495637_0091821_90_326 78
260 3300046520 Ga0495637_0235589 Ga0495637_0235589_90_326 78
261 3300046522 Ga0495643_0017733 Ga0495643_0017733_1028_1264 78
262 3300046522 Ga0495643_0029724 Ga0495643_0029724_702_938 78
263 3300046522 Ga0495643_0055138 Ga0495643_0055138_301_537 78
264 3300046522 Ga0495643_0160156 Ga0495643_0160156_475_711 78
265 3300046522 Ga0495643_0186741 Ga0495643_0186741_373_609 78
266 3300046523 Ga0495644_0080023 Ga0495644_0080023_971_1207 78
267 3300046523 Ga0495644_0108987 Ga0495644_0108987_596_832 78
268 3300046524 Ga0495648_0000392 Ga0495648_0000392_41506_41742 78
269 3300046524 Ga0495648_0027196 Ga0495648_0027196_597_833 78
270 3300046524 Ga0495648_0080313 Ga0495648_0080313_178_414 78
271 3300046524 Ga0495648_0092493 Ga0495648_0092493_1428_1664 78
272 3300046524 Ga0495648_0100798 Ga0495648_0100798_685_921 78
273 3300046524 Ga0495648_0143442 Ga0495648_0143442_736_972 78
274 3300046524 Ga0495648_0334965 Ga0495648_0334965_102_338 78
275 3300046526 Ga0495666_0003043 Ga0495666_0003043_6666_6902 78
276 3300046526 Ga0495666_0003373 Ga0495666_0003373_1158_1394 78
277 3300046526 Ga0495666_0128424 Ga0495666_0128424_160_396 78
278 3300046528 Ga0495642_0000003 Ga0495642_0000003_64680_64916 78
279 3300046529 Ga0495652_0354926 Ga0495652_0354926_295_531 78
280 3300046530 Ga0495654_0009800 Ga0495654_0009800_4361_4597 78
281 3300046530 Ga0495654_0026438 Ga0495654_0026438_2283_2519 78
282 3300046530 Ga0495654_0038356 Ga0495654_0038356_1047_1283 78
283 3300046530 Ga0495654_0265348 Ga0495654_0265348_118_354 78
284 3300046530 Ga0495654_0336391 Ga0495654_0336391_279_515 78
285 3300046535 Ga0495586_0356357 Ga0495586_0356357_286_522 78
286 3300046538 Ga0495609_0002893 Ga0495609_0002893_6177_6413 78
287 3300046538 Ga0495609_0008493 Ga0495609_0008493_4581_4817 78
288 3300046538 Ga0495609_0062433 Ga0495609_0062433_1148_1384 78
289 3300046538 Ga0495609_0100539 Ga0495609_0100539_338_574 78
290 3300046542 Ga0495597_0003145 Ga0495597_0003145_3469_3705 78
291 3300046542 Ga0495597_0009895 Ga0495597_0009895_3473_3709 78
292 3300046542 Ga0495597_0042286 Ga0495597_0042286_18_254 78
293 3300046542 Ga0495597_0050941 Ga0495597_0050941_1461_1697 78
294 3300046542 Ga0495597_0066998 Ga0495597_0066998_896_1132 78
295 3300046542 Ga0495597_0103946 Ga0495597_0103946_865_1101 78
296 3300046543 Ga0495645_0045985 Ga0495645_0045985_1703_1939 78
297 3300046557 Ga0495622_0000612 Ga0495622_0000612_16651_16887 78
298 3300046557 Ga0495622_0036963 Ga0495622_0036963_719_955 78
299 3300046557 Ga0495622_0066181 Ga0495622_0066181_1339_1575 78
300 3300046557 Ga0495622_0148275 Ga0495622_0148275_442_678 78
301 3300046558 Ga0495633_0008376 Ga0495633_0008376_925_1161 78
302 3300046558 Ga0495633_0035290 Ga0495633_0035290_1786_2022 78
303 3300046615 Ga0495656_0005248 Ga0495656_0005248_3993_4229 78
304 3300046615 Ga0495656_0288966 Ga0495656_0288966_425_661 78
305 3300046615 Ga0495656_0299765 Ga0495656_0299765_236_472 78
306 3300046616 Ga0495668_0003802 Ga0495668_0003802_4305_4541 78
307 3300046616 Ga0495668_0047933 Ga0495668_0047933_784_1020 78
308 3300046642 Ga0495634_0032251 Ga0495634_0032251_885_1121 78
309 3300046648 Ga0495611_0007062 Ga0495611_0007062_199_435 78
310 3300046648 Ga0495611_0016592 Ga0495611_0016592_499_735 78
311 3300046660 Ga0495625_0002980 Ga0495625_0002980_12525_12761 78
312 3300046660 Ga0495625_0050586 Ga0495625_0050586_1324_1560 78
313 3300046660 Ga0495625_0528497 Ga0495625_0528497_246_482 78
314 3300046663 Ga0495635_0279894 Ga0495635_0279894_365_601 78
315 3300046664 Ga0495659_0001085 Ga0495659_0001085_2850_3086 78
316 3300046664 Ga0495659_0008956 Ga0495659_0008956_513_749 78
317 3300046664 Ga0495659_0161673 Ga0495659_0161673_21_257 78
318 3300046665 Ga0495661_0006372 Ga0495661_0006372_4545_4781 78
319 3300046665 Ga0495661_0008324 Ga0495661_0008324_683_919 78
320 3300046665 Ga0495661_0056042 Ga0495661_0056042_127_363 78
321 3300046665 Ga0495661_0226496 Ga0495661_0226496_454_690 78
322 3300046665 Ga0495661_0420063 Ga0495661_0420063_232_468 78
323 3300046674 Ga0495588_0003722 Ga0495588_0003722_2222_2458 78
324 3300046674 Ga0495588_0017884 Ga0495588_0017884_1346_1582 78
325 3300046674 Ga0495588_0079076 Ga0495588_0079076_54_290 78
326 3300046674 Ga0495588_0311607 Ga0495588_0311607_96_332 78
327 3300046675 Ga0495657_0220037 Ga0495657_0220037_731_967 78
328 3300046679 Ga0495623_0002926 Ga0495623_0002926_4693_4929 78
329 3300046680 Ga0495646_0493346 Ga0495646_0493346_48_284 78
330 3300046684 Ga0495669_0010808 Ga0495669_0010808_3083_3319 78
331 3300046684 Ga0495669_0085482 Ga0495669_0085482_14_250 78
332 3300046684 Ga0495669_0284170 Ga0495669_0284170_14_250 78
333 3300046691 Ga0495670_0000120 Ga0495670_0000120_27965_28201 78
334 3300046691 Ga0495670_0017891 Ga0495670_0017891_1318_1554 78
335 3300046691 Ga0495670_0155883 Ga0495670_0155883_625_861 78
336 3300046691 Ga0495670_0382607 Ga0495670_0382607_447_683 78
337 3300046691 Ga0495670_0419929 Ga0495670_0419929_297_533 78
338 3300046692 Ga0495671_0001805 Ga0495671_0001805_4593_4829 78
339 3300046692 Ga0495671_0010103 Ga0495671_0010103_4742_4978 78
340 3300046692 Ga0495671_0015533 Ga0495671_0015533_2443_2679 78
341 3300046692 Ga0495671_0051279 Ga0495671_0051279_921_1157 78
342 3300046692 Ga0495671_0067621 Ga0495671_0067621_679_915 78
343 3300046692 Ga0495671_0090067 Ga0495671_0090067_1174_1410 78
344 3300046692 Ga0495671_0102856 Ga0495671_0102856_130_366 78
345 3300046692 Ga0495671_0221101 Ga0495671_0221101_280_516 78
346 3300046694 Ga0495649_0007033 Ga0495649_0007033_4478_4714 78
347 3300046694 Ga0495649_0024674 Ga0495649_0024674_687_923 78
348 3300046694 Ga0495649_0024751 Ga0495649_0024751_1438_1674 78
349 3300046694 Ga0495649_0093755 Ga0495649_0093755_172_408 78
350 3300046694 Ga0495649_0368335 Ga0495649_0368335_220_456 78
351 3300046794 Ga0495589_0002000 Ga0495589_0002000_4878_5114 78
352 3300046794 Ga0495589_0008458 Ga0495589_0008458_2321_2557 78
353 3300046794 Ga0495589_0339602 Ga0495589_0339602_407_643 78
354 3300046809 Ga0495600_0028197 Ga0495600_0028197_1230_1466 78
355 3300046810 Ga0495660_0004097 Ga0495660_0004097_3143_3379 78
356 3300046810 Ga0495660_0005016 Ga0495660_0005016_1425_1661 78
357 3300046810 Ga0495660_0018950 Ga0495660_0018950_2177_2413 78
358 3300046810 Ga0495660_0035951 Ga0495660_0035951_2246_2482 78
359 3300046810 Ga0495660_0084393 Ga0495660_0084393_170_406 78
360 3300046810 Ga0495660_0088628 Ga0495660_0088628_1358_1594 78
361 3300046810 Ga0495660_0142034 Ga0495660_0142034_940_1176 78
362 3300046810 Ga0495660_0173449 Ga0495660_0173449_533_769 78
363 3300046810 Ga0495660_0230810 Ga0495660_0230810_584_820 78
364 3300047315 Ga0495581_0012448 Ga0495581_0012448_1451_1687 78
365 3300047317 Ga0495604_0001437 Ga0495604_0001437_13499_13735 78
366 3300047317 Ga0495604_0009038 Ga0495604_0009038_5163_5399 78
367 3300047318 Ga0495636_0053670 Ga0495636_0053670_169_405 78
368 3300047318 Ga0495636_0094270 Ga0495636_0094270_879_1115 78
369 3300047318 Ga0495636_0126682 Ga0495636_0126682_152_388 78
370 3300047318 Ga0495636_0328119 Ga0495636_0328119_359_595 78
371 3300047319 Ga0495674_0599281 Ga0495674_0599281_590_826 78
372 3300047320 Ga0495672_0000261 Ga0495672_0000261_5750_5986 78
373 3300047320 Ga0495672_0011943 Ga0495672_0011943_1313_1549 78
374 3300047320 Ga0495672_0012301 Ga0495672_0012301_52_288 78
375 3300047320 Ga0495672_0013408 Ga0495672_0013408_325_561 78
376 3300047320 Ga0495672_0096570 Ga0495672_0096570_375_611 78
377 3300047320 Ga0495672_0124593 Ga0495672_0124593_940_1176 78
378 3300047320 Ga0495672_0176623 Ga0495672_0176623_83_319 78
379 3300047322 Ga0495680_0001302 Ga0495680_0001302_19287_19523 78
380 3300047322 Ga0495680_0009213 Ga0495680_0009213_6044_6280 78
381 3300047322 Ga0495680_0121763 Ga0495680_0121763_334_570 78
382 3300047322 Ga0495680_0157922 Ga0495680_0157922_1079_1315 78
383 3300047323 Ga0495683_0000010 Ga0495683_0000010_181703_181939 78
384 3300047323 Ga0495683_0006853 Ga0495683_0006853_4529_4765 78
385 3300047323 Ga0495683_0030683 Ga0495683_0030683_2244_2480 78
386 3300047323 Ga0495683_0093005 Ga0495683_0093005_985_1221 78
387 3300047323 Ga0495683_0173766 Ga0495683_0173766_235_471 78
388 3300047445 Ga0495677_0001539 Ga0495677_0001539_6356_6592 78
389 3300047446 Ga0495679_007523 Ga0495679_007523_1407_1643 78
390 3300047446 Ga0495679_027510 Ga0495679_027510_119_355 78
391 3300047447 Ga0495685_049282 Ga0495685_049282_907_1143 78
392 3300047469 Ga0495673_0000242 Ga0495673_0000242_68552_68788 78
393 3300047469 Ga0495673_0000407 Ga0495673_0000407_6289_6525 78
394 3300047469 Ga0495673_0003142 Ga0495673_0003142_21_257 78
395 3300047469 Ga0495673_0007995 Ga0495673_0007995_2500_2736 78
396 3300047469 Ga0495673_0009555 Ga0495673_0009555_4095_4331 78
397 3300047469 Ga0495673_0010298 Ga0495673_0010298_1977_2213 78
398 3300047469 Ga0495673_0050969 Ga0495673_0050969_546_782 78
399 3300047469 Ga0495673_0074377 Ga0495673_0074377_278_514 78
400 3300047469 Ga0495673_0116800 Ga0495673_0116800_43_279 78
401 3300047469 Ga0495673_0147358 Ga0495673_0147358_360_596 78
402 3300047470 Ga0495681_0000134 Ga0495681_0000134_44662_44898 78
403 3300047470 Ga0495681_0004485 Ga0495681_0004485_6262_6498 78
404 3300047470 Ga0495681_0022655 Ga0495681_0022655_1689_1925 78
405 3300047470 Ga0495681_0032466 Ga0495681_0032466_1064_1300 78
406 3300047470 Ga0495681_0034510 Ga0495681_0034510_1962_2198 78
407 3300047470 Ga0495681_0050481 Ga0495681_0050481_527_763 78
408 3300047470 Ga0495681_0096515 Ga0495681_0096515_980_1216 78
409 3300047470 Ga0495681_0303469 Ga0495681_0303469_120_356 78
410 3300047471 Ga0495684_0060164 Ga0495684_0060164_1953_2189 78
411 3300047472 Ga0495686_0089255 Ga0495686_0089255_1624_1860 78
412 3300047472 Ga0495686_0178136 Ga0495686_0178136_841_1077 78
413 3300047673 Ga0495593_0005954 Ga0495593_0005954_1071_1307 78
414 3300047673 Ga0495593_0016560 Ga0495593_0016560_1590_1826 78
415 3300047673 Ga0495593_0063073 Ga0495593_0063073_869_1105 78
416 3300047673 Ga0495593_0266131 Ga0495593_0266131_348_584 78
417 3300047673 Ga0495593_0523840 Ga0495593_0523840_318_554 78
418 3300048090 Ga0495615_0096357 Ga0495615_0096357_361_597 78
419 3300048091 Ga0495626_0000801 Ga0495626_0000801_15076_15312 78
420 3300048091 Ga0495626_0037585 Ga0495626_0037585_752_988 78
421 3300048091 Ga0495626_0073587 Ga0495626_0073587_1165_1401 78
422 3300048091 Ga0495626_0099692 Ga0495626_0099692_31_267 78
423 3300048091 Ga0495626_0261115 Ga0495626_0261115_77_313 78
424 3300048905 Ga0496102_0044086 Ga0496102_0044086_3398_3634 78
425 3300048905 Ga0496102_0463696 Ga0496102_0463696_14_250 78
426 3300048905 Ga0496102_1151163 Ga0496102_1151163_92_328 78
427 3300048906 Ga0496103_0429058 Ga0496103_0429058_141_377 78
428 3300048907 Ga0496104_0390981 Ga0496104_0390981_721_957 78
429 3300048913 Ga0496110_0197052 Ga0496110_0197052_358_594 78
430 3300048913 Ga0496110_0211225 Ga0496110_0211225_673_909 78
431 3300048913 Ga0496110_0587563 Ga0496110_0587563_577_813 78
432 3300048913 Ga0496110_1840071 Ga0496110_1840071_104_340 78
433 3300048914 Ga0496111_0069867 Ga0496111_0069867_1943_2179 78
434 3300048914 Ga0496111_0201424 Ga0496111_0201424_978_1214 78
435 3300048915 Ga0496112_0097153 Ga0496112_0097153_1978_2214 78
436 3300048920 Ga0496117_0087465 Ga0496117_0087465_347_583 78
437 3300048920 Ga0496117_0340853 Ga0496117_0340853_272_508 78
438 3300048921 Ga0496118_0099889 Ga0496118_0099889_1059_1295 78
439 3300048921 Ga0496118_0511395 Ga0496118_0511395_246_482 78
440 3300048921 Ga0496118_0519560 Ga0496118_0519560_266_502 78
441 3300048924 Ga0496121_0003161 Ga0496121_0003161_9887_10123 78
442 3300048924 Ga0496121_0060862 Ga0496121_0060862_2687_2923 78
443 3300048924 Ga0496121_0096910 Ga0496121_0096910_1284_1520 78
444 3300048925 Ga0496122_0006850 Ga0496122_0006850_3655_3891 78
445 3300048926 Ga0496123_0010150 Ga0496123_0010150_2464_2700 78
446 3300048927 Ga0496124_0001964 Ga0496124_0001964_11770_12006 78
447 3300048927 Ga0496124_0013492 Ga0496124_0013492_3783_4019 78
448 3300048927 Ga0496124_0258666 Ga0496124_0258666_875_1111 78
449 3300048927 Ga0496124_0269033 Ga0496124_0269033_342_578 78
450 3300048928 Ga0496125_0011582 Ga0496125_0011582_1559_1795 78
451 3300048928 Ga0496125_0036304 Ga0496125_0036304_1070_1306 78
452 3300048928 Ga0496125_0048774 Ga0496125_0048774_1465_1701 78
453 3300048928 Ga0496125_0108998 Ga0496125_0108998_1252_1488 78
454 3300048929 Ga0496126_0799662 Ga0496126_0799662_11_247 78
455 3300049459 Ga0495678_008803 Ga0495678_008803_2557_2793 78
456 3300049459 Ga0495678_012988 Ga0495678_012988_108_344 78
457 3300049459 Ga0495678_038567 Ga0495678_038567_573_809 78
458 3300049459 Ga0495678_078106 Ga0495678_078106_799_1035 78
459 3300049459 Ga0495678_111759 Ga0495678_111759_103_339 78
460 3300049459 Ga0495678_152072 Ga0495678_152072_127_363 78
461 3300049460 Ga0495682_0008429 Ga0495682_0008429_2178_2414 78
462 3300049460 Ga0495682_0148721 Ga0495682_0148721_178_414 78
463 3300049460 Ga0495682_0148749 Ga0495682_0148749_422_658 78
464 3300049460 Ga0495682_0209086 Ga0495682_0209086_382_618 78
465 3300049460 Ga0495682_0244633 Ga0495682_0244633_325_561 78
466 3300049760 Ga0501263_025914 Ga0501263_025914_19_255 78
467 3300049853 Ga0501226_011160 Ga0501226_011160_401_637 78
468 3300053140 Ga0500573_0011219 Ga0500573_0011219_3780_4016 78
469 3300005548 Ga0070665_100559428 Ga0070665_1005594282 79
470 3300005842 Ga0068858_100225354 Ga0068858_1002253542 79
471 3300009545 Ga0105237_11379529 Ga0105237_113795292 79
472 3300026035 Ga0207703_10149167 Ga0207703_101491672 79
473 3300005327 Ga0070658_10039919 Ga0070658_100399192 80
474 3300005344 Ga0070661_100573959 Ga0070661_1005739592 80
475 3300005539 Ga0068853_100198143 Ga0068853_1001981432 80
476 3300005563 Ga0068855_100115201 Ga0068855_1001152014 80
477 3300005577 Ga0068857_100897436 Ga0068857_1008974362 80
478 3300005578 Ga0068854_100079622 Ga0068854_1000796222 80
479 3300005614 Ga0068856_100115570 Ga0068856_1001155702 80
480 3300005616 Ga0068852_100359556 Ga0068852_1003595562 80
481 3300005834 Ga0068851_10022953 Ga0068851_100229533 80
482 3300009174 Ga0105241_10877008 Ga0105241_108770082 80
483 3300013307 Ga0157372_10200901 Ga0157372_102009012 80
484 3300025321 Ga0207656_10047750 Ga0207656_100477502 80
485 3300025911 Ga0207654_10014996 Ga0207654_100149962 80
486 3300025920 Ga0207649_11455334 Ga0207649_114553342 80
487 3300025949 Ga0207667_10855944 Ga0207667_108559442 80
488 3300025981 Ga0207640_10778380 Ga0207640_107783802 80
489 3300026078 Ga0207702_10247312 Ga0207702_102473122 80
490 3300046678 Ga0495599_0715842 Ga0495599_0715842_182_424 80
491 3300003323 rootH1_10211760 rootH1_102117602 81
492 3300005329 Ga0070683_100265656 Ga0070683_1002656562 81
493 3300005329 Ga0070683_100644370 Ga0070683_1006443702 81
494 3300005355 Ga0070671_100069088 Ga0070671_1000690882 81
495 3300005434 Ga0070709_10418637 Ga0070709_104186371 81
496 3300005436 Ga0070713_101179129 Ga0070713_1011791292 81
497 3300005437 Ga0070710_11134126 Ga0070710_111341261 81
498 3300005439 Ga0070711_100002406 Ga0070711_1000024066 81
499 3300005439 Ga0070711_101431366 Ga0070711_1014313662 81
500 3300005536 Ga0070697_101816549 Ga0070697_1018165492 81
501 3300006163 Ga0070715_10005678 Ga0070715_100056781 81
502 3300006173 Ga0070716_100003303 Ga0070716_1000033037 81
503 3300006175 Ga0070712_100002207 Ga0070712_1000022074 81
504 3300006178 Ga0075367_10692052 Ga0075367_106920522 81
505 3300025898 Ga0207692_11026229 Ga0207692_110262292 81
506 3300025905 Ga0207685_10229796 Ga0207685_102297962 81
507 3300025906 Ga0207699_10370551 Ga0207699_103705511 81
508 3300025915 Ga0207693_10000241 Ga0207693_1000024114 81
509 3300025916 Ga0207663_10005184 Ga0207663_100051844 81
510 3300025931 Ga0207644_10056599 Ga0207644_100565993 81
511 3300025939 Ga0207665_10048755 Ga0207665_100487553 81
512 3300042156 Ga0439446_0244761 Ga0439446_0244761_125_397 81
513 2124908026 MRS1a_Contig_2496 MRS1a_00071530 82
514 2124908027 MRS2a_Contig_27032 MRS2a_00219890 82
515 3300005288 Ga0065714_10064425 Ga0065714_10064425141 82
516 3300005536 Ga0070697_100414864 Ga0070697_1004148642 82
517 3300005549 Ga0070704_100813314 Ga0070704_1008133142 82
518 3300006852 Ga0075433_10829906 Ga0075433_108299062 82
519 3300009174 Ga0105241_11162200 Ga0105241_111622001 82
520 3300010375 Ga0105239_10767348 Ga0105239_107673482 82
521 3300013308 Ga0157375_10304095 Ga0157375_103040952 82
522 3300025911 Ga0207654_10944939 Ga0207654_109449392 82
523 3300025911 Ga0207654_11147830 Ga0207654_111478302 82
524 3300028800 Ga0265338_10001207 Ga0265338_1000120725 82
525 3300031238 Ga0265332_10013626 Ga0265332_100136262 82
526 3300048910 Ga0496107_0074668 Ga0496107_0074668_2064_2312 82
527 3300048913 Ga0496110_0889979 Ga0496110_0889979_122_385 82
528 3300050515 nmdc:mga0a205_875603_c1 nmdc:mga0a205_875603_c1_416_664 82

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13510

Fer2_4

2Fe-2S iron-sulfur cluster binding domain

3

89

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y56-assembly1.cif.gz_A crystal structure of l-proline dehydrogenase from p.horikoshii 0.8184 3 79
6tg9-assembly1.cif.gz_A cryo-em structure of nadh reduced form of nad+-dependent formate dehydrogenase from rhodobacter capsulatus 0.7928 3 82
7zmb-assembly1.cif.gz_A cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) 0.7818 3 82
7arb-assembly1.cif.gz_G cryo-em structure of arabidopsis thaliana complex-i (complete composition) 0.7762 3 82
3drz-assembly1.cif.gz_D x-ray crystal structure of the n-terminal btb domain of human kctd5 protein 0.7736 3 17
ID Description Score Start End Superfamily
af_C9JR72_7_137_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.9706 3 16 3.30.710.10
af_Q4DHU2_112_236_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.8882 3 17 3.30.710.10
af_A0A0P0XDJ3_166_290_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.8693 5 17 3.30.710.10
af_A4I6P3_2_81_3.10.120.10 Alpha Beta;Roll;Flavocytochrome B2; Chain A, domain 1;Cytochrome b5-like heme/steroid binding domain 0.8566 4 17 3.10.120.10
af_Q9XUR6_17_121_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.8441 3 17 3.30.710.10
ID Description Score Start End GO Terms
AF-A0A420A1I3-F1-model_v4 2Fe-2S iron-sulfur cluster protein 0.8892 2 81 GO:0016491
GO:0051536
AF-A0A848E7S3-F1-model_v4 (2Fe-2S)-binding protein 0.8891 2 80 GO:0016491
GO:0051536
AF-A0A420D1Y2-F1-model_v4 2Fe-2S iron-sulfur cluster protein 0.8862 3 80 GO:0016491
GO:0051536
AF-A0A831X183-F1-model_v4 (2Fe-2S)-binding protein 0.8861 5 82 GO:0016491
GO:0051536
AF-A0A098UGD7-F1-model_v4 deleted 0.885 5 80

Feature Viewer

pLDDT pTM Quality
84.15 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map