F459541

General Info

Members Datasets Scaffolds Average Seq Length
527 216 1054 180

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10013964|Ga0207645_100139645
Length 214
Sequence MIKLTPVERAALRAEAHGLNPVVMIGEAGLTEAVLKEISSSLDAHGLIKVRVFGDDRGFFYESWNRRAFAAAGIAAEFVQDNHSRSRRGVLRGLHYQVEHAQGKLVRAVAGEVFDVAVDLRRSSPTFGKSMGCVLSAVNKHMLWVPPGFAHGFLVLSDDAEFLYKTTDYWYPEHERTLLWNDPALAIAWPLAGEPILAAKDAAGKKLSVADTYA

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
216 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.19
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 2.85
Rhizosphere 93.74
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10013964 3300025907 Bacteria 5386
2 Ga0055524_1010488 3300003775 Bacteria 3684
3 Ga0055536_1000650 3300003781 Bacteria 23543
4 Ga0055528_1005787 3300003790 Bacteria 5688
5 Ga0065715_10105220 3300005293 Bacteria 2907
6 Ga0065715_10472004 3300005293 Bacteria 805
7 Ga0070658_10009240 3300005327 Bacteria 7925
8 Ga0070658_10049976 3300005327 Bacteria 3389
9 Ga0070676_10007082 3300005328 Bacteria 6003
10 Ga0070676_10025098 3300005328 Bacteria 3366
11 Ga0070676_10028795 3300005328 Bacteria 3155
12 Ga0070676_10088830 3300005328 Bacteria 1889
13 Ga0070676_10105038 3300005328 Bacteria 1751
14 Ga0070690_100182643 3300005330 Bacteria 1450
15 Ga0070690_100288133 3300005330 Bacteria 1174
16 Ga0070670_100000664 3300005331 Bacteria 26740
17 Ga0070670_100003976 3300005331 Bacteria 12342
18 Ga0070670_100011387 3300005331 Bacteria 7605
19 Ga0070670_100050132 3300005331 Bacteria 3588
20 Ga0070670_100058637 3300005331 Bacteria 3305
21 Ga0070670_100076437 3300005331 Bacteria 2877
22 Ga0070670_100092481 3300005331 Bacteria 2601
23 Ga0070670_100155851 3300005331 Bacteria 1978
24 Ga0070670_100179265 3300005331 Bacteria 1839
25 Ga0070670_100404229 3300005331 Bacteria 1206
26 Ga0070677_10141225 3300005333 Bacteria 1111
27 Ga0068869_100015323 3300005334 Bacteria 5139
28 Ga0068869_100036622 3300005334 Bacteria 3484
29 Ga0068869_100093106 3300005334 Bacteria 2270
30 Ga0068869_100543682 3300005334 Bacteria 975
31 Ga0070666_10001855 3300005335 Bacteria 12877
32 Ga0070666_10083750 3300005335 Bacteria 2182
33 Ga0070666_10151739 3300005335 Bacteria 1616
34 Ga0070666_10517483 3300005335 Bacteria 866
35 Ga0068868_100008340 3300005338 Bacteria 7416
36 Ga0068868_100046661 3300005338 Bacteria 3392
37 Ga0070660_100002776 3300005339 Bacteria 12017
38 Ga0070689_100153716 3300005340 Bacteria 1857
39 Ga0070689_100329336 3300005340 Bacteria 1277
40 Ga0070689_100738471 3300005340 Bacteria 862
41 Ga0070687_100376640 3300005343 Bacteria 924
42 Ga0070668_100013680 3300005347 Bacteria 6058
43 Ga0070668_100017915 3300005347 Bacteria 5312
44 Ga0070668_100030137 3300005347 Bacteria 4124
45 Ga0070668_100172145 3300005347 Bacteria 1763
46 Ga0070669_100003297 3300005353 Bacteria 11604
47 Ga0070669_100004906 3300005353 Bacteria 9656
48 Ga0070669_100021977 3300005353 Bacteria 4562
49 Ga0070669_100164374 3300005353 Bacteria 1727
50 Ga0070669_100174680 3300005353 Bacteria 1677
51 Ga0070669_100200449 3300005353 Bacteria 1570
52 Ga0070675_100015441 3300005354 Bacteria 6038
53 Ga0070675_100023095 3300005354 Bacteria 4970
54 Ga0070675_100067059 3300005354 Bacteria 2969
55 Ga0070675_100084336 3300005354 Bacteria 2653
56 Ga0070675_100633530 3300005354 Bacteria 971
57 Ga0070671_100044249 3300005355 Bacteria 3699
58 Ga0070671_100094936 3300005355 Bacteria 2500
59 Ga0070671_100116583 3300005355 Bacteria 2245
60 Ga0070671_100737092 3300005355 Bacteria 856
61 Ga0070674_100045888 3300005356 Bacteria 2987
62 Ga0070674_100093680 3300005356 Bacteria 2174
63 Ga0070674_100503194 3300005356 Bacteria 1009
64 Ga0070674_100877775 3300005356 Bacteria 780
65 Ga0070673_100009420 3300005364 Bacteria 6554
66 Ga0070673_100126647 3300005364 Bacteria 2138
67 Ga0070673_100220362 3300005364 Bacteria 1642
68 Ga0070673_100332659 3300005364 Bacteria 1344
69 Ga0070673_100621561 3300005364 Bacteria 987
70 Ga0070673_100663234 3300005364 Bacteria 956
71 Ga0070673_100964521 3300005364 Bacteria 793
72 Ga0070688_100398663 3300005365 Bacteria 1018
73 Ga0070659_100106481 3300005366 Bacteria 2260
74 Ga0070667_100004609 3300005367 Bacteria 11576
75 Ga0070667_100006526 3300005367 Bacteria 9694
76 Ga0070667_100009405 3300005367 Bacteria 8108
77 Ga0070667_100060649 3300005367 Bacteria 3201
78 Ga0070667_100063570 3300005367 Bacteria 3128
79 Ga0070667_100454499 3300005367 Bacteria 1171
80 Ga0070711_100178609 3300005439 Bacteria 1624
81 Ga0070694_100937536 3300005444 Bacteria 716
82 Ga0070708_100000773 3300005445 Bacteria 24034
83 Ga0070708_100050964 3300005445 Bacteria 3667
84 Ga0070678_100004731 3300005456 Bacteria 7757
85 Ga0070678_100022652 3300005456 Bacteria 4168
86 Ga0070678_100105885 3300005456 Bacteria 2190
87 Ga0070678_100114505 3300005456 Bacteria 2115
88 Ga0070678_100122971 3300005456 Bacteria 2049
89 Ga0070662_100258048 3300005457 Bacteria 1403
90 Ga0068867_100012058 3300005459 Bacteria 6106
91 Ga0068867_100015274 3300005459 Bacteria 5443
92 Ga0068867_100059268 3300005459 Bacteria 2838
93 Ga0068867_100086845 3300005459 Bacteria 2367
94 Ga0068867_100325254 3300005459 Bacteria 1275
95 Ga0068867_101021639 3300005459 Bacteria 751
96 Ga0070685_10244806 3300005466 Bacteria 1185
97 Ga0070685_10342210 3300005466 Bacteria 1020
98 Ga0070698_100367763 3300005471 Bacteria 1370
99 Ga0070684_100043961 3300005535 Bacteria 3861
100 Ga0070684_100908181 3300005535 Bacteria 825
101 Ga0070672_100033175 3300005543 Bacteria 3907
102 Ga0070672_100044917 3300005543 Bacteria 3414
103 Ga0070672_100051002 3300005543 Bacteria 3225
104 Ga0070672_100058174 3300005543 Bacteria 3037
105 Ga0070672_100212580 3300005543 Bacteria 1620
106 Ga0070672_100391476 3300005543 Bacteria 1190
107 Ga0070672_100877810 3300005543 Bacteria 792
108 Ga0070686_100275684 3300005544 Bacteria 1238
109 Ga0070686_100582663 3300005544 Bacteria 879
110 Ga0070695_100113879 3300005545 Bacteria 1840
111 Ga0070695_100319796 3300005545 Bacteria 1153
112 Ga0070696_100117889 3300005546 Bacteria 1919
113 Ga0070696_101207314 3300005546 Bacteria 639
114 Ga0070693_100207837 3300005547 Bacteria 1275
115 Ga0070665_100006019 3300005548 Bacteria 12402
116 Ga0070665_100010735 3300005548 Bacteria 9267
117 Ga0070665_100034923 3300005548 Bacteria 5058
118 Ga0070665_100077702 3300005548 Bacteria 3325
119 Ga0070665_100102179 3300005548 Bacteria 2870
120 Ga0070665_100304788 3300005548 Bacteria 1596
121 Ga0070665_100956288 3300005548 Bacteria 869
122 Ga0070704_100826706 3300005549 Bacteria 829
123 Ga0068855_100958105 3300005563 Bacteria 901
124 Ga0070664_100231608 3300005564 Bacteria 1656
125 Ga0070664_100275676 3300005564 Bacteria 1516
126 Ga0068857_100027868 3300005577 Bacteria 4981
127 Ga0068854_100124719 3300005578 Bacteria 1960
128 Ga0068856_100122070 3300005614 Bacteria 2607
129 Ga0070702_100782631 3300005615 Bacteria 736
130 Ga0068852_100006959 3300005616 Bacteria 8228
131 Ga0068852_100324929 3300005616 Bacteria 1495
132 Ga0068852_100951465 3300005616 Bacteria 877
133 Ga0068859_100029207 3300005617 Bacteria 5533
134 Ga0068859_100033094 3300005617 Bacteria 5192
135 Ga0068859_101319791 3300005617 Bacteria 795
136 Ga0068864_100001839 3300005618 Bacteria 17453
137 Ga0068864_100002166 3300005618 Bacteria 16217
138 Ga0068864_100007565 3300005618 Bacteria 8950
139 Ga0068864_100045225 3300005618 Bacteria 3776
140 Ga0068864_100110435 3300005618 Bacteria 2449
141 Ga0068864_100188407 3300005618 Bacteria 1890
142 Ga0068864_100301703 3300005618 Bacteria 1500
143 Ga0068866_10028030 3300005718 Bacteria 2680
144 Ga0068866_10031962 3300005718 Bacteria 2540
145 Ga0068861_100001567 3300005719 Bacteria 14538
146 Ga0068861_100048618 3300005719 Bacteria 3207
147 Ga0068861_100193578 3300005719 Bacteria 1702
148 Ga0068861_100744401 3300005719 Bacteria 915
149 Ga0068851_10001149 3300005834 Bacteria 11479
150 Ga0068870_10004471 3300005840 Bacteria 6021
151 Ga0068870_10096317 3300005840 Bacteria 1664
152 Ga0068863_100001112 3300005841 Bacteria 26867
153 Ga0068863_100002459 3300005841 Bacteria 18405
154 Ga0068863_100047885 3300005841 Bacteria 4054
155 Ga0068863_100049017 3300005841 Bacteria 4005
156 Ga0068863_100100681 3300005841 Bacteria 2747
157 Ga0068863_100130380 3300005841 Bacteria 2400
158 Ga0068863_100151252 3300005841 Bacteria 2221
159 Ga0068863_100229721 3300005841 Bacteria 1789
160 Ga0068863_100556736 3300005841 Bacteria 1133
161 Ga0068858_100001653 3300005842 Bacteria 22776
162 Ga0068858_100007295 3300005842 Bacteria 10709
163 Ga0068858_100029688 3300005842 Bacteria 5078
164 Ga0068858_100123184 3300005842 Bacteria 2426
165 Ga0068858_100144162 3300005842 Bacteria 2237
166 Ga0068858_100639863 3300005842 Bacteria 1033
167 Ga0068860_100010867 3300005843 Bacteria 8978
168 Ga0068860_100016275 3300005843 Bacteria 7252
169 Ga0068860_100045615 3300005843 Bacteria 4180
170 Ga0068860_100050601 3300005843 Bacteria 3954
171 Ga0068860_100234194 3300005843 Bacteria 1785
172 Ga0068860_100277841 3300005843 Bacteria 1636
173 Ga0068860_100526178 3300005843 Bacteria 1183
174 Ga0068860_101197567 3300005843 Bacteria 780
175 Ga0068862_100002687 3300005844 Bacteria 15628
176 Ga0068862_100007778 3300005844 Bacteria 8863
177 Ga0068862_100010582 3300005844 Bacteria 7624
178 Ga0068862_100060247 3300005844 Bacteria 3260
179 Ga0068862_100111746 3300005844 Bacteria 2399
180 Ga0068862_100548774 3300005844 Bacteria 1103
181 Ga0081539_10009988 3300005985 Bacteria 7820
182 Ga0075365_10035882 3300006038 Bacteria 3211
183 Ga0097621_100005813 3300006237 Bacteria 8712
184 Ga0097621_100016802 3300006237 Bacteria 5544
185 Ga0097621_100035371 3300006237 Bacteria 3991
186 Ga0097621_100109434 3300006237 Bacteria 2334
187 Ga0097621_100138141 3300006237 Bacteria 2080
188 Ga0097621_100152809 3300006237 Bacteria 1980
189 Ga0097621_100921770 3300006237 Bacteria 814
190 Ga0068871_100005265 3300006358 Bacteria 9057
191 Ga0068871_100014761 3300006358 Bacteria 5830
192 Ga0068871_100125235 3300006358 Bacteria 2174
193 Ga0068871_100303001 3300006358 Bacteria 1403
194 Ga0068871_100407356 3300006358 Bacteria 1212
195 Ga0068871_100430136 3300006358 Bacteria 1180
196 Ga0075433_10505079 3300006852 Bacteria 1064
197 Ga0075434_100022430 3300006871 Bacteria 6149
198 Ga0075434_100375754 3300006871 Bacteria 1442
199 Ga0068865_100001645 3300006881 Bacteria 13101
200 Ga0068865_100062594 3300006881 Bacteria 2612
201 Ga0068865_100152926 3300006881 Bacteria 1752
202 Ga0097620_100029207 3300006931 Bacteria 5533
203 Ga0097620_100033094 3300006931 Bacteria 5192
204 Ga0097620_101319795 3300006931 Bacteria 795
205 Ga0105240_10135406 3300009093 Bacteria 2951
206 Ga0105245_10209855 3300009098 Bacteria 1874
207 Ga0105247_10004994 3300009101 Bacteria 8426
208 Ga0105247_10124038 3300009101 Bacteria 1677
209 Ga0114129_11548452 3300009147 Bacteria 813
210 Ga0105243_10091231 3300009148 Bacteria 2509
211 Ga0105243_10311619 3300009148 Bacteria 1430
212 Ga0105241_10076709 3300009174 Bacteria 2607
213 Ga0105242_10025335 3300009176 Bacteria 4694
214 Ga0105242_10117824 3300009176 Bacteria 2274
215 Ga0105242_10324869 3300009176 Bacteria 1412
216 Ga0105242_11181144 3300009176 Bacteria 783
217 Ga0105248_10010438 3300009177 Bacteria 10231
218 Ga0105248_10019313 3300009177 Bacteria 7541
219 Ga0105248_10027026 3300009177 Bacteria 6384
220 Ga0105248_10103937 3300009177 Bacteria 3202
221 Ga0105248_10152213 3300009177 Bacteria 2610
222 Ga0105248_10333269 3300009177 Bacteria 1709
223 Ga0105249_10058498 3300009553 Bacteria 3532
224 Ga0105249_10068993 3300009553 Bacteria 3262
225 Ga0105249_10811021 3300009553 Bacteria 1000
226 Ga0157374_10001837 3300013296 Bacteria 17870
227 Ga0157374_10079583 3300013296 Bacteria 3106
228 Ga0157374_10199057 3300013296 Bacteria 1961
229 Ga0157374_10467957 3300013296 Bacteria 1263
230 Ga0157378_10075379 3300013297 Bacteria 3037
231 Ga0157378_10838966 3300013297 Bacteria 947
232 Ga0163162_10032789 3300013306 Bacteria 5158
233 Ga0163162_10256265 3300013306 Bacteria 1881
234 Ga0163162_10303632 3300013306 Bacteria 1728
235 Ga0163162_10879146 3300013306 Bacteria 1010
236 Ga0157372_10466447 3300013307 Bacteria 1472
237 Ga0157375_10009140 3300013308 Bacteria 8684
238 Ga0157375_10026612 3300013308 Bacteria 5394
239 Ga0157375_10033977 3300013308 Bacteria 4853
240 Ga0157375_10043459 3300013308 Bacteria 4359
241 Ga0157375_10055431 3300013308 Bacteria 3909
242 Ga0157375_10292409 3300013308 Bacteria 1792
243 Ga0163163_10019390 3300014325 Bacteria 6387
244 Ga0163163_10062166 3300014325 Bacteria 3700
245 Ga0163163_10457473 3300014325 Bacteria 1337
246 Ga0163163_11483750 3300014325 Bacteria 739
247 Ga0163163_11838933 3300014325 Bacteria 666
248 Ga0157380_10190215 3300014326 Bacteria 1811
249 Ga0157380_10534528 3300014326 Bacteria 1146
250 Ga0157380_11439579 3300014326 Bacteria 740
251 Ga0182008_10360910 3300014497 Bacteria 773
252 Ga0157377_10208895 3300014745 Bacteria 1244
253 Ga0157379_10000871 3300014968 Bacteria 24416
254 Ga0157379_10008862 3300014968 Bacteria 8769
255 Ga0157379_10283259 3300014968 Bacteria 1508
256 Ga0157379_10383135 3300014968 Bacteria 1290
257 Ga0157376_10003998 3300014969 Bacteria 10193
258 Ga0157376_10019411 3300014969 Bacteria 5240
259 Ga0157376_10046756 3300014969 Bacteria 3571
260 Ga0157376_10050521 3300014969 Bacteria 3450
261 Ga0157376_10116876 3300014969 Bacteria 2357
262 Ga0157376_11721838 3300014969 Bacteria 662
263 Ga0163161_10725733 3300017792 Bacteria 829
264 Ga0209673_1003388 3300025273 Bacteria 9467
265 Ga0209564_1001470 3300025295 Bacteria 23851
266 Ga0209256_1001453 3300025299 Bacteria 24384
267 Ga0207697_10014982 3300025315 Bacteria 3208
268 Ga0207697_10015852 3300025315 Bacteria 3109
269 Ga0207656_10001267 3300025321 Bacteria 8323
270 Ga0207682_10134938 3300025893 Bacteria 1104
271 Ga0207682_10230018 3300025893 Bacteria 859
272 Ga0207642_10047917 3300025899 Bacteria 1913
273 Ga0207710_10002647 3300025900 Bacteria 8256
274 Ga0207688_10146201 3300025901 Bacteria 1394
275 Ga0207680_10021139 3300025903 Bacteria 3516
276 Ga0207680_10041889 3300025903 Bacteria 2675
277 Ga0207680_10130474 3300025903 Bacteria 1656
278 Ga0207645_10000287 3300025907 Bacteria 42109
279 Ga0207645_10025846 3300025907 Bacteria 3797
280 Ga0207645_10033423 3300025907 Bacteria 3306
281 Ga0207645_10054152 3300025907 Bacteria 2563
282 Ga0207645_10162519 3300025907 Bacteria 1461
283 Ga0207645_10490536 3300025907 Bacteria 831
284 Ga0207643_10006167 3300025908 Bacteria 6416
285 Ga0207643_10087497 3300025908 Bacteria 1812
286 Ga0207643_10268377 3300025908 Bacteria 1055
287 Ga0207643_10412503 3300025908 Bacteria 855
288 Ga0207705_10008575 3300025909 Bacteria 7452
289 Ga0207707_10235554 3300025912 Bacteria 1592
290 Ga0207695_10083573 3300025913 Bacteria 3225
291 Ga0207662_10093195 3300025918 Bacteria 1856
292 Ga0207649_10255313 3300025920 Bacteria 1264
293 Ga0207681_10006754 3300025923 Bacteria 7042
294 Ga0207681_10015877 3300025923 Bacteria 4700
295 Ga0207681_10030082 3300025923 Bacteria 3537
296 Ga0207681_10101182 3300025923 Bacteria 2079
297 Ga0207681_10163712 3300025923 Bacteria 1679
298 Ga0207681_10212356 3300025923 Bacteria 1492
299 Ga0207650_10004158 3300025925 Bacteria 9892
300 Ga0207650_10005148 3300025925 Bacteria 8925
301 Ga0207650_10012464 3300025925 Bacteria 5869
302 Ga0207650_10047981 3300025925 Bacteria 3148
303 Ga0207650_10095440 3300025925 Bacteria 2280
304 Ga0207650_10178363 3300025925 Bacteria 1692
305 Ga0207650_10262589 3300025925 Bacteria 1401
306 Ga0207650_10268730 3300025925 Bacteria 1385
307 Ga0207650_10332375 3300025925 Bacteria 1246
308 Ga0207650_10548309 3300025925 Bacteria 969
309 Ga0207650_10746028 3300025925 Bacteria 828
310 Ga0207650_11019084 3300025925 Bacteria 704
311 Ga0207650_11062866 3300025925 Bacteria 689
312 Ga0207659_10005937 3300025926 Bacteria 7452
313 Ga0207659_10060035 3300025926 Bacteria 2735
314 Ga0207659_10065093 3300025926 Bacteria 2641
315 Ga0207659_10135294 3300025926 Bacteria 1907
316 Ga0207659_10155411 3300025926 Bacteria 1790
317 Ga0207659_10376848 3300025926 Bacteria 1182
318 Ga0207659_10695388 3300025926 Bacteria 870
319 Ga0207700_10235264 3300025928 Bacteria 1559
320 Ga0207664_10147966 3300025929 Bacteria 1993
321 Ga0207644_10013757 3300025931 Bacteria 5404
322 Ga0207644_10142226 3300025931 Bacteria 1848
323 Ga0207644_10637746 3300025931 Bacteria 886
324 Ga0207706_10128208 3300025933 Bacteria 2231
325 Ga0207706_10248751 3300025933 Bacteria 1553
326 Ga0207686_10513352 3300025934 Bacteria 932
327 Ga0207686_10942843 3300025934 Bacteria 698
328 Ga0207670_10084996 3300025936 Bacteria 2223
329 Ga0207670_10342546 3300025936 Bacteria 1182
330 Ga0207669_10007636 3300025937 Bacteria 5020
331 Ga0207669_10103270 3300025937 Bacteria 1890
332 Ga0207669_10174127 3300025937 Bacteria 1535
333 Ga0207669_10429352 3300025937 Bacteria 1042
334 Ga0207704_10036374 3300025938 Bacteria 2833
335 Ga0207704_10262548 3300025938 Bacteria 1303
336 Ga0207665_10118095 3300025939 Bacteria 1871
337 Ga0207691_10001041 3300025940 Bacteria 27487
338 Ga0207691_10006782 3300025940 Bacteria 11040
339 Ga0207691_10029615 3300025940 Bacteria 5121
340 Ga0207691_10048202 3300025940 Bacteria 3907
341 Ga0207691_10062954 3300025940 Bacteria 3365
342 Ga0207691_10165100 3300025940 Bacteria 1941
343 Ga0207691_10368820 3300025940 Bacteria 1227
344 Ga0207711_10028682 3300025941 Bacteria 4687
345 Ga0207711_10033370 3300025941 Bacteria 4355
346 Ga0207711_10064998 3300025941 Bacteria 3152
347 Ga0207711_10281263 3300025941 Bacteria 1532
348 Ga0207689_10000258 3300025942 Bacteria 47518
349 Ga0207689_10001990 3300025942 Bacteria 19301
350 Ga0207689_10030686 3300025942 Bacteria 4479
351 Ga0207689_10539135 3300025942 Bacteria 980
352 Ga0207679_10317651 3300025945 Bacteria 1348
353 Ga0207679_10405684 3300025945 Bacteria 1200
354 Ga0207679_10583940 3300025945 Bacteria 1005
355 Ga0207651_10002917 3300025960 Bacteria 8262
356 Ga0207651_10102373 3300025960 Bacteria 2129
357 Ga0207651_10252967 3300025960 Bacteria 1442
358 Ga0207651_10276344 3300025960 Bacteria 1386
359 Ga0207651_10466251 3300025960 Bacteria 1086
360 Ga0207651_10717454 3300025960 Bacteria 882
361 Ga0207651_11199670 3300025960 Bacteria 681
362 Ga0207712_10340271 3300025961 Bacteria 1244
363 Ga0207712_10832966 3300025961 Bacteria 812
364 Ga0207668_10005326 3300025972 Bacteria 7571
365 Ga0207668_10044207 3300025972 Bacteria 3028
366 Ga0207668_10573102 3300025972 Bacteria 980
367 Ga0207640_10048832 3300025981 Bacteria 2738
368 Ga0207658_10006516 3300025986 Bacteria 7969
369 Ga0207658_10036689 3300025986 Bacteria 3516
370 Ga0207658_10038643 3300025986 Bacteria 3440
371 Ga0207658_10065837 3300025986 Bacteria 2723
372 Ga0207658_10467946 3300025986 Bacteria 1118
373 Ga0207658_10578370 3300025986 Bacteria 1007
374 Ga0207677_10003358 3300026023 Bacteria 8481
375 Ga0207677_10113989 3300026023 Bacteria 2019
376 Ga0207703_10002668 3300026035 Bacteria 15333
377 Ga0207703_10015038 3300026035 Bacteria 6041
378 Ga0207703_10045175 3300026035 Bacteria 3543
379 Ga0207703_10348854 3300026035 Bacteria 1362
380 Ga0207639_10215567 3300026041 Bacteria 1655
381 Ga0207678_10729203 3300026067 Bacteria 873
382 Ga0207708_10034693 3300026075 Bacteria 3838
383 Ga0207702_10485512 3300026078 Bacteria 1203
384 Ga0207641_10000746 3300026088 Bacteria 34998
385 Ga0207641_10004011 3300026088 Bacteria 12845
386 Ga0207641_10030710 3300026088 Bacteria 4451
387 Ga0207641_10035790 3300026088 Bacteria 4140
388 Ga0207641_10072180 3300026088 Bacteria 2972
389 Ga0207641_10102192 3300026088 Bacteria 2527
390 Ga0207641_10153103 3300026088 Bacteria 2090
391 Ga0207641_10503613 3300026088 Bacteria 1176
392 Ga0207641_10969913 3300026088 Bacteria 846
393 Ga0207648_10000048 3300026089 Bacteria 109946
394 Ga0207648_10021482 3300026089 Bacteria 5801
395 Ga0207648_10022272 3300026089 Bacteria 5693
396 Ga0207648_10299463 3300026089 Bacteria 1442
397 Ga0207648_10335919 3300026089 Bacteria 1360
398 Ga0207676_10004021 3300026095 Bacteria 10378
399 Ga0207676_10013385 3300026095 Bacteria 5893
400 Ga0207676_10048780 3300026095 Bacteria 3289
401 Ga0207676_10061195 3300026095 Bacteria 2980
402 Ga0207676_10194434 3300026095 Bacteria 1788
403 Ga0207676_10368716 3300026095 Bacteria 1333
404 Ga0207674_10000053 3300026116 Bacteria 114437
405 Ga0207674_10015968 3300026116 Bacteria 8226
406 Ga0207674_10410991 3300026116 Bacteria 1308
407 Ga0207675_100002057 3300026118 Bacteria 20074
408 Ga0207675_100023959 3300026118 Bacteria 5674
409 Ga0207675_100055808 3300026118 Bacteria 3686
410 Ga0207683_10003717 3300026121 Bacteria 13244
411 Ga0207683_10005506 3300026121 Bacteria 10851
412 Ga0207683_10007987 3300026121 Bacteria 9050
413 Ga0207683_10163944 3300026121 Bacteria 2011
414 Ga0207683_10251283 3300026121 Bacteria 1614
415 Ga0207698_10006741 3300026142 Bacteria 7175
416 Ga0207698_10400595 3300026142 Bacteria 1311
417 Ga0207698_10726202 3300026142 Bacteria 990
418 Ga0209996_1021781 3300027395 Bacteria 904
419 Ga0268266_10004386 3300028379 Bacteria 13536
420 Ga0268266_10067054 3300028379 Bacteria 3105
421 Ga0268266_10077672 3300028379 Bacteria 2887
422 Ga0268266_10232448 3300028379 Bacteria 1698
423 Ga0268266_10473379 3300028379 Bacteria 1193
424 Ga0268265_10018329 3300028380 Bacteria 4848
425 Ga0268265_10021549 3300028380 Bacteria 4517
426 Ga0268265_10050279 3300028380 Bacteria 3140
427 Ga0268265_10051148 3300028380 Bacteria 3117
428 Ga0268265_10229075 3300028380 Bacteria 1632
429 Ga0268264_10006988 3300028381 Bacteria 9473
430 Ga0268264_10009800 3300028381 Bacteria 7929
431 Ga0268264_10052853 3300028381 Bacteria 3388
432 Ga0268264_10081848 3300028381 Bacteria 2761
433 Ga0268264_10315435 3300028381 Bacteria 1476
434 Ga0268264_10878425 3300028381 Bacteria 899
435 Ga0316181_1142860 3300030744 Bacteria 3764
436 Ga0265327_10007304 3300031251 Bacteria 8567
437 Ga0307408_100504890 3300031548 Bacteria 1059
438 Ga0307412_10256347 3300031911 Bacteria 1361
439 Ga0307416_100424113 3300032002 Bacteria 1375
440 Ga0307411_11563265 3300032005 Bacteria 608
441 Ga0373939_0259492 3300035114 Bacteria 679
442 Ga0373941_0083383 3300035115 Bacteria 1084
443 Ga0373946_0022090 3300035171 Bacteria 2474
444 Ga0373931_0342430 3300035691 Bacteria 934
445 Ga0373933_0195795 3300035724 Bacteria 1292
446 Ga0373933_0261551 3300035724 Bacteria 1116
447 Ga0373937_0030760 3300036401 Bacteria 4863
448 Ga0373937_0499169 3300036401 Bacteria 1156
449 Ga0439465_0006213 3300041413 Bacteria 3797
450 Ga0451807_0656937 3300041486 Bacteria 1796
451 Ga0439433_0090538 3300041999 Bacteria 752
452 Ga0439449_0028819 3300042007 Bacteria 2069
453 Ga0439444_0069101 3300042437 Bacteria 753
454 Ga0466966_0305902 3300044684 Bacteria 955
455 Ga0466961_0162232 3300044693 Bacteria 1393
456 Ga0453684_0210963 3300044712 Bacteria 2257
457 Ga0466958_0044846 3300045836 Bacteria 2665
458 Ga0495650_0018436 3300046471 Bacteria 3468
459 Ga0495585_0000332 3300046492 Bacteria 46071
460 Ga0495621_0001332 3300046539 Bacteria 6384
461 Ga0495633_0076330 3300046558 Bacteria 1560
462 Ga0495658_0111849 3300046683 Bacteria 1643
463 Ga0495658_0780951 3300046683 Bacteria 611
464 Ga0496100_0159992 3300048903 Bacteria 1614
465 Ga0496102_0506998 3300048905 Bacteria 1129
466 Ga0496104_0274142 3300048907 Bacteria 1600
467 Ga0496106_0680402 3300048909 Bacteria 821
468 Ga0496108_0080459 3300048911 Bacteria 2760
469 Ga0496108_0109192 3300048911 Bacteria 2364
470 Ga0496108_0125349 3300048911 Bacteria 2205
471 Ga0496109_0029700 3300048912 Bacteria 4898
472 Ga0496109_0315247 3300048912 Bacteria 1476
473 Ga0496110_0144278 3300048913 Bacteria 2153
474 Ga0496111_0074544 3300048914 Bacteria 2472
475 Ga0496112_0002269 3300048915 Bacteria 15381
476 Ga0496112_0635930 3300048915 Bacteria 997
477 Ga0496114_0139654 3300048917 Bacteria 2097
478 Ga0496121_0312710 3300048924 Bacteria 1061
479 Ga0496122_0010912 3300048925 Bacteria 9291
480 Ga0496122_0346171 3300048925 Bacteria 778
481 Ga0496123_0000431 3300048926 Bacteria 75535
482 Ga0496125_0098850 3300048928 Bacteria 2158
483 Ga0496125_0242876 3300048928 Bacteria 1142
484 Ga0496126_0075519 3300048929 Bacteria 2991
485 Ga0501310_004802 3300049130 Bacteria 1369
486 Ga0501033_0010286 3300049570 Bacteria 7178
487 Ga0501034_0098359 3300049571 Bacteria 2922
488 Ga0501034_0848402 3300049571 Bacteria 804
489 Ga0501036_0004696 3300049572 Bacteria 11027
490 Ga0501038_0001086 3300049574 Bacteria 24601
491 Ga0501038_0750610 3300049574 Unclassified 728
492 Ga0501039_0002322 3300049575 Bacteria 14128
493 Ga0501039_0946327 3300049575 Unclassified 670
494 Ga0501040_0009962 3300049576 Bacteria 6207
495 Ga0501041_0000377 3300049577 Bacteria 22310
496 Ga0501042_0004040 3300049578 Bacteria 9297
497 Ga0501046_0010958 3300049580 Bacteria 7774
498 Ga0501047_0078238 3300049581 Bacteria 3181
499 Ga0501048_0002728 3300049582 Bacteria 13471
500 Ga0501068_0016980 3300049584 Bacteria 4206
501 Ga0501070_0089304 3300049586 Bacteria 2550
502 Ga0501072_0014072 3300049588 Bacteria 6130
503 Ga0501074_0055840 3300049590 Bacteria 2845
504 Ga0501075_0003545 3300049591 Bacteria 10445
505 Ga0501076_0006071 3300049592 Bacteria 8737
506 Ga0501076_0191269 3300049592 Bacteria 1670
507 Ga0501077_0009037 3300049593 Bacteria 6186
508 Ga0501077_0639249 3300049593 Bacteria 684
509 Ga0501079_0002534 3300049741 Bacteria 13266
510 Ga0501080_0038739 3300049742 Bacteria 4449
511 Ga0501081_0000032 3300049743 Bacteria 52062
512 Ga0501081_0390154 3300049743 Bacteria 1030
513 Ga0501035_0030327 3300049822 Bacteria 4930
514 Ga0501044_0076021 3300049823 Bacteria 3410
515 Ga0501044_0943418 3300049823 Bacteria 736
516 Ga0501045_0005921 3300049824 Bacteria 8457
517 nmdc:mga03683_138930_c1 3300050489 Bacteria 1091
518 nmdc:mga0yw44_110424_c1 3300050492 Bacteria 1761
519 Ga0495595_0259256 3300053084 Bacteria 871
520 Ga0500583_0283804 3300053092 Bacteria 812
521 Ga0501084_0003399 3300054114 Bacteria 12901
522 Ga0501084_0035432 3300054114 Bacteria 4172
523 Ga0501082_0017533 3300060353 Bacteria 6168
524 Ga0501082_0869495 3300060353 Bacteria 789
525 Ga0530510_0001142 3300061734 Bacteria 17647
526 2553005140 2551306416 Bacteria 6152985
527 8020959817 8020953355 Bacteria 7439080
528 Ga0207645_10013964
529 Ga0055524_1010488
530 Ga0055536_1000650
531 Ga0055528_1005787
532 Ga0065715_10105220
533 Ga0065715_10472004
534 Ga0070658_10009240
535 Ga0070658_10049976
536 Ga0070676_10007082
537 Ga0070676_10025098
538 Ga0070676_10028795
539 Ga0070676_10088830
540 Ga0070676_10105038
541 Ga0070690_100182643
542 Ga0070690_100288133
543 Ga0070670_100000664
544 Ga0070670_100003976
545 Ga0070670_100011387
546 Ga0070670_100050132
547 Ga0070670_100058637
548 Ga0070670_100076437
549 Ga0070670_100092481
550 Ga0070670_100155851
551 Ga0070670_100179265
552 Ga0070670_100404229
553 Ga0070677_10141225
554 Ga0068869_100015323
555 Ga0068869_100036622
556 Ga0068869_100093106
557 Ga0068869_100543682
558 Ga0070666_10001855
559 Ga0070666_10083750
560 Ga0070666_10151739
561 Ga0070666_10517483
562 Ga0068868_100008340
563 Ga0068868_100046661
564 Ga0070660_100002776
565 Ga0070689_100153716
566 Ga0070689_100329336
567 Ga0070689_100738471
568 Ga0070687_100376640
569 Ga0070668_100013680
570 Ga0070668_100017915
571 Ga0070668_100030137
572 Ga0070668_100172145
573 Ga0070669_100003297
574 Ga0070669_100004906
575 Ga0070669_100021977
576 Ga0070669_100164374
577 Ga0070669_100174680
578 Ga0070669_100200449
579 Ga0070675_100015441
580 Ga0070675_100023095
581 Ga0070675_100067059
582 Ga0070675_100084336
583 Ga0070675_100633530
584 Ga0070671_100044249
585 Ga0070671_100094936
586 Ga0070671_100116583
587 Ga0070671_100737092
588 Ga0070674_100045888
589 Ga0070674_100093680
590 Ga0070674_100503194
591 Ga0070674_100877775
592 Ga0070673_100009420
593 Ga0070673_100126647
594 Ga0070673_100220362
595 Ga0070673_100332659
596 Ga0070673_100621561
597 Ga0070673_100663234
598 Ga0070673_100964521
599 Ga0070688_100398663
600 Ga0070659_100106481
601 Ga0070667_100004609
602 Ga0070667_100006526
603 Ga0070667_100009405
604 Ga0070667_100060649
605 Ga0070667_100063570
606 Ga0070667_100454499
607 Ga0070711_100178609
608 Ga0070694_100937536
609 Ga0070708_100000773
610 Ga0070708_100050964
611 Ga0070678_100004731
612 Ga0070678_100022652
613 Ga0070678_100105885
614 Ga0070678_100114505
615 Ga0070678_100122971
616 Ga0070662_100258048
617 Ga0068867_100012058
618 Ga0068867_100015274
619 Ga0068867_100059268
620 Ga0068867_100086845
621 Ga0068867_100325254
622 Ga0068867_101021639
623 Ga0070685_10244806
624 Ga0070685_10342210
625 Ga0070698_100367763
626 Ga0070684_100043961
627 Ga0070684_100908181
628 Ga0070672_100033175
629 Ga0070672_100044917
630 Ga0070672_100051002
631 Ga0070672_100058174
632 Ga0070672_100212580
633 Ga0070672_100391476
634 Ga0070672_100877810
635 Ga0070686_100275684
636 Ga0070686_100582663
637 Ga0070695_100113879
638 Ga0070695_100319796
639 Ga0070696_100117889
640 Ga0070696_101207314
641 Ga0070693_100207837
642 Ga0070665_100006019
643 Ga0070665_100010735
644 Ga0070665_100034923
645 Ga0070665_100077702
646 Ga0070665_100102179
647 Ga0070665_100304788
648 Ga0070665_100956288
649 Ga0070704_100826706
650 Ga0068855_100958105
651 Ga0070664_100231608
652 Ga0070664_100275676
653 Ga0068857_100027868
654 Ga0068854_100124719
655 Ga0068856_100122070
656 Ga0070702_100782631
657 Ga0068852_100006959
658 Ga0068852_100324929
659 Ga0068852_100951465
660 Ga0068859_100029207
661 Ga0068859_100033094
662 Ga0068859_101319791
663 Ga0068864_100001839
664 Ga0068864_100002166
665 Ga0068864_100007565
666 Ga0068864_100045225
667 Ga0068864_100110435
668 Ga0068864_100188407
669 Ga0068864_100301703
670 Ga0068866_10028030
671 Ga0068866_10031962
672 Ga0068861_100001567
673 Ga0068861_100048618
674 Ga0068861_100193578
675 Ga0068861_100744401
676 Ga0068851_10001149
677 Ga0068870_10004471
678 Ga0068870_10096317
679 Ga0068863_100001112
680 Ga0068863_100002459
681 Ga0068863_100047885
682 Ga0068863_100049017
683 Ga0068863_100100681
684 Ga0068863_100130380
685 Ga0068863_100151252
686 Ga0068863_100229721
687 Ga0068863_100556736
688 Ga0068858_100001653
689 Ga0068858_100007295
690 Ga0068858_100029688
691 Ga0068858_100123184
692 Ga0068858_100144162
693 Ga0068858_100639863
694 Ga0068860_100010867
695 Ga0068860_100016275
696 Ga0068860_100045615
697 Ga0068860_100050601
698 Ga0068860_100234194
699 Ga0068860_100277841
700 Ga0068860_100526178
701 Ga0068860_101197567
702 Ga0068862_100002687
703 Ga0068862_100007778
704 Ga0068862_100010582
705 Ga0068862_100060247
706 Ga0068862_100111746
707 Ga0068862_100548774
708 Ga0081539_10009988
709 Ga0075365_10035882
710 Ga0097621_100005813
711 Ga0097621_100016802
712 Ga0097621_100035371
713 Ga0097621_100109434
714 Ga0097621_100138141
715 Ga0097621_100152809
716 Ga0097621_100921770
717 Ga0068871_100005265
718 Ga0068871_100014761
719 Ga0068871_100125235
720 Ga0068871_100303001
721 Ga0068871_100407356
722 Ga0068871_100430136
723 Ga0075433_10505079
724 Ga0075434_100022430
725 Ga0075434_100375754
726 Ga0068865_100001645
727 Ga0068865_100062594
728 Ga0068865_100152926
729 Ga0097620_100029207
730 Ga0097620_100033094
731 Ga0097620_101319795
732 Ga0105240_10135406
733 Ga0105245_10209855
734 Ga0105247_10004994
735 Ga0105247_10124038
736 Ga0114129_11548452
737 Ga0105243_10091231
738 Ga0105243_10311619
739 Ga0105241_10076709
740 Ga0105242_10025335
741 Ga0105242_10117824
742 Ga0105242_10324869
743 Ga0105242_11181144
744 Ga0105248_10010438
745 Ga0105248_10019313
746 Ga0105248_10027026
747 Ga0105248_10103937
748 Ga0105248_10152213
749 Ga0105248_10333269
750 Ga0105249_10058498
751 Ga0105249_10068993
752 Ga0105249_10811021
753 Ga0157374_10001837
754 Ga0157374_10079583
755 Ga0157374_10199057
756 Ga0157374_10467957
757 Ga0157378_10075379
758 Ga0157378_10838966
759 Ga0163162_10032789
760 Ga0163162_10256265
761 Ga0163162_10303632
762 Ga0163162_10879146
763 Ga0157372_10466447
764 Ga0157375_10009140
765 Ga0157375_10026612
766 Ga0157375_10033977
767 Ga0157375_10043459
768 Ga0157375_10055431
769 Ga0157375_10292409
770 Ga0163163_10019390
771 Ga0163163_10062166
772 Ga0163163_10457473
773 Ga0163163_11483750
774 Ga0163163_11838933
775 Ga0157380_10190215
776 Ga0157380_10534528
777 Ga0157380_11439579
778 Ga0182008_10360910
779 Ga0157377_10208895
780 Ga0157379_10000871
781 Ga0157379_10008862
782 Ga0157379_10283259
783 Ga0157379_10383135
784 Ga0157376_10003998
785 Ga0157376_10019411
786 Ga0157376_10046756
787 Ga0157376_10050521
788 Ga0157376_10116876
789 Ga0157376_11721838
790 Ga0163161_10725733
791 Ga0209673_1003388
792 Ga0209564_1001470
793 Ga0209256_1001453
794 Ga0207697_10014982
795 Ga0207697_10015852
796 Ga0207656_10001267
797 Ga0207682_10134938
798 Ga0207682_10230018
799 Ga0207642_10047917
800 Ga0207710_10002647
801 Ga0207688_10146201
802 Ga0207680_10021139
803 Ga0207680_10041889
804 Ga0207680_10130474
805 Ga0207645_10000287
806 Ga0207645_10025846
807 Ga0207645_10033423
808 Ga0207645_10054152
809 Ga0207645_10162519
810 Ga0207645_10490536
811 Ga0207643_10006167
812 Ga0207643_10087497
813 Ga0207643_10268377
814 Ga0207643_10412503
815 Ga0207705_10008575
816 Ga0207707_10235554
817 Ga0207695_10083573
818 Ga0207662_10093195
819 Ga0207649_10255313
820 Ga0207681_10006754
821 Ga0207681_10015877
822 Ga0207681_10030082
823 Ga0207681_10101182
824 Ga0207681_10163712
825 Ga0207681_10212356
826 Ga0207650_10004158
827 Ga0207650_10005148
828 Ga0207650_10012464
829 Ga0207650_10047981
830 Ga0207650_10095440
831 Ga0207650_10178363
832 Ga0207650_10262589
833 Ga0207650_10268730
834 Ga0207650_10332375
835 Ga0207650_10548309
836 Ga0207650_10746028
837 Ga0207650_11019084
838 Ga0207650_11062866
839 Ga0207659_10005937
840 Ga0207659_10060035
841 Ga0207659_10065093
842 Ga0207659_10135294
843 Ga0207659_10155411
844 Ga0207659_10376848
845 Ga0207659_10695388
846 Ga0207700_10235264
847 Ga0207664_10147966
848 Ga0207644_10013757
849 Ga0207644_10142226
850 Ga0207644_10637746
851 Ga0207706_10128208
852 Ga0207706_10248751
853 Ga0207686_10513352
854 Ga0207686_10942843
855 Ga0207670_10084996
856 Ga0207670_10342546
857 Ga0207669_10007636
858 Ga0207669_10103270
859 Ga0207669_10174127
860 Ga0207669_10429352
861 Ga0207704_10036374
862 Ga0207704_10262548
863 Ga0207665_10118095
864 Ga0207691_10001041
865 Ga0207691_10006782
866 Ga0207691_10029615
867 Ga0207691_10048202
868 Ga0207691_10062954
869 Ga0207691_10165100
870 Ga0207691_10368820
871 Ga0207711_10028682
872 Ga0207711_10033370
873 Ga0207711_10064998
874 Ga0207711_10281263
875 Ga0207689_10000258
876 Ga0207689_10001990
877 Ga0207689_10030686
878 Ga0207689_10539135
879 Ga0207679_10317651
880 Ga0207679_10405684
881 Ga0207679_10583940
882 Ga0207651_10002917
883 Ga0207651_10102373
884 Ga0207651_10252967
885 Ga0207651_10276344
886 Ga0207651_10466251
887 Ga0207651_10717454
888 Ga0207651_11199670
889 Ga0207712_10340271
890 Ga0207712_10832966
891 Ga0207668_10005326
892 Ga0207668_10044207
893 Ga0207668_10573102
894 Ga0207640_10048832
895 Ga0207658_10006516
896 Ga0207658_10036689
897 Ga0207658_10038643
898 Ga0207658_10065837
899 Ga0207658_10467946
900 Ga0207658_10578370
901 Ga0207677_10003358
902 Ga0207677_10113989
903 Ga0207703_10002668
904 Ga0207703_10015038
905 Ga0207703_10045175
906 Ga0207703_10348854
907 Ga0207639_10215567
908 Ga0207678_10729203
909 Ga0207708_10034693
910 Ga0207702_10485512
911 Ga0207641_10000746
912 Ga0207641_10004011
913 Ga0207641_10030710
914 Ga0207641_10035790
915 Ga0207641_10072180
916 Ga0207641_10102192
917 Ga0207641_10153103
918 Ga0207641_10503613
919 Ga0207641_10969913
920 Ga0207648_10000048
921 Ga0207648_10021482
922 Ga0207648_10022272
923 Ga0207648_10299463
924 Ga0207648_10335919
925 Ga0207676_10004021
926 Ga0207676_10013385
927 Ga0207676_10048780
928 Ga0207676_10061195
929 Ga0207676_10194434
930 Ga0207676_10368716
931 Ga0207674_10000053
932 Ga0207674_10015968
933 Ga0207674_10410991
934 Ga0207675_100002057
935 Ga0207675_100023959
936 Ga0207675_100055808
937 Ga0207683_10003717
938 Ga0207683_10005506
939 Ga0207683_10007987
940 Ga0207683_10163944
941 Ga0207683_10251283
942 Ga0207698_10006741
943 Ga0207698_10400595
944 Ga0207698_10726202
945 Ga0209996_1021781
946 Ga0268266_10004386
947 Ga0268266_10067054
948 Ga0268266_10077672
949 Ga0268266_10232448
950 Ga0268266_10473379
951 Ga0268265_10018329
952 Ga0268265_10021549
953 Ga0268265_10050279
954 Ga0268265_10051148
955 Ga0268265_10229075
956 Ga0268264_10006988
957 Ga0268264_10009800
958 Ga0268264_10052853
959 Ga0268264_10081848
960 Ga0268264_10315435
961 Ga0268264_10878425
962 Ga0316181_1142860
963 Ga0265327_10007304
964 Ga0307408_100504890
965 Ga0307412_10256347
966 Ga0307416_100424113
967 Ga0307411_11563265
968 Ga0373939_0259492
969 Ga0373941_0083383
970 Ga0373946_0022090
971 Ga0373931_0342430
972 Ga0373933_0195795
973 Ga0373933_0261551
974 Ga0373937_0030760
975 Ga0373937_0499169
976 Ga0439465_0006213
977 Ga0451807_0656937
978 Ga0439433_0090538
979 Ga0439449_0028819
980 Ga0439444_0069101
981 Ga0466966_0305902
982 Ga0466961_0162232
983 Ga0453684_0210963
984 Ga0466958_0044846
985 Ga0495650_0018436
986 Ga0495585_0000332
987 Ga0495621_0001332
988 Ga0495633_0076330
989 Ga0495658_0111849
990 Ga0495658_0780951
991 Ga0496100_0159992
992 Ga0496102_0506998
993 Ga0496104_0274142
994 Ga0496106_0680402
995 Ga0496108_0080459
996 Ga0496108_0109192
997 Ga0496108_0125349
998 Ga0496109_0029700
999 Ga0496109_0315247
1000 Ga0496110_0144278
1001 Ga0496111_0074544
1002 Ga0496112_0002269
1003 Ga0496112_0635930
1004 Ga0496114_0139654
1005 Ga0496121_0312710
1006 Ga0496122_0010912
1007 Ga0496122_0346171
1008 Ga0496123_0000431
1009 Ga0496125_0098850
1010 Ga0496125_0242876
1011 Ga0496126_0075519
1012 Ga0501310_004802
1013 Ga0501033_0010286
1014 Ga0501034_0098359
1015 Ga0501034_0848402
1016 Ga0501036_0004696
1017 Ga0501038_0001086
1018 Ga0501038_0750610
1019 Ga0501039_0002322
1020 Ga0501039_0946327
1021 Ga0501040_0009962
1022 Ga0501041_0000377
1023 Ga0501042_0004040
1024 Ga0501046_0010958
1025 Ga0501047_0078238
1026 Ga0501048_0002728
1027 Ga0501068_0016980
1028 Ga0501070_0089304
1029 Ga0501072_0014072
1030 Ga0501074_0055840
1031 Ga0501075_0003545
1032 Ga0501076_0006071
1033 Ga0501076_0191269
1034 Ga0501077_0009037
1035 Ga0501077_0639249
1036 Ga0501079_0002534
1037 Ga0501080_0038739
1038 Ga0501081_0000032
1039 Ga0501081_0390154
1040 Ga0501035_0030327
1041 Ga0501044_0076021
1042 Ga0501044_0943418
1043 Ga0501045_0005921
1044 nmdc:mga03683_138930_c1
1045 nmdc:mga0yw44_110424_c1
1046 Ga0495595_0259256
1047 Ga0500583_0283804
1048 Ga0501084_0003399
1049 Ga0501084_0035432
1050 Ga0501082_0017533
1051 Ga0501082_0869495
1052 Ga0530510_0001142
1053 2553005140
1054 8020959817

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

39

209

0.97

PF01985

CRS1_YhbY

CRS1 / YhbY (CRM) domain

4

80

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9883 1 181
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9873 1 181
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9848 2 181
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.983 1 181
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.982 1 181
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9881 2 181 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9719 2 181 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9584 1 175 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9573 1 175 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9508 2 181 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A432R1U7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9967 45 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7C8XNS0-F1-model_v4 deleted 0.9964 43 167
AF-A0A1G3ZJG3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9956 43 175 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A656G4K2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9948 2 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A0F8Z5C9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9945 38 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map