F459108
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 524 | 232 | 524 | 467 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100161157|Ga0070699_1001611571 |
| Length | 517 |
| Sequence | LQNEAAIASAGSITSAAQDAPHLRRVLGRMDLVLLFVVAVFNLNVVPSIAANGGVTVWLWIISLALFFWPQGIAVIELAHRYPGEGGVYLWAKEVFGDFHGFLSGWCYWTNNMMYVPTVMLYFVGVSVFALGSGHEGLADNKTFALTASLLLLVFLVVLNIVGLGVGKWINNLGAIGTGIAAAVLIGLGMVVWLRFGTTVTWADFRIPPNPRFVLNSFAVICFGLVGLELASIMGDEIENPQKTLPGAVAWGGVLSGALYIGATLTLLIAINKGDINVLQGIVQAVGHMAGRLGVGWIVAPFALMLSLSIAGIASAWLGGSARIPFVAGLDSYMPSWLGRVHPRYHTPYAALIVHAAVSMVLVVLNFSGWWIWNKLIGLSLVAYILRASGFVVANLMASPTGVQETFQKLLSLAVVLQLIPFLYMFGALLKIAFSDSFAKACYGKTKLILSGASGLITTILGIGLAFFPAQQVTSIFSYEVWMFGGTLFFIGLAAFFFFVYGRHKSARKLAEAVPLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 164 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 1.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.53 |
| Rhizosphere | 93.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10002304 | 3300002239 | Bacteria | 2614 |
| 2 | Ga0070658_10026272 | 3300005327 | Bacteria | 4670 |
| 3 | Ga0070676_10015943 | 3300005328 | Bacteria | 4147 |
| 4 | Ga0070676_10031597 | 3300005328 | Bacteria | 3027 |
| 5 | Ga0070683_100001410 | 3300005329 | Bacteria | 18459 |
| 6 | Ga0070683_100020363 | 3300005329 | Bacteria | 5904 |
| 7 | Ga0070683_100119095 | 3300005329 | Unclassified | 2493 |
| 8 | Ga0070690_100007305 | 3300005330 | Bacteria | 6327 |
| 9 | Ga0070670_100002128 | 3300005331 | Bacteria | 16247 |
| 10 | Ga0070670_100016498 | 3300005331 | Bacteria | 6341 |
| 11 | Ga0068869_100010897 | 3300005334 | Bacteria | 5947 |
| 12 | Ga0068869_100025905 | 3300005334 | Bacteria | 4077 |
| 13 | Ga0068869_100031928 | 3300005334 | Bacteria | 3708 |
| 14 | Ga0070666_10010602 | 3300005335 | Bacteria | 5766 |
| 15 | Ga0070666_10018971 | 3300005335 | Bacteria | 4432 |
| 16 | Ga0070666_10024702 | 3300005335 | Bacteria | 3917 |
| 17 | Ga0070680_100054480 | 3300005336 | Bacteria | 3266 |
| 18 | Ga0068868_100001052 | 3300005338 | Bacteria | 18872 |
| 19 | Ga0068868_100004660 | 3300005338 | Bacteria | 9625 |
| 20 | Ga0070687_100009776 | 3300005343 | Bacteria | 4120 |
| 21 | Ga0070661_100015954 | 3300005344 | Bacteria | 5302 |
| 22 | Ga0070661_100016008 | 3300005344 | Bacteria | 5293 |
| 23 | Ga0070661_100022947 | 3300005344 | Bacteria | 4470 |
| 24 | Ga0070668_100001619 | 3300005347 | Bacteria | 16277 |
| 25 | Ga0070669_100050826 | 3300005353 | Bacteria | 3028 |
| 26 | Ga0070669_100050854 | 3300005353 | Bacteria | 3028 |
| 27 | Ga0070671_100024078 | 3300005355 | Bacteria | 4983 |
| 28 | Ga0070674_100030624 | 3300005356 | Bacteria | 3558 |
| 29 | Ga0070673_100163068 | 3300005364 | Unclassified | 1897 |
| 30 | Ga0070688_100006942 | 3300005365 | Bacteria | 6083 |
| 31 | Ga0070659_100007111 | 3300005366 | Bacteria | 8116 |
| 32 | Ga0070659_100015344 | 3300005366 | Bacteria | 5737 |
| 33 | Ga0070667_100053799 | 3300005367 | Bacteria | 3398 |
| 34 | Ga0070703_10002370 | 3300005406 | Bacteria | 5437 |
| 35 | Ga0070709_10003654 | 3300005434 | Bacteria | 8255 |
| 36 | Ga0070709_10004050 | 3300005434 | Bacteria | 7906 |
| 37 | Ga0070709_10026558 | 3300005434 | Bacteria | 3433 |
| 38 | Ga0070709_10080158 | 3300005434 | Bacteria | 2128 |
| 39 | Ga0070709_10080334 | 3300005434 | Bacteria | 2126 |
| 40 | Ga0070714_100000054 | 3300005435 | Bacteria | 104948 |
| 41 | Ga0070714_100020160 | 3300005435 | Bacteria | 5441 |
| 42 | Ga0070714_100042455 | 3300005435 | Bacteria | 3842 |
| 43 | Ga0070713_100000188 | 3300005436 | Bacteria | 40867 |
| 44 | Ga0070713_100005655 | 3300005436 | Bacteria | 8576 |
| 45 | Ga0070713_100025798 | 3300005436 | Bacteria | 4602 |
| 46 | Ga0070713_100043608 | 3300005436 | Bacteria | 3668 |
| 47 | Ga0070713_100154210 | 3300005436 | Unclassified | 2046 |
| 48 | Ga0070710_10005758 | 3300005437 | Bacteria | 5904 |
| 49 | Ga0070710_10012414 | 3300005437 | Bacteria | 4231 |
| 50 | Ga0070710_10019149 | 3300005437 | Bacteria | 3534 |
| 51 | Ga0070710_10070205 | 3300005437 | Unclassified | 2017 |
| 52 | Ga0070711_100005021 | 3300005439 | Bacteria | 7867 |
| 53 | Ga0070711_100011852 | 3300005439 | Bacteria | 5426 |
| 54 | Ga0070705_100001727 | 3300005440 | Bacteria | 11368 |
| 55 | Ga0070694_100031627 | 3300005444 | Bacteria | 3470 |
| 56 | Ga0070708_100000258 | 3300005445 | Bacteria | 39526 |
| 57 | Ga0070708_100000730 | 3300005445 | Bacteria | 24932 |
| 58 | Ga0070708_100002282 | 3300005445 | Bacteria | 14838 |
| 59 | Ga0070708_100003396 | 3300005445 | Bacteria | 12471 |
| 60 | Ga0070708_100003476 | 3300005445 | Bacteria | 12334 |
| 61 | Ga0070708_100087578 | 3300005445 | Bacteria | 2830 |
| 62 | Ga0070708_100131230 | 3300005445 | Bacteria | 2319 |
| 63 | Ga0070708_100257672 | 3300005445 | Unclassified | 1639 |
| 64 | Ga0070662_100001311 | 3300005457 | Bacteria | 15290 |
| 65 | Ga0070681_10161405 | 3300005458 | Bacteria | 2165 |
| 66 | Ga0068867_100017340 | 3300005459 | Bacteria | 5114 |
| 67 | Ga0068867_100018927 | 3300005459 | Bacteria | 4901 |
| 68 | Ga0068867_100022678 | 3300005459 | Bacteria | 4490 |
| 69 | Ga0068867_100102443 | 3300005459 | Bacteria | 2188 |
| 70 | Ga0070706_100001995 | 3300005467 | Bacteria | 21055 |
| 71 | Ga0070706_100002945 | 3300005467 | Bacteria | 16899 |
| 72 | Ga0070706_100035823 | 3300005467 | Bacteria | 4582 |
| 73 | Ga0070706_100114165 | 3300005467 | Bacteria | 2515 |
| 74 | Ga0070707_100003955 | 3300005468 | Bacteria | 13953 |
| 75 | Ga0070707_100022628 | 3300005468 | Bacteria | 5943 |
| 76 | Ga0070707_100023194 | 3300005468 | Bacteria | 5870 |
| 77 | Ga0070707_100039468 | 3300005468 | Bacteria | 4512 |
| 78 | Ga0070707_100052786 | 3300005468 | Bacteria | 3897 |
| 79 | Ga0070707_100059365 | 3300005468 | Bacteria | 3669 |
| 80 | Ga0070698_100000148 | 3300005471 | Bacteria | 63449 |
| 81 | Ga0070698_100002041 | 3300005471 | Bacteria | 22434 |
| 82 | Ga0070698_100136062 | 3300005471 | Bacteria | 2411 |
| 83 | Ga0070699_100001045 | 3300005518 | Bacteria | 25776 |
| 84 | Ga0070699_100006769 | 3300005518 | Bacteria | 9971 |
| 85 | Ga0070699_100031914 | 3300005518 | Bacteria | 4548 |
| 86 | Ga0070699_100067098 | 3300005518 | Bacteria | 3115 |
| 87 | Ga0070699_100116533 | 3300005518 | Bacteria | 2348 |
| 88 | Ga0070699_100161157 | 3300005518 | Bacteria | 1985 |
| 89 | Ga0070684_100029051 | 3300005535 | Bacteria | 4682 |
| 90 | Ga0070684_100040018 | 3300005535 | Bacteria | 4033 |
| 91 | Ga0070684_100072169 | 3300005535 | Bacteria | 3039 |
| 92 | Ga0070697_100000092 | 3300005536 | Bacteria | 75107 |
| 93 | Ga0070697_100000570 | 3300005536 | Bacteria | 27832 |
| 94 | Ga0070697_100000630 | 3300005536 | Bacteria | 26714 |
| 95 | Ga0070697_100000921 | 3300005536 | Bacteria | 22143 |
| 96 | Ga0070697_100062341 | 3300005536 | Bacteria | 3043 |
| 97 | Ga0070697_100118734 | 3300005536 | Bacteria | 2210 |
| 98 | Ga0070697_100221599 | 3300005536 | Unclassified | 1612 |
| 99 | Ga0070686_100011250 | 3300005544 | Bacteria | 5070 |
| 100 | Ga0070695_100035677 | 3300005545 | Bacteria | 3124 |
| 101 | Ga0070696_100000413 | 3300005546 | Bacteria | 26661 |
| 102 | Ga0070696_100121466 | 3300005546 | Unclassified | 1891 |
| 103 | Ga0070696_100158675 | 3300005546 | Bacteria | 1665 |
| 104 | Ga0070693_100000309 | 3300005547 | Bacteria | 22684 |
| 105 | Ga0070693_100010569 | 3300005547 | Bacteria | 4628 |
| 106 | Ga0070693_100028360 | 3300005547 | Bacteria | 3043 |
| 107 | Ga0070665_100002088 | 3300005548 | Bacteria | 22395 |
| 108 | Ga0070665_100009890 | 3300005548 | Bacteria | 9644 |
| 109 | Ga0070704_100000191 | 3300005549 | Bacteria | 25096 |
| 110 | Ga0070704_100042863 | 3300005549 | Bacteria | 3133 |
| 111 | Ga0068855_100005150 | 3300005563 | Bacteria | 15945 |
| 112 | Ga0068855_100055914 | 3300005563 | Bacteria | 4632 |
| 113 | Ga0070664_100001802 | 3300005564 | Bacteria | 17165 |
| 114 | Ga0070664_100017155 | 3300005564 | Bacteria | 5944 |
| 115 | Ga0070664_100030028 | 3300005564 | Bacteria | 4533 |
| 116 | Ga0068857_100068151 | 3300005577 | Bacteria | 3167 |
| 117 | Ga0068857_100112114 | 3300005577 | Bacteria | 2452 |
| 118 | Ga0068857_100182827 | 3300005577 | Bacteria | 1908 |
| 119 | Ga0068854_100007433 | 3300005578 | Bacteria | 7000 |
| 120 | Ga0068856_100000436 | 3300005614 | Bacteria | 45887 |
| 121 | Ga0068856_100090018 | 3300005614 | Bacteria | 3052 |
| 122 | Ga0070702_100019038 | 3300005615 | Bacteria | 3572 |
| 123 | Ga0068852_100018688 | 3300005616 | Bacteria | 5464 |
| 124 | Ga0068852_100026397 | 3300005616 | Bacteria | 4720 |
| 125 | Ga0068852_100096151 | 3300005616 | Unclassified | 2661 |
| 126 | Ga0068852_100132522 | 3300005616 | Bacteria | 2297 |
| 127 | Ga0068859_100011960 | 3300005617 | Bacteria | 8717 |
| 128 | Ga0068859_100035120 | 3300005617 | Bacteria | 5030 |
| 129 | Ga0068859_100047598 | 3300005617 | Bacteria | 4309 |
| 130 | Ga0068864_100006672 | 3300005618 | Bacteria | 9449 |
| 131 | Ga0068864_100038468 | 3300005618 | Bacteria | 4085 |
| 132 | Ga0068864_100051749 | 3300005618 | Bacteria | 3539 |
| 133 | Ga0068866_10065874 | 3300005718 | Unclassified | 1896 |
| 134 | Ga0068851_10010152 | 3300005834 | Bacteria | 4388 |
| 135 | Ga0068870_10010366 | 3300005840 | Bacteria | 4280 |
| 136 | Ga0068870_10029163 | 3300005840 | Bacteria | 2777 |
| 137 | Ga0068863_100006247 | 3300005841 | Bacteria | 11704 |
| 138 | Ga0068863_100034458 | 3300005841 | Bacteria | 4822 |
| 139 | Ga0068858_100001669 | 3300005842 | Bacteria | 22692 |
| 140 | Ga0068858_100005368 | 3300005842 | Bacteria | 12563 |
| 141 | Ga0068858_100050011 | 3300005842 | Bacteria | 3869 |
| 142 | Ga0068860_100027846 | 3300005843 | Bacteria | 5442 |
| 143 | Ga0068860_100059154 | 3300005843 | Bacteria | 3644 |
| 144 | Ga0068860_100135103 | 3300005843 | Bacteria | 2368 |
| 145 | Ga0068862_100022178 | 3300005844 | Bacteria | 5313 |
| 146 | Ga0081540_1030947 | 3300005983 | Bacteria | 2954 |
| 147 | Ga0070717_10000472 | 3300006028 | Bacteria | 25636 |
| 148 | Ga0070717_10001371 | 3300006028 | Bacteria | 16788 |
| 149 | Ga0070717_10007398 | 3300006028 | Bacteria | 8152 |
| 150 | Ga0070717_10014331 | 3300006028 | Bacteria | 6098 |
| 151 | Ga0070717_10068647 | 3300006028 | Bacteria | 2951 |
| 152 | Ga0070717_10267170 | 3300006028 | Bacteria | 1514 |
| 153 | Ga0070715_10009345 | 3300006163 | Bacteria | 3454 |
| 154 | Ga0070715_10012060 | 3300006163 | Bacteria | 3131 |
| 155 | Ga0070715_10030848 | 3300006163 | Bacteria | 2171 |
| 156 | Ga0070716_100000300 | 3300006173 | Bacteria | 19983 |
| 157 | Ga0070716_100009732 | 3300006173 | Bacteria | 4799 |
| 158 | Ga0070716_100013266 | 3300006173 | Bacteria | 4196 |
| 159 | Ga0070716_100044114 | 3300006173 | Bacteria | 2497 |
| 160 | Ga0070712_100006280 | 3300006175 | Bacteria | 7362 |
| 161 | Ga0070712_100009078 | 3300006175 | Bacteria | 6260 |
| 162 | Ga0070712_100009576 | 3300006175 | Bacteria | 6107 |
| 163 | Ga0070712_100166673 | 3300006175 | Bacteria | 1706 |
| 164 | Ga0097621_100000183 | 3300006237 | Bacteria | 39949 |
| 165 | Ga0097621_100001802 | 3300006237 | Bacteria | 14707 |
| 166 | Ga0097621_100004754 | 3300006237 | Bacteria | 9496 |
| 167 | Ga0097621_100013368 | 3300006237 | Bacteria | 6118 |
| 168 | Ga0097621_100101683 | 3300006237 | Bacteria | 2419 |
| 169 | Ga0068871_100002972 | 3300006358 | Bacteria | 11632 |
| 170 | Ga0068871_100007289 | 3300006358 | Bacteria | 7891 |
| 171 | Ga0068871_100029002 | 3300006358 | Bacteria | 4344 |
| 172 | Ga0075434_100046681 | 3300006871 | Bacteria | 4298 |
| 173 | Ga0075436_100006574 | 3300006914 | Bacteria | 7961 |
| 174 | Ga0075436_100007607 | 3300006914 | Bacteria | 7402 |
| 175 | Ga0075436_100011669 | 3300006914 | Bacteria | 6029 |
| 176 | Ga0075436_100014415 | 3300006914 | Bacteria | 5412 |
| 177 | Ga0075436_100143371 | 3300006914 | Unclassified | 1680 |
| 178 | Ga0097620_100011960 | 3300006931 | Bacteria | 8717 |
| 179 | Ga0097620_100035120 | 3300006931 | Bacteria | 5030 |
| 180 | Ga0097620_100047598 | 3300006931 | Bacteria | 4309 |
| 181 | Ga0075435_100008964 | 3300007076 | Bacteria | 7213 |
| 182 | Ga0075435_100011548 | 3300007076 | Bacteria | 6504 |
| 183 | Ga0099794_10000669 | 3300007265 | Bacteria | 11473 |
| 184 | Ga0099794_10009809 | 3300007265 | Bacteria | 4044 |
| 185 | Ga0099794_10027161 | 3300007265 | Bacteria | 2651 |
| 186 | Ga0099795_10021510 | 3300007788 | Bacteria | 2117 |
| 187 | Ga0105251_10055370 | 3300009011 | Bacteria | 1881 |
| 188 | Ga0105240_10022678 | 3300009093 | Bacteria | 8317 |
| 189 | Ga0105240_10052964 | 3300009093 | Bacteria | 5098 |
| 190 | Ga0105240_10055244 | 3300009093 | Bacteria | 4972 |
| 191 | Ga0105240_10176428 | 3300009093 | Unclassified | 2526 |
| 192 | Ga0105245_10005793 | 3300009098 | Bacteria | 10839 |
| 193 | Ga0105245_10053219 | 3300009098 | Bacteria | 3633 |
| 194 | Ga0105245_10077715 | 3300009098 | Bacteria | 3027 |
| 195 | Ga0105247_10034392 | 3300009101 | Bacteria | 3086 |
| 196 | Ga0105243_10069081 | 3300009148 | Bacteria | 2849 |
| 197 | Ga0105241_10004694 | 3300009174 | Bacteria | 10088 |
| 198 | Ga0105241_10014773 | 3300009174 | Bacteria | 5716 |
| 199 | Ga0105241_10024601 | 3300009174 | Bacteria | 4472 |
| 200 | Ga0105241_10026134 | 3300009174 | Bacteria | 4341 |
| 201 | Ga0105242_10028250 | 3300009176 | Bacteria | 4464 |
| 202 | Ga0105242_10032960 | 3300009176 | Bacteria | 4145 |
| 203 | Ga0105242_10046508 | 3300009176 | Bacteria | 3521 |
| 204 | Ga0105248_10010896 | 3300009177 | Bacteria | 10032 |
| 205 | Ga0105248_10014251 | 3300009177 | Bacteria | 8751 |
| 206 | Ga0105248_10026894 | 3300009177 | Bacteria | 6398 |
| 207 | Ga0105248_10047499 | 3300009177 | Bacteria | 4814 |
| 208 | Ga0105248_10056239 | 3300009177 | Bacteria | 4414 |
| 209 | Ga0105248_10114221 | 3300009177 | Bacteria | 3046 |
| 210 | Ga0105237_10034900 | 3300009545 | Bacteria | 5090 |
| 211 | Ga0105237_10040485 | 3300009545 | Bacteria | 4699 |
| 212 | Ga0105237_10050004 | 3300009545 | Bacteria | 4201 |
| 213 | Ga0105237_10081906 | 3300009545 | Bacteria | 3218 |
| 214 | Ga0105238_10007499 | 3300009551 | Bacteria | 10929 |
| 215 | Ga0105238_10020954 | 3300009551 | Bacteria | 6660 |
| 216 | Ga0105249_10013641 | 3300009553 | Bacteria | 7175 |
| 217 | Ga0105239_10008576 | 3300010375 | Bacteria | 11598 |
| 218 | Ga0105239_10047148 | 3300010375 | Bacteria | 4722 |
| 219 | Ga0105246_10119211 | 3300011119 | Bacteria | 1952 |
| 220 | Ga0157373_10006176 | 3300013100 | Bacteria | 8952 |
| 221 | Ga0157373_10034470 | 3300013100 | Bacteria | 3635 |
| 222 | Ga0157373_10102733 | 3300013100 | Bacteria | 2011 |
| 223 | Ga0157371_10003936 | 3300013102 | Bacteria | 13191 |
| 224 | Ga0157371_10013553 | 3300013102 | Bacteria | 6190 |
| 225 | Ga0157371_10042869 | 3300013102 | Unclassified | 3225 |
| 226 | Ga0157371_10158772 | 3300013102 | Bacteria | 1615 |
| 227 | Ga0157369_10028452 | 3300013105 | Bacteria | 6185 |
| 228 | Ga0157369_10044245 | 3300013105 | Unclassified | 4847 |
| 229 | Ga0157369_10154202 | 3300013105 | Bacteria | 2427 |
| 230 | Ga0157369_10163164 | 3300013105 | Bacteria | 2351 |
| 231 | Ga0157374_10000187 | 3300013296 | Bacteria | 57781 |
| 232 | Ga0157374_10007069 | 3300013296 | Bacteria | 9557 |
| 233 | Ga0157374_10017621 | 3300013296 | Bacteria | 6292 |
| 234 | Ga0157374_10024896 | 3300013296 | Bacteria | 5369 |
| 235 | Ga0157374_10028852 | 3300013296 | Bacteria | 5017 |
| 236 | Ga0157378_10000161 | 3300013297 | Bacteria | 63839 |
| 237 | Ga0157378_10000181 | 3300013297 | Bacteria | 60266 |
| 238 | Ga0157378_10000353 | 3300013297 | Bacteria | 45114 |
| 239 | Ga0157378_10000739 | 3300013297 | Bacteria | 30524 |
| 240 | Ga0157378_10005841 | 3300013297 | Bacteria | 10788 |
| 241 | Ga0157378_10107199 | 3300013297 | Bacteria | 2557 |
| 242 | Ga0157378_10130450 | 3300013297 | Bacteria | 2326 |
| 243 | Ga0163162_10002288 | 3300013306 | Bacteria | 17976 |
| 244 | Ga0163162_10008859 | 3300013306 | Bacteria | 9781 |
| 245 | Ga0163162_10099282 | 3300013306 | Bacteria | 3002 |
| 246 | Ga0157372_10001859 | 3300013307 | Bacteria | 22893 |
| 247 | Ga0157372_10005390 | 3300013307 | Bacteria | 13600 |
| 248 | Ga0157372_10006207 | 3300013307 | Bacteria | 12699 |
| 249 | Ga0157372_10008201 | 3300013307 | Bacteria | 11101 |
| 250 | Ga0157372_10013942 | 3300013307 | Bacteria | 8588 |
| 251 | Ga0157372_10066198 | 3300013307 | Bacteria | 4059 |
| 252 | Ga0157375_10098527 | 3300013308 | Bacteria | 3000 |
| 253 | Ga0163163_10001664 | 3300014325 | Bacteria | 18732 |
| 254 | Ga0163163_10012039 | 3300014325 | Bacteria | 7871 |
| 255 | Ga0163163_10046496 | 3300014325 | Bacteria | 4263 |
| 256 | Ga0163163_10060798 | 3300014325 | Bacteria | 3742 |
| 257 | Ga0163163_10106682 | 3300014325 | Bacteria | 2827 |
| 258 | Ga0157380_10096094 | 3300014326 | Bacteria | 2456 |
| 259 | Ga0157377_10001157 | 3300014745 | Bacteria | 11181 |
| 260 | Ga0157379_10001683 | 3300014968 | Bacteria | 18273 |
| 261 | Ga0157379_10006009 | 3300014968 | Bacteria | 10465 |
| 262 | Ga0157379_10023305 | 3300014968 | Bacteria | 5492 |
| 263 | Ga0157379_10031396 | 3300014968 | Bacteria | 4732 |
| 264 | Ga0157379_10167571 | 3300014968 | Bacteria | 1983 |
| 265 | Ga0157376_10000008 | 3300014969 | Bacteria | 351192 |
| 266 | Ga0157376_10000852 | 3300014969 | Bacteria | 20014 |
| 267 | Ga0157376_10003365 | 3300014969 | Bacteria | 11002 |
| 268 | Ga0157376_10036361 | 3300014969 | Bacteria | 3989 |
| 269 | Ga0157376_10049130 | 3300014969 | Bacteria | 3493 |
| 270 | Ga0213874_10018106 | 3300021377 | Unclassified | 1900 |
| 271 | Ga0213876_10036462 | 3300021384 | Unclassified | 2593 |
| 272 | Ga0228598_1001070 | 3300024227 | Bacteria | 6022 |
| 273 | Ga0228598_1001796 | 3300024227 | Bacteria | 4678 |
| 274 | Ga0207697_10031844 | 3300025315 | Bacteria | 2158 |
| 275 | Ga0207656_10007524 | 3300025321 | Bacteria | 3971 |
| 276 | Ga0207653_10004906 | 3300025885 | Bacteria | 4180 |
| 277 | Ga0207692_10005292 | 3300025898 | Bacteria | 5159 |
| 278 | Ga0207642_10006892 | 3300025899 | Bacteria | 3804 |
| 279 | Ga0207680_10023226 | 3300025903 | Bacteria | 3383 |
| 280 | Ga0207680_10054926 | 3300025903 | Bacteria | 2398 |
| 281 | Ga0207647_10007769 | 3300025904 | Bacteria | 7719 |
| 282 | Ga0207647_10008969 | 3300025904 | Bacteria | 7124 |
| 283 | Ga0207647_10012828 | 3300025904 | Bacteria | 5822 |
| 284 | Ga0207685_10006871 | 3300025905 | Bacteria | 3131 |
| 285 | Ga0207685_10023098 | 3300025905 | Bacteria | 2112 |
| 286 | Ga0207699_10007982 | 3300025906 | Unclassified | 5198 |
| 287 | Ga0207699_10008109 | 3300025906 | Bacteria | 5167 |
| 288 | Ga0207699_10008908 | 3300025906 | Bacteria | 4974 |
| 289 | Ga0207699_10033284 | 3300025906 | Bacteria | 2912 |
| 290 | Ga0207645_10000330 | 3300025907 | Bacteria | 39597 |
| 291 | Ga0207645_10010617 | 3300025907 | Bacteria | 6318 |
| 292 | Ga0207643_10000975 | 3300025908 | Bacteria | 17195 |
| 293 | Ga0207643_10035523 | 3300025908 | Bacteria | 2795 |
| 294 | Ga0207684_10000447 | 3300025910 | Bacteria | 54429 |
| 295 | Ga0207684_10002057 | 3300025910 | Bacteria | 20692 |
| 296 | Ga0207684_10002811 | 3300025910 | Bacteria | 17297 |
| 297 | Ga0207684_10082853 | 3300025910 | Bacteria | 2732 |
| 298 | Ga0207654_10014519 | 3300025911 | Bacteria | 4070 |
| 299 | Ga0207654_10018553 | 3300025911 | Bacteria | 3653 |
| 300 | Ga0207654_10023554 | 3300025911 | Bacteria | 3299 |
| 301 | Ga0207654_10034960 | 3300025911 | Bacteria | 2796 |
| 302 | Ga0207695_10035323 | 3300025913 | Bacteria | 5423 |
| 303 | Ga0207695_10046682 | 3300025913 | Bacteria | 4589 |
| 304 | Ga0207695_10070215 | 3300025913 | Unclassified | 3582 |
| 305 | Ga0207695_10127400 | 3300025913 | Unclassified | 2506 |
| 306 | Ga0207671_10022269 | 3300025914 | Bacteria | 4792 |
| 307 | Ga0207671_10022952 | 3300025914 | Bacteria | 4711 |
| 308 | Ga0207671_10045342 | 3300025914 | Bacteria | 3251 |
| 309 | Ga0207693_10001184 | 3300025915 | Bacteria | 23296 |
| 310 | Ga0207693_10003013 | 3300025915 | Bacteria | 14570 |
| 311 | Ga0207693_10007281 | 3300025915 | Bacteria | 9106 |
| 312 | Ga0207693_10016219 | 3300025915 | Bacteria | 5957 |
| 313 | Ga0207663_10003294 | 3300025916 | Bacteria | 7871 |
| 314 | Ga0207663_10033563 | 3300025916 | Bacteria | 3059 |
| 315 | Ga0207663_10039944 | 3300025916 | Bacteria | 2847 |
| 316 | Ga0207663_10054423 | 3300025916 | Bacteria | 2506 |
| 317 | Ga0207662_10007683 | 3300025918 | Bacteria | 5874 |
| 318 | Ga0207657_10000458 | 3300025919 | Bacteria | 43216 |
| 319 | Ga0207657_10002016 | 3300025919 | Bacteria | 21946 |
| 320 | Ga0207657_10002563 | 3300025919 | Bacteria | 19662 |
| 321 | Ga0207649_10002595 | 3300025920 | Bacteria | 10036 |
| 322 | Ga0207649_10053224 | 3300025920 | Bacteria | 2515 |
| 323 | Ga0207652_10005526 | 3300025921 | Bacteria | 10247 |
| 324 | Ga0207646_10000676 | 3300025922 | Bacteria | 44173 |
| 325 | Ga0207646_10001577 | 3300025922 | Bacteria | 27856 |
| 326 | Ga0207646_10005589 | 3300025922 | Bacteria | 13200 |
| 327 | Ga0207646_10071315 | 3300025922 | Bacteria | 3103 |
| 328 | Ga0207646_10079657 | 3300025922 | Bacteria | 2929 |
| 329 | Ga0207646_10092553 | 3300025922 | Bacteria | 2706 |
| 330 | Ga0207681_10039151 | 3300025923 | Bacteria | 3145 |
| 331 | Ga0207650_10000058 | 3300025925 | Bacteria | 153056 |
| 332 | Ga0207650_10009443 | 3300025925 | Bacteria | 6666 |
| 333 | Ga0207659_10014384 | 3300025926 | Bacteria | 5102 |
| 334 | Ga0207687_10025104 | 3300025927 | Bacteria | 3987 |
| 335 | Ga0207687_10025467 | 3300025927 | Bacteria | 3958 |
| 336 | Ga0207700_10004881 | 3300025928 | Bacteria | 7966 |
| 337 | Ga0207700_10037500 | 3300025928 | Bacteria | 3511 |
| 338 | Ga0207700_10058095 | 3300025928 | Bacteria | 2921 |
| 339 | Ga0207700_10072857 | 3300025928 | Bacteria | 2650 |
| 340 | Ga0207700_10145613 | 3300025928 | Bacteria | 1952 |
| 341 | Ga0207664_10000954 | 3300025929 | Bacteria | 19503 |
| 342 | Ga0207664_10004842 | 3300025929 | Bacteria | 9154 |
| 343 | Ga0207664_10012565 | 3300025929 | Bacteria | 6058 |
| 344 | Ga0207644_10013643 | 3300025931 | Bacteria | 5422 |
| 345 | Ga0207706_10000245 | 3300025933 | Bacteria | 59509 |
| 346 | Ga0207706_10000676 | 3300025933 | Bacteria | 35793 |
| 347 | Ga0207706_10016843 | 3300025933 | Bacteria | 6596 |
| 348 | Ga0207706_10192365 | 3300025933 | Bacteria | 1790 |
| 349 | Ga0207686_10012288 | 3300025934 | Bacteria | 4705 |
| 350 | Ga0207709_10015686 | 3300025935 | Bacteria | 4204 |
| 351 | Ga0207670_10007488 | 3300025936 | Bacteria | 6095 |
| 352 | Ga0207669_10033410 | 3300025937 | Bacteria | 2903 |
| 353 | Ga0207665_10000049 | 3300025939 | Bacteria | 76350 |
| 354 | Ga0207665_10000080 | 3300025939 | Bacteria | 62639 |
| 355 | Ga0207665_10005337 | 3300025939 | Bacteria | 8587 |
| 356 | Ga0207665_10021778 | 3300025939 | Bacteria | 4216 |
| 357 | Ga0207665_10056305 | 3300025939 | Bacteria | 2654 |
| 358 | Ga0207691_10031536 | 3300025940 | Bacteria | 4946 |
| 359 | Ga0207711_10018376 | 3300025941 | Bacteria | 5812 |
| 360 | Ga0207711_10021120 | 3300025941 | Bacteria | 5438 |
| 361 | Ga0207689_10000734 | 3300025942 | Bacteria | 31550 |
| 362 | Ga0207689_10004057 | 3300025942 | Bacteria | 13302 |
| 363 | Ga0207689_10010914 | 3300025942 | Bacteria | 7810 |
| 364 | Ga0207689_10027907 | 3300025942 | Bacteria | 4722 |
| 365 | Ga0207661_10000551 | 3300025944 | Bacteria | 23963 |
| 366 | Ga0207661_10222751 | 3300025944 | Bacteria | 1668 |
| 367 | Ga0207679_10000170 | 3300025945 | Bacteria | 53584 |
| 368 | Ga0207679_10053668 | 3300025945 | Bacteria | 2963 |
| 369 | Ga0207667_10000694 | 3300025949 | Bacteria | 43647 |
| 370 | Ga0207667_10022433 | 3300025949 | Bacteria | 6974 |
| 371 | Ga0207667_10088311 | 3300025949 | Bacteria | 3207 |
| 372 | Ga0207651_10017392 | 3300025960 | Bacteria | 4248 |
| 373 | Ga0207712_10076207 | 3300025961 | Bacteria | 2427 |
| 374 | Ga0207668_10056982 | 3300025972 | Bacteria | 2724 |
| 375 | Ga0207640_10001398 | 3300025981 | Bacteria | 13020 |
| 376 | Ga0207640_10037304 | 3300025981 | Bacteria | 3057 |
| 377 | Ga0207640_10044511 | 3300025981 | Bacteria | 2845 |
| 378 | Ga0207677_10001639 | 3300026023 | Bacteria | 11858 |
| 379 | Ga0207677_10002373 | 3300026023 | Bacteria | 9859 |
| 380 | Ga0207677_10010595 | 3300026023 | Bacteria | 5222 |
| 381 | Ga0207677_10052811 | 3300026023 | Bacteria | 2763 |
| 382 | Ga0207703_10003415 | 3300026035 | Bacteria | 13332 |
| 383 | Ga0207703_10213856 | 3300026035 | Bacteria | 1720 |
| 384 | Ga0207639_10039043 | 3300026041 | Unclassified | 3535 |
| 385 | Ga0207639_10141830 | 3300026041 | Bacteria | 2003 |
| 386 | Ga0207678_10000666 | 3300026067 | Bacteria | 31531 |
| 387 | Ga0207678_10005878 | 3300026067 | Bacteria | 10936 |
| 388 | Ga0207708_10077133 | 3300026075 | Bacteria | 2557 |
| 389 | Ga0207702_10000657 | 3300026078 | Bacteria | 37655 |
| 390 | Ga0207702_10009897 | 3300026078 | Bacteria | 7993 |
| 391 | Ga0207702_10013784 | 3300026078 | Bacteria | 6714 |
| 392 | Ga0207641_10000323 | 3300026088 | Bacteria | 58693 |
| 393 | Ga0207641_10008200 | 3300026088 | Bacteria | 8635 |
| 394 | Ga0207641_10020160 | 3300026088 | Bacteria | 5474 |
| 395 | Ga0207648_10001360 | 3300026089 | Bacteria | 27048 |
| 396 | Ga0207648_10012134 | 3300026089 | Bacteria | 8079 |
| 397 | Ga0207648_10019307 | 3300026089 | Bacteria | 6152 |
| 398 | Ga0207648_10022125 | 3300026089 | Bacteria | 5711 |
| 399 | Ga0207676_10000163 | 3300026095 | Bacteria | 58243 |
| 400 | Ga0207676_10004714 | 3300026095 | Bacteria | 9662 |
| 401 | Ga0207674_10000164 | 3300026116 | Bacteria | 79381 |
| 402 | Ga0207674_10000905 | 3300026116 | Bacteria | 38684 |
| 403 | Ga0207674_10058520 | 3300026116 | Bacteria | 3903 |
| 404 | Ga0207675_100032027 | 3300026118 | Bacteria | 4898 |
| 405 | Ga0207683_10006145 | 3300026121 | Bacteria | 10290 |
| 406 | Ga0207698_10052865 | 3300026142 | Bacteria | 3114 |
| 407 | Ga0209179_1009170 | 3300027512 | Unclassified | 1688 |
| 408 | Ga0209588_1001776 | 3300027671 | Bacteria | 5724 |
| 409 | Ga0209588_1002774 | 3300027671 | Bacteria | 4794 |
| 410 | Ga0265354_1002457 | 3300028016 | Bacteria | 2287 |
| 411 | Ga0265357_1000346 | 3300028023 | Bacteria | 2530 |
| 412 | Ga0268266_10000227 | 3300028379 | Bacteria | 97786 |
| 413 | Ga0268266_10046087 | 3300028379 | Bacteria | 3732 |
| 414 | Ga0268265_10021199 | 3300028380 | Bacteria | 4548 |
| 415 | Ga0268265_10031505 | 3300028380 | Bacteria | 3829 |
| 416 | Ga0268264_10029558 | 3300028381 | Bacteria | 4489 |
| 417 | Ga0268264_10030611 | 3300028381 | Bacteria | 4411 |
| 418 | Ga0268264_10042130 | 3300028381 | Bacteria | 3779 |
| 419 | Ga0268264_10125159 | 3300028381 | Bacteria | 2271 |
| 420 | Ga0265338_10004188 | 3300028800 | Bacteria | 19676 |
| 421 | Ga0265338_10035922 | 3300028800 | Bacteria | 4752 |
| 422 | Ga0265338_10069365 | 3300028800 | Bacteria | 3029 |
| 423 | Ga0265762_1000325 | 3300030760 | Bacteria | 8066 |
| 424 | Ga0265770_1000601 | 3300030878 | Bacteria | 4986 |
| 425 | Ga0265770_1002307 | 3300030878 | Bacteria | 2593 |
| 426 | Ga0265765_1000384 | 3300030879 | Bacteria | 3369 |
| 427 | Ga0265760_10000141 | 3300031090 | Bacteria | 18302 |
| 428 | Ga0265760_10003719 | 3300031090 | Bacteria | 4414 |
| 429 | Ga0265316_10004327 | 3300031344 | Bacteria | 14159 |
| 430 | Ga0265316_10042197 | 3300031344 | Bacteria | 3647 |
| 431 | Ga0265314_10032002 | 3300031711 | Bacteria | 3875 |
| 432 | Ga0316212_1000580 | 3300033547 | Bacteria | 4555 |
| 433 | Ga0373936_0008709 | 3300035113 | Bacteria | 3820 |
| 434 | Ga0373945_0000496 | 3300035116 | Bacteria | 11179 |
| 435 | Ga0373953_0035093 | 3300035117 | Bacteria | 1969 |
| 436 | Ga0373954_0036245 | 3300035118 | Bacteria | 2289 |
| 437 | Ga0373956_0005475 | 3300035119 | Bacteria | 5084 |
| 438 | Ga0373957_0005562 | 3300035120 | Bacteria | 3911 |
| 439 | Ga0373943_0000045 | 3300035170 | Bacteria | 42005 |
| 440 | Ga0373943_0004997 | 3300035170 | Bacteria | 5985 |
| 441 | Ga0373946_0002383 | 3300035171 | Bacteria | 6649 |
| 442 | Ga0373946_0003252 | 3300035171 | Bacteria | 5771 |
| 443 | Ga0373931_0016020 | 3300035691 | Bacteria | 3685 |
| 444 | Ga0373935_0018520 | 3300035692 | Bacteria | 4236 |
| 445 | Ga0373927_0000094 | 3300035695 | Bacteria | 66764 |
| 446 | Ga0373927_0002440 | 3300035695 | Bacteria | 13559 |
| 447 | Ga0373927_0018433 | 3300035695 | Bacteria | 4588 |
| 448 | Ga0373933_0028200 | 3300035724 | Bacteria | 3237 |
| 449 | Ga0373947_0006702 | 3300035725 | Bacteria | 6683 |
| 450 | Ga0373937_0000555 | 3300036401 | Bacteria | 33153 |
| 451 | Ga0373937_0064562 | 3300036401 | Bacteria | 3368 |
| 452 | Ga0373937_0255139 | 3300036401 | Unclassified | 1653 |
| 453 | Ga0373925_0000297 | 3300037068 | Bacteria | 52136 |
| 454 | Ga0373925_0003730 | 3300037068 | Bacteria | 11699 |
| 455 | Ga0373925_0007729 | 3300037068 | Bacteria | 7829 |
| 456 | Ga0373925_0024183 | 3300037068 | Bacteria | 4434 |
| 457 | Ga0436364_0831126 | 3300037853 | Bacteria | 1725 |
| 458 | Ga0436365_0942396 | 3300039437 | Bacteria | 6505 |
| 459 | Ga0436363_0665316 | 3300039450 | Bacteria | 4015 |
| 460 | Ga0495629_0015435 | 3300046459 | Bacteria | 5485 |
| 461 | Ga0495653_0125873 | 3300046463 | Unclassified | 1820 |
| 462 | Ga0495580_0000037 | 3300046472 | Bacteria | 71995 |
| 463 | Ga0495580_0008672 | 3300046472 | Bacteria | 8060 |
| 464 | Ga0495580_0008800 | 3300046472 | Bacteria | 7992 |
| 465 | Ga0495580_0011396 | 3300046472 | Bacteria | 6880 |
| 466 | Ga0495580_0014399 | 3300046472 | Bacteria | 5999 |
| 467 | Ga0495580_0066309 | 3300046472 | Bacteria | 2527 |
| 468 | Ga0495639_0002138 | 3300046475 | Bacteria | 8715 |
| 469 | Ga0495662_0037673 | 3300046476 | Bacteria | 2336 |
| 470 | Ga0495664_0026856 | 3300046477 | Bacteria | 3355 |
| 471 | Ga0495594_0015281 | 3300046499 | Unclassified | 4030 |
| 472 | Ga0495628_0004325 | 3300046516 | Bacteria | 12607 |
| 473 | Ga0495630_0017481 | 3300046517 | Bacteria | 5254 |
| 474 | Ga0495640_0002276 | 3300046533 | Bacteria | 15394 |
| 475 | Ga0495586_0010064 | 3300046535 | Bacteria | 5034 |
| 476 | Ga0495587_0002499 | 3300046536 | Bacteria | 12276 |
| 477 | Ga0495647_0002553 | 3300046681 | Bacteria | 5769 |
| 478 | Ga0495669_0048049 | 3300046684 | Unclassified | 1908 |
| 479 | Ga0495613_0056299 | 3300046689 | Bacteria | 2887 |
| 480 | Ga0495581_0046568 | 3300047315 | Bacteria | 2506 |
| 481 | Ga0495674_0016465 | 3300047319 | Bacteria | 6896 |
| 482 | Ga0495676_0047424 | 3300047321 | Bacteria | 3474 |
| 483 | Ga0495675_0003992 | 3300047444 | Bacteria | 8941 |
| 484 | Ga0495684_0047632 | 3300047471 | Bacteria | 3278 |
| 485 | Ga0495602_0001204 | 3300048088 | Bacteria | 25464 |
| 486 | Ga0495602_0150745 | 3300048088 | Bacteria | 1828 |
| 487 | Ga0496100_0008437 | 3300048903 | Bacteria | 5747 |
| 488 | Ga0496100_0042229 | 3300048903 | Bacteria | 2912 |
| 489 | Ga0496101_0062585 | 3300048904 | Bacteria | 2706 |
| 490 | Ga0496102_0004513 | 3300048905 | Bacteria | 11761 |
| 491 | Ga0496102_0019020 | 3300048905 | Bacteria | 6044 |
| 492 | Ga0496102_0041183 | 3300048905 | Unclassified | 4182 |
| 493 | Ga0496102_0100259 | 3300048905 | Unclassified | 2689 |
| 494 | Ga0496103_0008179 | 3300048906 | Bacteria | 6208 |
| 495 | Ga0496103_0008280 | 3300048906 | Bacteria | 6175 |
| 496 | Ga0496104_0172237 | 3300048907 | Bacteria | 2075 |
| 497 | Ga0496106_0154965 | 3300048909 | Bacteria | 1809 |
| 498 | Ga0496107_0043185 | 3300048910 | Bacteria | 3239 |
| 499 | Ga0496107_0062791 | 3300048910 | Unclassified | 2691 |
| 500 | Ga0496108_0010617 | 3300048911 | Bacteria | 7471 |
| 501 | Ga0496109_0000169 | 3300048912 | Bacteria | 64301 |
| 502 | Ga0496110_0001005 | 3300048913 | Bacteria | 19871 |
| 503 | Ga0496110_0053160 | 3300048913 | Bacteria | 3560 |
| 504 | Ga0496110_0204277 | 3300048913 | Unclassified | 1795 |
| 505 | Ga0496111_0022660 | 3300048914 | Bacteria | 4399 |
| 506 | Ga0496112_0000060 | 3300048915 | Bacteria | 74795 |
| 507 | Ga0496112_0015045 | 3300048915 | Bacteria | 7203 |
| 508 | Ga0496112_0040983 | 3300048915 | Bacteria | 4530 |
| 509 | Ga0496112_0068355 | 3300048915 | Bacteria | 3508 |
| 510 | Ga0496112_0083892 | 3300048915 | Bacteria | 3152 |
| 511 | Ga0496112_0095150 | 3300048915 | Bacteria | 2949 |
| 512 | Ga0496112_0220833 | 3300048915 | Bacteria | 1851 |
| 513 | Ga0496113_0000553 | 3300048916 | Bacteria | 18549 |
| 514 | Ga0496115_0003103 | 3300048918 | Bacteria | 11938 |
| 515 | Ga0496115_0004025 | 3300048918 | Bacteria | 10613 |
| 516 | Ga0501083_0064688 | 3300049744 | Bacteria | 2437 |
| 517 | nmdc:mga0rr50_55056_c1 | 3300050513 | Bacteria | 2966 |
| 518 | nmdc:mga08x19_12310_c1 | 3300050514 | Bacteria | 5151 |
| 519 | nmdc:mga08x19_21384_c1 | 3300050514 | Bacteria | 3993 |
| 520 | nmdc:mga08x19_242_c1 | 3300050514 | Bacteria | 41716 |
| 521 | nmdc:mga08x19_4630_c1 | 3300050514 | Bacteria | 8163 |
| 522 | nmdc:mga08x19_6770_c1 | 3300050514 | Bacteria | 6806 |
| 523 | Ga0495619_0118663 | 3300053085 | Bacteria | 1813 |
| 524 | Ga0495619_0129158 | 3300053085 | Bacteria | 1736 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048915 | Ga0496112_0220833 | Ga0496112_0220833_626_1810 | 373 |
| 2 | 3300031090 | Ga0265760_10003719 | Ga0265760_100037193 | 396 |
| 3 | 3300048909 | Ga0496106_0154965 | Ga0496106_0154965_443_1726 | 403 |
| 4 | 3300005437 | Ga0070710_10005758 | Ga0070710_100057583 | 408 |
| 5 | 3300025898 | Ga0207692_10005292 | Ga0207692_100052923 | 408 |
| 6 | 3300005434 | Ga0070709_10003654 | Ga0070709_100036543 | 419 |
| 7 | 3300005435 | Ga0070714_100000054 | Ga0070714_1000000544 | 419 |
| 8 | 3300005439 | Ga0070711_100005021 | Ga0070711_1000050212 | 419 |
| 9 | 3300025916 | Ga0207663_10003294 | Ga0207663_100032945 | 419 |
| 10 | 3300025929 | Ga0207664_10000954 | Ga0207664_100009544 | 419 |
| 11 | 3300035113 | Ga0373936_0008709 | Ga0373936_0008709_1051_2553 | 419 |
| 12 | 3300035116 | Ga0373945_0000496 | Ga0373945_0000496_6562_8064 | 419 |
| 13 | 3300035117 | Ga0373953_0035093 | Ga0373953_0035093_204_1706 | 419 |
| 14 | 3300035120 | Ga0373957_0005562 | Ga0373957_0005562_330_1832 | 419 |
| 15 | 3300035170 | Ga0373943_0000045 | Ga0373943_0000045_38910_40412 | 419 |
| 16 | 3300035171 | Ga0373946_0003252 | Ga0373946_0003252_227_1729 | 419 |
| 17 | 3300035692 | Ga0373935_0018520 | Ga0373935_0018520_888_2390 | 419 |
| 18 | 3300035695 | Ga0373927_0000094 | Ga0373927_0000094_49802_51304 | 419 |
| 19 | 3300035725 | Ga0373947_0006702 | Ga0373947_0006702_1061_2563 | 419 |
| 20 | 3300037068 | Ga0373925_0000297 | Ga0373925_0000297_22206_23708 | 419 |
| 21 | 3300047319 | Ga0495674_0016465 | Ga0495674_0016465_5265_6767 | 419 |
| 22 | 3300005434 | Ga0070709_10080334 | Ga0070709_100803342 | 425 |
| 23 | 3300005445 | Ga0070708_100003396 | Ga0070708_1000033963 | 425 |
| 24 | 3300005468 | Ga0070707_100022628 | Ga0070707_1000226283 | 425 |
| 25 | 3300005471 | Ga0070698_100002041 | Ga0070698_10000204111 | 425 |
| 26 | 3300005518 | Ga0070699_100001045 | Ga0070699_10000104521 | 425 |
| 27 | 3300005536 | Ga0070697_100000092 | Ga0070697_10000009269 | 425 |
| 28 | 3300025910 | Ga0207684_10000447 | Ga0207684_1000044738 | 425 |
| 29 | 3300025922 | Ga0207646_10000676 | Ga0207646_1000067638 | 425 |
| 30 | 3300046472 | Ga0495580_0000037 | Ga0495580_0000037_54289_55728 | 425 |
| 31 | 3300005983 | Ga0081540_1030947 | Ga0081540_10309472 | 429 |
| 32 | 3300021377 | Ga0213874_10018106 | Ga0213874_100181062 | 429 |
| 33 | 3300039450 | Ga0436363_0665316 | Ga0436363_0665316_2104_3474 | 429 |
| 34 | 3300005434 | Ga0070709_10004050 | Ga0070709_100040503 | 430 |
| 35 | 3300005436 | Ga0070713_100000188 | Ga0070713_10000018816 | 430 |
| 36 | 3300006163 | Ga0070715_10030848 | Ga0070715_100308482 | 430 |
| 37 | 3300006173 | Ga0070716_100044114 | Ga0070716_1000441142 | 430 |
| 38 | 3300006175 | Ga0070712_100009078 | Ga0070712_1000090782 | 430 |
| 39 | 3300025905 | Ga0207685_10023098 | Ga0207685_100230982 | 430 |
| 40 | 3300025906 | Ga0207699_10008109 | Ga0207699_100081093 | 430 |
| 41 | 3300025916 | Ga0207663_10033563 | Ga0207663_100335632 | 430 |
| 42 | 3300025928 | Ga0207700_10004881 | Ga0207700_100048812 | 430 |
| 43 | 3300025928 | Ga0207700_10145613 | Ga0207700_101456132 | 430 |
| 44 | 3300025939 | Ga0207665_10021778 | Ga0207665_100217782 | 430 |
| 45 | 3300048088 | Ga0495602_0150745 | Ga0495602_0150745_200_1660 | 433 |
| 46 | 3300005614 | Ga0068856_100090018 | Ga0068856_1000900182 | 435 |
| 47 | 3300005841 | Ga0068863_100006247 | Ga0068863_1000062474 | 435 |
| 48 | 3300006175 | Ga0070712_100166673 | Ga0070712_1001666732 | 435 |
| 49 | 3300007076 | Ga0075435_100008964 | Ga0075435_1000089644 | 435 |
| 50 | 3300009545 | Ga0105237_10081906 | Ga0105237_100819063 | 435 |
| 51 | 3300013100 | Ga0157373_10102733 | Ga0157373_101027332 | 435 |
| 52 | 3300013307 | Ga0157372_10013942 | Ga0157372_100139423 | 435 |
| 53 | 3300026088 | Ga0207641_10008200 | Ga0207641_100082002 | 435 |
| 54 | 3300046472 | Ga0495580_0066309 | Ga0495580_0066309_1019_2461 | 435 |
| 55 | 3300005445 | Ga0070708_100003476 | Ga0070708_1000034765 | 436 |
| 56 | 3300005467 | Ga0070706_100001995 | Ga0070706_1000019954 | 436 |
| 57 | 3300005536 | Ga0070697_100000921 | Ga0070697_10000092114 | 436 |
| 58 | 3300025910 | Ga0207684_10002811 | Ga0207684_100028116 | 436 |
| 59 | 3300005336 | Ga0070680_100054480 | Ga0070680_1000544802 | 437 |
| 60 | 3300005440 | Ga0070705_100001727 | Ga0070705_1000017275 | 437 |
| 61 | 3300005444 | Ga0070694_100031627 | Ga0070694_1000316272 | 437 |
| 62 | 3300005445 | Ga0070708_100000258 | Ga0070708_10000025823 | 437 |
| 63 | 3300005536 | Ga0070697_100000570 | Ga0070697_10000057013 | 437 |
| 64 | 3300005546 | Ga0070696_100000413 | Ga0070696_1000004139 | 437 |
| 65 | 3300005547 | Ga0070693_100000309 | Ga0070693_10000030917 | 437 |
| 66 | 3300005549 | Ga0070704_100000191 | Ga0070704_10000019110 | 437 |
| 67 | 3300025885 | Ga0207653_10004906 | Ga0207653_100049062 | 437 |
| 68 | 3300025921 | Ga0207652_10005526 | Ga0207652_100055267 | 437 |
| 69 | 3300005445 | Ga0070708_100131230 | Ga0070708_1001312302 | 438 |
| 70 | 3300005328 | Ga0070676_10015943 | Ga0070676_100159433 | 439 |
| 71 | 3300005329 | Ga0070683_100020363 | Ga0070683_1000203632 | 439 |
| 72 | 3300005335 | Ga0070666_10010602 | Ga0070666_100106022 | 439 |
| 73 | 3300005338 | Ga0068868_100004660 | Ga0068868_1000046603 | 439 |
| 74 | 3300005344 | Ga0070661_100016008 | Ga0070661_1000160083 | 439 |
| 75 | 3300005353 | Ga0070669_100050854 | Ga0070669_1000508542 | 439 |
| 76 | 3300005366 | Ga0070659_100007111 | Ga0070659_1000071113 | 439 |
| 77 | 3300005406 | Ga0070703_10002370 | Ga0070703_100023702 | 439 |
| 78 | 3300005457 | Ga0070662_100001311 | Ga0070662_10000131110 | 439 |
| 79 | 3300005459 | Ga0068867_100018927 | Ga0068867_1000189272 | 439 |
| 80 | 3300005535 | Ga0070684_100029051 | Ga0070684_1000290513 | 439 |
| 81 | 3300005544 | Ga0070686_100011250 | Ga0070686_1000112502 | 439 |
| 82 | 3300005545 | Ga0070695_100035677 | Ga0070695_1000356772 | 439 |
| 83 | 3300005548 | Ga0070665_100009890 | Ga0070665_1000098902 | 439 |
| 84 | 3300005564 | Ga0070664_100017155 | Ga0070664_1000171553 | 439 |
| 85 | 3300005577 | Ga0068857_100112114 | Ga0068857_1001121142 | 439 |
| 86 | 3300005616 | Ga0068852_100018688 | Ga0068852_1000186883 | 439 |
| 87 | 3300005617 | Ga0068859_100011960 | Ga0068859_1000119603 | 439 |
| 88 | 3300005618 | Ga0068864_100038468 | Ga0068864_1000384683 | 439 |
| 89 | 3300005834 | Ga0068851_10010152 | Ga0068851_100101522 | 439 |
| 90 | 3300005842 | Ga0068858_100050011 | Ga0068858_1000500113 | 439 |
| 91 | 3300005843 | Ga0068860_100027846 | Ga0068860_1000278462 | 439 |
| 92 | 3300005844 | Ga0068862_100022178 | Ga0068862_1000221783 | 439 |
| 93 | 3300006931 | Ga0097620_100011960 | Ga0097620_1000119603 | 439 |
| 94 | 3300009101 | Ga0105247_10034392 | Ga0105247_100343922 | 439 |
| 95 | 3300009148 | Ga0105243_10069081 | Ga0105243_100690812 | 439 |
| 96 | 3300009176 | Ga0105242_10028250 | Ga0105242_100282503 | 439 |
| 97 | 3300009177 | Ga0105248_10026894 | Ga0105248_100268943 | 439 |
| 98 | 3300011119 | Ga0105246_10119211 | Ga0105246_101192111 | 439 |
| 99 | 3300013102 | Ga0157371_10003936 | Ga0157371_1000393610 | 439 |
| 100 | 3300013105 | Ga0157369_10028452 | Ga0157369_100284524 | 439 |
| 101 | 3300013296 | Ga0157374_10024896 | Ga0157374_100248963 | 439 |
| 102 | 3300013306 | Ga0163162_10008859 | Ga0163162_100088593 | 439 |
| 103 | 3300014325 | Ga0163163_10046496 | Ga0163163_100464962 | 439 |
| 104 | 3300014968 | Ga0157379_10031396 | Ga0157379_100313963 | 439 |
| 105 | 3300025321 | Ga0207656_10007524 | Ga0207656_100075242 | 439 |
| 106 | 3300025903 | Ga0207680_10054926 | Ga0207680_100549262 | 439 |
| 107 | 3300025907 | Ga0207645_10010617 | Ga0207645_100106173 | 439 |
| 108 | 3300025911 | Ga0207654_10018553 | Ga0207654_100185532 | 439 |
| 109 | 3300025913 | Ga0207695_10035323 | Ga0207695_100353232 | 439 |
| 110 | 3300025914 | Ga0207671_10022952 | Ga0207671_100229523 | 439 |
| 111 | 3300025919 | Ga0207657_10002563 | Ga0207657_100025633 | 439 |
| 112 | 3300025933 | Ga0207706_10000676 | Ga0207706_1000067614 | 439 |
| 113 | 3300025935 | Ga0207709_10015686 | Ga0207709_100156863 | 439 |
| 114 | 3300025941 | Ga0207711_10021120 | Ga0207711_100211204 | 439 |
| 115 | 3300025942 | Ga0207689_10004057 | Ga0207689_100040578 | 439 |
| 116 | 3300025972 | Ga0207668_10056982 | Ga0207668_100569822 | 439 |
| 117 | 3300026067 | Ga0207678_10000666 | Ga0207678_100006663 | 439 |
| 118 | 3300026078 | Ga0207702_10013784 | Ga0207702_100137843 | 439 |
| 119 | 3300026089 | Ga0207648_10012134 | Ga0207648_100121344 | 439 |
| 120 | 3300026116 | Ga0207674_10058520 | Ga0207674_100585202 | 439 |
| 121 | 3300026118 | Ga0207675_100032027 | Ga0207675_1000320272 | 439 |
| 122 | 3300028380 | Ga0268265_10021199 | Ga0268265_100211992 | 439 |
| 123 | 3300028381 | Ga0268264_10029558 | Ga0268264_100295582 | 439 |
| 124 | 3300005547 | Ga0070693_100028360 | Ga0070693_1000283603 | 440 |
| 125 | 3300009093 | Ga0105240_10176428 | Ga0105240_101764282 | 440 |
| 126 | 3300009174 | Ga0105241_10014773 | Ga0105241_100147732 | 440 |
| 127 | 3300009177 | Ga0105248_10014251 | Ga0105248_100142514 | 440 |
| 128 | 3300013102 | Ga0157371_10042869 | Ga0157371_100428692 | 440 |
| 129 | 3300013296 | Ga0157374_10000187 | Ga0157374_1000018727 | 440 |
| 130 | 3300013297 | Ga0157378_10000161 | Ga0157378_1000016112 | 440 |
| 131 | 3300013307 | Ga0157372_10005390 | Ga0157372_100053902 | 440 |
| 132 | 3300014969 | Ga0157376_10003365 | Ga0157376_100033652 | 440 |
| 133 | 3300035695 | Ga0373927_0018433 | Ga0373927_0018433_1135_2553 | 440 |
| 134 | 3300005536 | Ga0070697_100221599 | Ga0070697_1002215991 | 442 |
| 135 | 3300006028 | Ga0070717_10000472 | Ga0070717_100004728 | 442 |
| 136 | 3300025910 | Ga0207684_10082853 | Ga0207684_100828532 | 442 |
| 137 | 3300009545 | Ga0105237_10040485 | Ga0105237_100404852 | 443 |
| 138 | 3300046472 | Ga0495580_0008800 | Ga0495580_0008800_2040_3449 | 443 |
| 139 | 3300007265 | Ga0099794_10009809 | Ga0099794_100098092 | 444 |
| 140 | 3300025906 | Ga0207699_10008908 | Ga0207699_100089082 | 445 |
| 141 | 3300028800 | Ga0265338_10004188 | Ga0265338_1000418819 | 446 |
| 142 | 3300006237 | Ga0097621_100013368 | Ga0097621_1000133683 | 447 |
| 143 | 3300014969 | Ga0157376_10000008 | Ga0157376_10000008259 | 447 |
| 144 | 3300046472 | Ga0495580_0008672 | Ga0495580_0008672_5117_6553 | 447 |
| 145 | 3300005536 | Ga0070697_100118734 | Ga0070697_1001187342 | 448 |
| 146 | 3300005841 | Ga0068863_100034458 | Ga0068863_1000344582 | 448 |
| 147 | 3300006173 | Ga0070716_100009732 | Ga0070716_1000097323 | 448 |
| 148 | 3300006237 | Ga0097621_100004754 | Ga0097621_1000047542 | 448 |
| 149 | 3300006358 | Ga0068871_100002972 | Ga0068871_1000029729 | 448 |
| 150 | 3300009174 | Ga0105241_10004694 | Ga0105241_100046945 | 448 |
| 151 | 3300009551 | Ga0105238_10020954 | Ga0105238_100209543 | 448 |
| 152 | 3300013296 | Ga0157374_10028852 | Ga0157374_100288523 | 448 |
| 153 | 3300013297 | Ga0157378_10107199 | Ga0157378_101071991 | 448 |
| 154 | 3300013306 | Ga0163162_10002288 | Ga0163162_100022883 | 448 |
| 155 | 3300025939 | Ga0207665_10000080 | Ga0207665_1000008044 | 448 |
| 156 | 3300026088 | Ga0207641_10020160 | Ga0207641_100201602 | 448 |
| 157 | 3300036401 | Ga0373937_0064562 | Ga0373937_0064562_1204_2748 | 448 |
| 158 | 3300048903 | Ga0496100_0008437 | Ga0496100_0008437_256_1677 | 448 |
| 159 | 3300048910 | Ga0496107_0043185 | Ga0496107_0043185_247_1668 | 448 |
| 160 | 3300048915 | Ga0496112_0040983 | Ga0496112_0040983_1612_3033 | 448 |
| 161 | 3300048918 | Ga0496115_0003103 | Ga0496115_0003103_3859_5280 | 448 |
| 162 | 3300053085 | Ga0495619_0118663 | Ga0495619_0118663_348_1769 | 448 |
| 163 | 3300014968 | Ga0157379_10001683 | Ga0157379_100016839 | 449 |
| 164 | 3300025911 | Ga0207654_10014519 | Ga0207654_100145193 | 449 |
| 165 | 3300048903 | Ga0496100_0042229 | Ga0496100_0042229_997_2475 | 449 |
| 166 | 3300048904 | Ga0496101_0062585 | Ga0496101_0062585_1076_2554 | 449 |
| 167 | 3300048905 | Ga0496102_0004513 | Ga0496102_0004513_1523_3001 | 449 |
| 168 | 3300048906 | Ga0496103_0008179 | Ga0496103_0008179_4744_6183 | 449 |
| 169 | 3300048907 | Ga0496104_0172237 | Ga0496104_0172237_360_1838 | 449 |
| 170 | 3300005445 | Ga0070708_100000730 | Ga0070708_10000073020 | 450 |
| 171 | 3300005467 | Ga0070706_100002945 | Ga0070706_10000294510 | 450 |
| 172 | 3300005468 | Ga0070707_100003955 | Ga0070707_1000039553 | 450 |
| 173 | 3300005471 | Ga0070698_100000148 | Ga0070698_10000014845 | 450 |
| 174 | 3300005518 | Ga0070699_100067098 | Ga0070699_1000670981 | 450 |
| 175 | 3300025910 | Ga0207684_10002057 | Ga0207684_1000205713 | 450 |
| 176 | 3300025922 | Ga0207646_10001577 | Ga0207646_1000157712 | 450 |
| 177 | 3300006871 | Ga0075434_100046681 | Ga0075434_1000466812 | 451 |
| 178 | 3300007076 | Ga0075435_100011548 | Ga0075435_1000115485 | 451 |
| 179 | 3300007265 | Ga0099794_10027161 | Ga0099794_100271612 | 451 |
| 180 | 3300025922 | Ga0207646_10092553 | Ga0207646_100925532 | 451 |
| 181 | 3300048913 | Ga0496110_0053160 | Ga0496110_0053160_140_1582 | 451 |
| 182 | 3300050513 | nmdc:mga0rr50_55056_c1 | nmdc:mga0rr50_55056_c1_75_1541 | 451 |
| 183 | 3300005468 | Ga0070707_100052786 | Ga0070707_1000527862 | 452 |
| 184 | 3300005518 | Ga0070699_100006769 | Ga0070699_1000067693 | 452 |
| 185 | 3300005536 | Ga0070697_100000630 | Ga0070697_1000006304 | 452 |
| 186 | 3300007265 | Ga0099794_10000669 | Ga0099794_100006692 | 452 |
| 187 | 3300013297 | Ga0157378_10130450 | Ga0157378_101304502 | 452 |
| 188 | 3300025906 | Ga0207699_10007982 | Ga0207699_100079824 | 452 |
| 189 | 3300025922 | Ga0207646_10079657 | Ga0207646_100796572 | 452 |
| 190 | 3300027671 | Ga0209588_1001776 | Ga0209588_10017763 | 452 |
| 191 | 3300009093 | Ga0105240_10052964 | Ga0105240_100529643 | 454 |
| 192 | 3300013105 | Ga0157369_10163164 | Ga0157369_101631642 | 454 |
| 193 | 3300013307 | Ga0157372_10001859 | Ga0157372_1000185916 | 454 |
| 194 | 3300025913 | Ga0207695_10046682 | Ga0207695_100466823 | 454 |
| 195 | 3300027671 | Ga0209588_1002774 | Ga0209588_10027742 | 454 |
| 196 | 3300028800 | Ga0265338_10035922 | Ga0265338_100359223 | 454 |
| 197 | 3300030878 | Ga0265770_1002307 | Ga0265770_10023072 | 454 |
| 198 | 3300031090 | Ga0265760_10000141 | Ga0265760_1000014110 | 454 |
| 199 | 3300031344 | Ga0265316_10042197 | Ga0265316_100421972 | 454 |
| 200 | 3300037853 | Ga0436364_0831126 | Ga0436364_0831126_220_1641 | 454 |
| 201 | 3300005335 | Ga0070666_10018971 | Ga0070666_100189712 | 455 |
| 202 | 3300005338 | Ga0068868_100001052 | Ga0068868_1000010528 | 455 |
| 203 | 3300005367 | Ga0070667_100053799 | Ga0070667_1000537992 | 455 |
| 204 | 3300005459 | Ga0068867_100102443 | Ga0068867_1001024432 | 455 |
| 205 | 3300005578 | Ga0068854_100007433 | Ga0068854_1000074333 | 455 |
| 206 | 3300005843 | Ga0068860_100135103 | Ga0068860_1001351032 | 455 |
| 207 | 3300006028 | Ga0070717_10068647 | Ga0070717_100686472 | 455 |
| 208 | 3300006028 | Ga0070717_10267170 | Ga0070717_102671701 | 455 |
| 209 | 3300006237 | Ga0097621_100001802 | Ga0097621_1000018024 | 455 |
| 210 | 3300009098 | Ga0105245_10005793 | Ga0105245_100057936 | 455 |
| 211 | 3300009176 | Ga0105242_10046508 | Ga0105242_100465082 | 455 |
| 212 | 3300013297 | Ga0157378_10000353 | Ga0157378_1000035328 | 455 |
| 213 | 3300013306 | Ga0163162_10099282 | Ga0163162_100992822 | 455 |
| 214 | 3300014969 | Ga0157376_10049130 | Ga0157376_100491302 | 455 |
| 215 | 3300025903 | Ga0207680_10023226 | Ga0207680_100232263 | 455 |
| 216 | 3300025922 | Ga0207646_10071315 | Ga0207646_100713152 | 455 |
| 217 | 3300025927 | Ga0207687_10025104 | Ga0207687_100251042 | 455 |
| 218 | 3300025981 | Ga0207640_10044511 | Ga0207640_100445112 | 455 |
| 219 | 3300026023 | Ga0207677_10001639 | Ga0207677_100016396 | 455 |
| 220 | 3300028016 | Ga0265354_1002457 | Ga0265354_10024572 | 455 |
| 221 | 3300028023 | Ga0265357_1000346 | Ga0265357_10003462 | 455 |
| 222 | 3300030878 | Ga0265770_1000601 | Ga0265770_10006012 | 455 |
| 223 | 3300030879 | Ga0265765_1000384 | Ga0265765_10003842 | 455 |
| 224 | 3300033547 | Ga0316212_1000580 | Ga0316212_10005802 | 455 |
| 225 | 3300035170 | Ga0373943_0004997 | Ga0373943_0004997_3268_4689 | 455 |
| 226 | 3300037068 | Ga0373925_0024183 | Ga0373925_0024183_791_2212 | 455 |
| 227 | 3300053085 | Ga0495619_0129158 | Ga0495619_0129158_47_1414 | 455 |
| 228 | 3300005445 | Ga0070708_100002282 | Ga0070708_1000022823 | 456 |
| 229 | 3300014968 | Ga0157379_10006009 | Ga0157379_100060093 | 456 |
| 230 | 3300005468 | Ga0070707_100039468 | Ga0070707_1000394682 | 457 |
| 231 | 3300014968 | Ga0157379_10167571 | Ga0157379_101675712 | 457 |
| 232 | 3300025914 | Ga0207671_10022269 | Ga0207671_100222693 | 457 |
| 233 | 3300005436 | Ga0070713_100005655 | Ga0070713_1000056555 | 458 |
| 234 | 3300005437 | Ga0070710_10019149 | Ga0070710_100191491 | 458 |
| 235 | 3300006028 | Ga0070717_10007398 | Ga0070717_100073983 | 458 |
| 236 | 3300025916 | Ga0207663_10054423 | Ga0207663_100544232 | 458 |
| 237 | 3300025928 | Ga0207700_10072857 | Ga0207700_100728572 | 458 |
| 238 | 3300025929 | Ga0207664_10004842 | Ga0207664_100048422 | 458 |
| 239 | 3300035171 | Ga0373946_0002383 | Ga0373946_0002383_5006_6463 | 458 |
| 240 | 3300035695 | Ga0373927_0002440 | Ga0373927_0002440_7598_9055 | 458 |
| 241 | 3300037068 | Ga0373925_0003730 | Ga0373925_0003730_6270_7727 | 458 |
| 242 | 3300046517 | Ga0495630_0017481 | Ga0495630_0017481_2147_3604 | 458 |
| 243 | 3300050514 | nmdc:mga08x19_21384_c1 | nmdc:mga08x19_21384_c1_1089_2525 | 458 |
| 244 | 3300005467 | Ga0070706_100035823 | Ga0070706_1000358232 | 459 |
| 245 | 3300013297 | Ga0157378_10005841 | Ga0157378_100058414 | 459 |
| 246 | 3300046472 | Ga0495580_0014399 | Ga0495580_0014399_3044_4471 | 459 |
| 247 | 3300005435 | Ga0070714_100020160 | Ga0070714_1000201603 | 460 |
| 248 | 3300005436 | Ga0070713_100025798 | Ga0070713_1000257982 | 460 |
| 249 | 3300006028 | Ga0070717_10001371 | Ga0070717_100013716 | 460 |
| 250 | 3300006358 | Ga0068871_100029002 | Ga0068871_1000290023 | 460 |
| 251 | 3300014969 | Ga0157376_10000852 | Ga0157376_100008527 | 460 |
| 252 | 3300025928 | Ga0207700_10037500 | Ga0207700_100375002 | 460 |
| 253 | 3300025929 | Ga0207664_10012565 | Ga0207664_100125654 | 460 |
| 254 | 3300028800 | Ga0265338_10069365 | Ga0265338_100693652 | 460 |
| 255 | 3300031344 | Ga0265316_10004327 | Ga0265316_100043275 | 460 |
| 256 | 3300037068 | Ga0373925_0007729 | Ga0373925_0007729_2313_3770 | 460 |
| 257 | 3300046459 | Ga0495629_0015435 | Ga0495629_0015435_2363_3778 | 460 |
| 258 | 3300046472 | Ga0495580_0011396 | Ga0495580_0011396_2593_4008 | 460 |
| 259 | 3300046475 | Ga0495639_0002138 | Ga0495639_0002138_1510_2925 | 460 |
| 260 | 3300046476 | Ga0495662_0037673 | Ga0495662_0037673_702_2117 | 460 |
| 261 | 3300046477 | Ga0495664_0026856 | Ga0495664_0026856_918_2333 | 460 |
| 262 | 3300046499 | Ga0495594_0015281 | Ga0495594_0015281_625_2040 | 460 |
| 263 | 3300046533 | Ga0495640_0002276 | Ga0495640_0002276_3477_4892 | 460 |
| 264 | 3300046535 | Ga0495586_0010064 | Ga0495586_0010064_1990_3405 | 460 |
| 265 | 3300046536 | Ga0495587_0002499 | Ga0495587_0002499_4440_5984 | 460 |
| 266 | 3300046681 | Ga0495647_0002553 | Ga0495647_0002553_1993_3408 | 460 |
| 267 | 3300046689 | Ga0495613_0056299 | Ga0495613_0056299_185_1600 | 460 |
| 268 | 3300047315 | Ga0495581_0046568 | Ga0495581_0046568_779_2194 | 460 |
| 269 | 3300047321 | Ga0495676_0047424 | Ga0495676_0047424_1839_3254 | 460 |
| 270 | 3300047471 | Ga0495684_0047632 | Ga0495684_0047632_1356_2771 | 460 |
| 271 | 3300005331 | Ga0070670_100002128 | Ga0070670_1000021282 | 461 |
| 272 | 3300005334 | Ga0068869_100010897 | Ga0068869_1000108971 | 461 |
| 273 | 3300005364 | Ga0070673_100163068 | Ga0070673_1001630682 | 461 |
| 274 | 3300005436 | Ga0070713_100154210 | Ga0070713_1001542102 | 461 |
| 275 | 3300005459 | Ga0068867_100022678 | Ga0068867_1000226782 | 461 |
| 276 | 3300005549 | Ga0070704_100042863 | Ga0070704_1000428632 | 461 |
| 277 | 3300005563 | Ga0068855_100005150 | Ga0068855_10000515015 | 461 |
| 278 | 3300005564 | Ga0070664_100001802 | Ga0070664_10000180211 | 461 |
| 279 | 3300005577 | Ga0068857_100068151 | Ga0068857_1000681512 | 461 |
| 280 | 3300005614 | Ga0068856_100000436 | Ga0068856_10000043622 | 461 |
| 281 | 3300005616 | Ga0068852_100132522 | Ga0068852_1001325222 | 461 |
| 282 | 3300005617 | Ga0068859_100047598 | Ga0068859_1000475983 | 461 |
| 283 | 3300005618 | Ga0068864_100006672 | Ga0068864_1000066724 | 461 |
| 284 | 3300005718 | Ga0068866_10065874 | Ga0068866_100658742 | 461 |
| 285 | 3300005840 | Ga0068870_10029163 | Ga0068870_100291632 | 461 |
| 286 | 3300005842 | Ga0068858_100005368 | Ga0068858_1000053686 | 461 |
| 287 | 3300005843 | Ga0068860_100059154 | Ga0068860_1000591542 | 461 |
| 288 | 3300006237 | Ga0097621_100000183 | Ga0097621_10000018321 | 461 |
| 289 | 3300006358 | Ga0068871_100007289 | Ga0068871_1000072893 | 461 |
| 290 | 3300006914 | Ga0075436_100006574 | Ga0075436_1000065744 | 461 |
| 291 | 3300006914 | Ga0075436_100014415 | Ga0075436_1000144153 | 461 |
| 292 | 3300006931 | Ga0097620_100047598 | Ga0097620_1000475982 | 461 |
| 293 | 3300009177 | Ga0105248_10047499 | Ga0105248_100474993 | 461 |
| 294 | 3300009177 | Ga0105248_10056239 | Ga0105248_100562392 | 461 |
| 295 | 3300013296 | Ga0157374_10007069 | Ga0157374_100070692 | 461 |
| 296 | 3300013297 | Ga0157378_10000181 | Ga0157378_1000018110 | 461 |
| 297 | 3300013297 | Ga0157378_10000739 | Ga0157378_100007397 | 461 |
| 298 | 3300013307 | Ga0157372_10008201 | Ga0157372_100082012 | 461 |
| 299 | 3300025904 | Ga0207647_10012828 | Ga0207647_100128283 | 461 |
| 300 | 3300025908 | Ga0207643_10035523 | Ga0207643_100355232 | 461 |
| 301 | 3300025911 | Ga0207654_10034960 | Ga0207654_100349601 | 461 |
| 302 | 3300025913 | Ga0207695_10127400 | Ga0207695_101274002 | 461 |
| 303 | 3300025920 | Ga0207649_10053224 | Ga0207649_100532242 | 461 |
| 304 | 3300025925 | Ga0207650_10009443 | Ga0207650_100094433 | 461 |
| 305 | 3300025933 | Ga0207706_10192365 | Ga0207706_101923652 | 461 |
| 306 | 3300025939 | Ga0207665_10056305 | Ga0207665_100563052 | 461 |
| 307 | 3300025941 | Ga0207711_10018376 | Ga0207711_100183764 | 461 |
| 308 | 3300025945 | Ga0207679_10053668 | Ga0207679_100536682 | 461 |
| 309 | 3300025949 | Ga0207667_10000694 | Ga0207667_1000069415 | 461 |
| 310 | 3300025949 | Ga0207667_10022433 | Ga0207667_100224333 | 461 |
| 311 | 3300025981 | Ga0207640_10001398 | Ga0207640_100013984 | 461 |
| 312 | 3300026023 | Ga0207677_10002373 | Ga0207677_100023733 | 461 |
| 313 | 3300026035 | Ga0207703_10003415 | Ga0207703_100034153 | 461 |
| 314 | 3300026041 | Ga0207639_10141830 | Ga0207639_101418302 | 461 |
| 315 | 3300026078 | Ga0207702_10000657 | Ga0207702_100006573 | 461 |
| 316 | 3300026078 | Ga0207702_10009897 | Ga0207702_100098973 | 461 |
| 317 | 3300026089 | Ga0207648_10019307 | Ga0207648_100193073 | 461 |
| 318 | 3300026095 | Ga0207676_10004714 | Ga0207676_100047142 | 461 |
| 319 | 3300026116 | Ga0207674_10000905 | Ga0207674_100009058 | 461 |
| 320 | 3300028381 | Ga0268264_10042130 | Ga0268264_100421302 | 461 |
| 321 | 3300028381 | Ga0268264_10125159 | Ga0268264_101251592 | 461 |
| 322 | 3300031711 | Ga0265314_10032002 | Ga0265314_100320023 | 461 |
| 323 | 3300035691 | Ga0373931_0016020 | Ga0373931_0016020_1580_3073 | 461 |
| 324 | 3300048915 | Ga0496112_0068355 | Ga0496112_0068355_1867_3327 | 461 |
| 325 | 3300048918 | Ga0496115_0004025 | Ga0496115_0004025_7336_8751 | 461 |
| 326 | 3300050514 | nmdc:mga08x19_4630_c1 | nmdc:mga08x19_4630_c1_1686_3101 | 461 |
| 327 | 3300050514 | nmdc:mga08x19_6770_c1 | nmdc:mga08x19_6770_c1_81_1586 | 461 |
| 328 | 3300005548 | Ga0070665_100002088 | Ga0070665_1000020883 | 462 |
| 329 | 3300028379 | Ga0268266_10000227 | Ga0268266_1000022717 | 462 |
| 330 | 3300006914 | Ga0075436_100007607 | Ga0075436_1000076072 | 463 |
| 331 | 3300009093 | Ga0105240_10022678 | Ga0105240_100226784 | 463 |
| 332 | 3300013296 | Ga0157374_10017621 | Ga0157374_100176213 | 463 |
| 333 | 3300025913 | Ga0207695_10070215 | Ga0207695_100702151 | 463 |
| 334 | 3300048915 | Ga0496112_0083892 | Ga0496112_0083892_1062_2498 | 463 |
| 335 | 3300050514 | nmdc:mga08x19_12310_c1 | nmdc:mga08x19_12310_c1_3412_4848 | 463 |
| 336 | 3300005434 | Ga0070709_10080158 | Ga0070709_100801582 | 465 |
| 337 | 3300005467 | Ga0070706_100114165 | Ga0070706_1001141652 | 465 |
| 338 | 3300005547 | Ga0070693_100010569 | Ga0070693_1000105693 | 465 |
| 339 | 3300007788 | Ga0099795_10021510 | Ga0099795_100215102 | 465 |
| 340 | 3300005536 | Ga0070697_100062341 | Ga0070697_1000623412 | 466 |
| 341 | 3300006914 | Ga0075436_100011669 | Ga0075436_1000116693 | 467 |
| 342 | 3300024227 | Ga0228598_1001070 | Ga0228598_10010702 | 467 |
| 343 | 3300050514 | nmdc:mga08x19_242_c1 | nmdc:mga08x19_242_c1_18321_19745 | 467 |
| 344 | 3300035118 | Ga0373954_0036245 | Ga0373954_0036245_69_1520 | 468 |
| 345 | 3300035119 | Ga0373956_0005475 | Ga0373956_0005475_2956_4407 | 468 |
| 346 | 3300035724 | Ga0373933_0028200 | Ga0373933_0028200_1710_3119 | 468 |
| 347 | 3300036401 | Ga0373937_0000555 | Ga0373937_0000555_11037_12446 | 468 |
| 348 | 3300046463 | Ga0495653_0125873 | Ga0495653_0125873_77_1486 | 468 |
| 349 | 3300047444 | Ga0495675_0003992 | Ga0495675_0003992_2797_4206 | 468 |
| 350 | 3300048088 | Ga0495602_0001204 | Ga0495602_0001204_14355_15764 | 468 |
| 351 | 3300005434 | Ga0070709_10026558 | Ga0070709_100265583 | 469 |
| 352 | 3300005437 | Ga0070710_10012414 | Ga0070710_100124142 | 469 |
| 353 | 3300005437 | Ga0070710_10070205 | Ga0070710_100702052 | 469 |
| 354 | 3300005468 | Ga0070707_100023194 | Ga0070707_1000231942 | 469 |
| 355 | 3300005471 | Ga0070698_100136062 | Ga0070698_1001360621 | 469 |
| 356 | 3300005518 | Ga0070699_100031914 | Ga0070699_1000319142 | 469 |
| 357 | 3300006163 | Ga0070715_10009345 | Ga0070715_100093452 | 469 |
| 358 | 3300006163 | Ga0070715_10012060 | Ga0070715_100120602 | 469 |
| 359 | 3300006173 | Ga0070716_100000300 | Ga0070716_1000003004 | 469 |
| 360 | 3300006173 | Ga0070716_100013266 | Ga0070716_1000132663 | 469 |
| 361 | 3300006175 | Ga0070712_100006280 | Ga0070712_1000062803 | 469 |
| 362 | 3300006175 | Ga0070712_100009576 | Ga0070712_1000095764 | 469 |
| 363 | 3300025905 | Ga0207685_10006871 | Ga0207685_100068712 | 469 |
| 364 | 3300025906 | Ga0207699_10033284 | Ga0207699_100332842 | 469 |
| 365 | 3300025915 | Ga0207693_10001184 | Ga0207693_1000118413 | 469 |
| 366 | 3300025915 | Ga0207693_10003013 | Ga0207693_1000301314 | 469 |
| 367 | 3300025915 | Ga0207693_10016219 | Ga0207693_100162192 | 469 |
| 368 | 3300025922 | Ga0207646_10005589 | Ga0207646_100055892 | 469 |
| 369 | 3300025939 | Ga0207665_10000049 | Ga0207665_1000004936 | 469 |
| 370 | 3300025939 | Ga0207665_10005337 | Ga0207665_100053373 | 469 |
| 371 | 3300027512 | Ga0209179_1009170 | Ga0209179_10091702 | 469 |
| 372 | 3300006028 | Ga0070717_10014331 | Ga0070717_100143312 | 470 |
| 373 | 3300006914 | Ga0075436_100143371 | Ga0075436_1001433712 | 470 |
| 374 | 3300048905 | Ga0496102_0019020 | Ga0496102_0019020_4123_5562 | 470 |
| 375 | 3300048906 | Ga0496103_0008280 | Ga0496103_0008280_1971_3410 | 470 |
| 376 | 3300005468 | Ga0070707_100059365 | Ga0070707_1000593653 | 471 |
| 377 | 3300014325 | Ga0163163_10060798 | Ga0163163_100607982 | 471 |
| 378 | 3300046684 | Ga0495669_0048049 | Ga0495669_0048049_388_1803 | 471 |
| 379 | 3300049744 | Ga0501083_0064688 | Ga0501083_0064688_424_1887 | 471 |
| 380 | 3300005445 | Ga0070708_100087578 | Ga0070708_1000875782 | 472 |
| 381 | 3300024227 | Ga0228598_1001796 | Ga0228598_10017962 | 472 |
| 382 | 3300025915 | Ga0207693_10007281 | Ga0207693_100072813 | 472 |
| 383 | 3300009174 | Ga0105241_10024601 | Ga0105241_100246012 | 473 |
| 384 | 3300025911 | Ga0207654_10023554 | Ga0207654_100235543 | 473 |
| 385 | 3300021384 | Ga0213876_10036462 | Ga0213876_100364622 | 474 |
| 386 | 3300039437 | Ga0436365_0942396 | Ga0436365_0942396_4252_5700 | 474 |
| 387 | 3300005334 | Ga0068869_100025905 | Ga0068869_1000259053 | 475 |
| 388 | 3300005436 | Ga0070713_100043608 | Ga0070713_1000436082 | 475 |
| 389 | 3300005439 | Ga0070711_100011852 | Ga0070711_1000118524 | 475 |
| 390 | 3300005445 | Ga0070708_100257672 | Ga0070708_1002576721 | 475 |
| 391 | 3300005518 | Ga0070699_100161157 | Ga0070699_1001611571 | 475 |
| 392 | 3300005546 | Ga0070696_100121466 | Ga0070696_1001214662 | 475 |
| 393 | 3300025916 | Ga0207663_10039944 | Ga0207663_100399442 | 475 |
| 394 | 3300025928 | Ga0207700_10058095 | Ga0207700_100580952 | 475 |
| 395 | 3300025942 | Ga0207689_10027907 | Ga0207689_100279073 | 475 |
| 396 | 3300036401 | Ga0373937_0255139 | Ga0373937_0255139_140_1582 | 475 |
| 397 | 3300046516 | Ga0495628_0004325 | Ga0495628_0004325_1275_2732 | 475 |
| 398 | 3300014325 | Ga0163163_10106682 | Ga0163163_101066822 | 477 |
| 399 | 3300005327 | Ga0070658_10026272 | Ga0070658_100262723 | 478 |
| 400 | 3300005329 | Ga0070683_100119095 | Ga0070683_1001190951 | 478 |
| 401 | 3300005334 | Ga0068869_100031928 | Ga0068869_1000319283 | 478 |
| 402 | 3300005344 | Ga0070661_100015954 | Ga0070661_1000159543 | 478 |
| 403 | 3300005355 | Ga0070671_100024078 | Ga0070671_1000240783 | 478 |
| 404 | 3300005366 | Ga0070659_100015344 | Ga0070659_1000153442 | 478 |
| 405 | 3300005458 | Ga0070681_10161405 | Ga0070681_101614052 | 478 |
| 406 | 3300005518 | Ga0070699_100116533 | Ga0070699_1001165332 | 478 |
| 407 | 3300005535 | Ga0070684_100072169 | Ga0070684_1000721692 | 478 |
| 408 | 3300005564 | Ga0070664_100030028 | Ga0070664_1000300282 | 478 |
| 409 | 3300005577 | Ga0068857_100182827 | Ga0068857_1001828272 | 478 |
| 410 | 3300005616 | Ga0068852_100096151 | Ga0068852_1000961512 | 478 |
| 411 | 3300005617 | Ga0068859_100035120 | Ga0068859_1000351202 | 478 |
| 412 | 3300005618 | Ga0068864_100051749 | Ga0068864_1000517492 | 478 |
| 413 | 3300005842 | Ga0068858_100001669 | Ga0068858_10000166913 | 478 |
| 414 | 3300006237 | Ga0097621_100101683 | Ga0097621_1001016832 | 478 |
| 415 | 3300006931 | Ga0097620_100035120 | Ga0097620_1000351203 | 478 |
| 416 | 3300009093 | Ga0105240_10055244 | Ga0105240_100552442 | 478 |
| 417 | 3300009098 | Ga0105245_10053219 | Ga0105245_100532192 | 478 |
| 418 | 3300009177 | Ga0105248_10010896 | Ga0105248_100108963 | 478 |
| 419 | 3300009545 | Ga0105237_10050004 | Ga0105237_100500043 | 478 |
| 420 | 3300009551 | Ga0105238_10007499 | Ga0105238_100074993 | 478 |
| 421 | 3300010375 | Ga0105239_10008576 | Ga0105239_100085763 | 478 |
| 422 | 3300010375 | Ga0105239_10047148 | Ga0105239_100471483 | 478 |
| 423 | 3300013100 | Ga0157373_10006176 | Ga0157373_100061763 | 478 |
| 424 | 3300013102 | Ga0157371_10158772 | Ga0157371_101587721 | 478 |
| 425 | 3300013105 | Ga0157369_10154202 | Ga0157369_101542022 | 478 |
| 426 | 3300013307 | Ga0157372_10006207 | Ga0157372_100062075 | 478 |
| 427 | 3300014325 | Ga0163163_10012039 | Ga0163163_100120394 | 478 |
| 428 | 3300014968 | Ga0157379_10023305 | Ga0157379_100233053 | 478 |
| 429 | 3300025904 | Ga0207647_10008969 | Ga0207647_100089693 | 478 |
| 430 | 3300025914 | Ga0207671_10045342 | Ga0207671_100453422 | 478 |
| 431 | 3300025919 | Ga0207657_10002016 | Ga0207657_100020164 | 478 |
| 432 | 3300025933 | Ga0207706_10016843 | Ga0207706_100168432 | 478 |
| 433 | 3300025942 | Ga0207689_10010914 | Ga0207689_100109143 | 478 |
| 434 | 3300025944 | Ga0207661_10222751 | Ga0207661_102227511 | 478 |
| 435 | 3300026023 | Ga0207677_10010595 | Ga0207677_100105952 | 478 |
| 436 | 3300026035 | Ga0207703_10213856 | Ga0207703_102138562 | 478 |
| 437 | 3300026041 | Ga0207639_10039043 | Ga0207639_100390432 | 478 |
| 438 | 3300026089 | Ga0207648_10022125 | Ga0207648_100221253 | 478 |
| 439 | 3300030760 | Ga0265762_1000325 | Ga0265762_10003254 | 478 |
| 440 | 3300048905 | Ga0496102_0100259 | Ga0496102_0100259_472_1908 | 478 |
| 441 | 3300048910 | Ga0496107_0062791 | Ga0496107_0062791_454_1890 | 478 |
| 442 | 3300048913 | Ga0496110_0204277 | Ga0496110_0204277_104_1540 | 478 |
| 443 | 3300048915 | Ga0496112_0015045 | Ga0496112_0015045_5543_6997 | 478 |
| 444 | 3300048915 | Ga0496112_0095150 | Ga0496112_0095150_1088_2524 | 478 |
| 445 | 3300005435 | Ga0070714_100042455 | Ga0070714_1000424553 | 479 |
| 446 | 3300002239 | JGI24034J26672_10002304 | JGI24034J26672_100023041 | 481 |
| 447 | 3300005328 | Ga0070676_10031597 | Ga0070676_100315972 | 481 |
| 448 | 3300005329 | Ga0070683_100001410 | Ga0070683_10000141013 | 481 |
| 449 | 3300005330 | Ga0070690_100007305 | Ga0070690_1000073053 | 481 |
| 450 | 3300005331 | Ga0070670_100016498 | Ga0070670_1000164983 | 481 |
| 451 | 3300005335 | Ga0070666_10024702 | Ga0070666_100247022 | 481 |
| 452 | 3300005343 | Ga0070687_100009776 | Ga0070687_1000097762 | 481 |
| 453 | 3300005344 | Ga0070661_100022947 | Ga0070661_1000229472 | 481 |
| 454 | 3300005347 | Ga0070668_100001619 | Ga0070668_1000016192 | 481 |
| 455 | 3300005353 | Ga0070669_100050826 | Ga0070669_1000508262 | 481 |
| 456 | 3300005356 | Ga0070674_100030624 | Ga0070674_1000306242 | 481 |
| 457 | 3300005365 | Ga0070688_100006942 | Ga0070688_1000069423 | 481 |
| 458 | 3300005459 | Ga0068867_100017340 | Ga0068867_1000173402 | 481 |
| 459 | 3300005535 | Ga0070684_100040018 | Ga0070684_1000400183 | 481 |
| 460 | 3300005546 | Ga0070696_100158675 | Ga0070696_1001586751 | 481 |
| 461 | 3300005563 | Ga0068855_100055914 | Ga0068855_1000559142 | 481 |
| 462 | 3300005615 | Ga0070702_100019038 | Ga0070702_1000190382 | 481 |
| 463 | 3300005616 | Ga0068852_100026397 | Ga0068852_1000263972 | 481 |
| 464 | 3300005840 | Ga0068870_10010366 | Ga0068870_100103663 | 481 |
| 465 | 3300009011 | Ga0105251_10055370 | Ga0105251_100553701 | 481 |
| 466 | 3300009098 | Ga0105245_10077715 | Ga0105245_100777152 | 481 |
| 467 | 3300009174 | Ga0105241_10026134 | Ga0105241_100261343 | 481 |
| 468 | 3300009176 | Ga0105242_10032960 | Ga0105242_100329602 | 481 |
| 469 | 3300009177 | Ga0105248_10114221 | Ga0105248_101142212 | 481 |
| 470 | 3300009545 | Ga0105237_10034900 | Ga0105237_100349001 | 481 |
| 471 | 3300009553 | Ga0105249_10013641 | Ga0105249_100136413 | 481 |
| 472 | 3300013100 | Ga0157373_10034470 | Ga0157373_100344702 | 481 |
| 473 | 3300013102 | Ga0157371_10013553 | Ga0157371_100135533 | 481 |
| 474 | 3300013105 | Ga0157369_10044245 | Ga0157369_100442452 | 481 |
| 475 | 3300013307 | Ga0157372_10066198 | Ga0157372_100661982 | 481 |
| 476 | 3300013308 | Ga0157375_10098527 | Ga0157375_100985272 | 481 |
| 477 | 3300014325 | Ga0163163_10001664 | Ga0163163_1000166412 | 481 |
| 478 | 3300014326 | Ga0157380_10096094 | Ga0157380_100960942 | 481 |
| 479 | 3300014745 | Ga0157377_10001157 | Ga0157377_100011575 | 481 |
| 480 | 3300014969 | Ga0157376_10036361 | Ga0157376_100363613 | 481 |
| 481 | 3300025315 | Ga0207697_10031844 | Ga0207697_100318442 | 481 |
| 482 | 3300025899 | Ga0207642_10006892 | Ga0207642_100068922 | 481 |
| 483 | 3300025904 | Ga0207647_10007769 | Ga0207647_100077693 | 481 |
| 484 | 3300025907 | Ga0207645_10000330 | Ga0207645_100003302 | 481 |
| 485 | 3300025908 | Ga0207643_10000975 | Ga0207643_100009753 | 481 |
| 486 | 3300025918 | Ga0207662_10007683 | Ga0207662_100076833 | 481 |
| 487 | 3300025919 | Ga0207657_10000458 | Ga0207657_1000045835 | 481 |
| 488 | 3300025920 | Ga0207649_10002595 | Ga0207649_100025957 | 481 |
| 489 | 3300025923 | Ga0207681_10039151 | Ga0207681_100391512 | 481 |
| 490 | 3300025925 | Ga0207650_10000058 | Ga0207650_1000005860 | 481 |
| 491 | 3300025926 | Ga0207659_10014384 | Ga0207659_100143842 | 481 |
| 492 | 3300025927 | Ga0207687_10025467 | Ga0207687_100254672 | 481 |
| 493 | 3300025931 | Ga0207644_10013643 | Ga0207644_100136433 | 481 |
| 494 | 3300025933 | Ga0207706_10000245 | Ga0207706_1000024546 | 481 |
| 495 | 3300025934 | Ga0207686_10012288 | Ga0207686_100122883 | 481 |
| 496 | 3300025936 | Ga0207670_10007488 | Ga0207670_100074883 | 481 |
| 497 | 3300025937 | Ga0207669_10033410 | Ga0207669_100334102 | 481 |
| 498 | 3300025940 | Ga0207691_10031536 | Ga0207691_100315362 | 481 |
| 499 | 3300025942 | Ga0207689_10000734 | Ga0207689_100007343 | 481 |
| 500 | 3300025944 | Ga0207661_10000551 | Ga0207661_100005514 | 481 |
| 501 | 3300025945 | Ga0207679_10000170 | Ga0207679_1000017023 | 481 |
| 502 | 3300025949 | Ga0207667_10088311 | Ga0207667_100883112 | 481 |
| 503 | 3300025960 | Ga0207651_10017392 | Ga0207651_100173922 | 481 |
| 504 | 3300025961 | Ga0207712_10076207 | Ga0207712_100762072 | 481 |
| 505 | 3300025981 | Ga0207640_10037304 | Ga0207640_100373042 | 481 |
| 506 | 3300026023 | Ga0207677_10052811 | Ga0207677_100528112 | 481 |
| 507 | 3300026067 | Ga0207678_10005878 | Ga0207678_100058782 | 481 |
| 508 | 3300026075 | Ga0207708_10077133 | Ga0207708_100771331 | 481 |
| 509 | 3300026088 | Ga0207641_10000323 | Ga0207641_100003237 | 481 |
| 510 | 3300026089 | Ga0207648_10001360 | Ga0207648_100013602 | 481 |
| 511 | 3300026095 | Ga0207676_10000163 | Ga0207676_1000016344 | 481 |
| 512 | 3300026116 | Ga0207674_10000164 | Ga0207674_1000016442 | 481 |
| 513 | 3300026121 | Ga0207683_10006145 | Ga0207683_100061453 | 481 |
| 514 | 3300026142 | Ga0207698_10052865 | Ga0207698_100528652 | 481 |
| 515 | 3300028379 | Ga0268266_10046087 | Ga0268266_100460872 | 481 |
| 516 | 3300028380 | Ga0268265_10031505 | Ga0268265_100315053 | 481 |
| 517 | 3300028381 | Ga0268264_10030611 | Ga0268264_100306113 | 481 |
| 518 | 3300048905 | Ga0496102_0041183 | Ga0496102_0041183_167_1612 | 481 |
| 519 | 3300048911 | Ga0496108_0010617 | Ga0496108_0010617_2402_3847 | 481 |
| 520 | 3300048912 | Ga0496109_0000169 | Ga0496109_0000169_55693_57138 | 481 |
| 521 | 3300048913 | Ga0496110_0001005 | Ga0496110_0001005_3839_5284 | 481 |
| 522 | 3300048914 | Ga0496111_0022660 | Ga0496111_0022660_1368_2813 | 481 |
| 523 | 3300048915 | Ga0496112_0000060 | Ga0496112_0000060_52215_53660 | 481 |
| 524 | 3300048916 | Ga0496113_0000553 | Ga0496113_0000553_224_1669 | 481 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4djk-assembly3.cif.gz_B | structure of glutamate-gaba antiporter gadc | 0.8598 | 16 | 460 |
| 4dji-assembly3.cif.gz_A | structure of glutamate-gaba antiporter gadc | 0.8514 | 14 | 460 |
| 4dji-assembly3.cif.gz_B | structure of glutamate-gaba antiporter gadc | 0.8478 | 16 | 460 |
| 4djk-assembly3.cif.gz_A | structure of glutamate-gaba antiporter gadc | 0.8396 | 16 | 464 |
| 4djk-assembly3.cif.gz_B | structure of glutamate-gaba antiporter gadc | 0.8296 | 16 | 460 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P63235_7_481_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9078 | 19 | 460 | 1.20.1740.10 |
| af_P39282_4_494_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.882 | 15 | 460 | 1.20.1740.10 |
| af_P42590_4_465_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8781 | 13 | 457 | 1.20.1740.10 |
| af_P75835_4_476_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8737 | 13 | 463 | 1.20.1740.10 |
| af_P63235_7_481_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8466 | 19 | 460 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9DJ03-F1-model_v4 | Amino acid permease | 0.9582 | 1 | 464 |
GO:0005886
GO:0022857 |
| AF-A0A2V9TW08-F1-model_v4 | Amino acid permease | 0.9568 | 1 | 475 |
GO:0005886
GO:0022857 |
| AF-A0A2V9GU99-F1-model_v4 | Amino acid permease | 0.9511 | 1 | 470 |
GO:0005886
GO:0022857 |
| AF-A0A1Q7ZAR3-F1-model_v4 | Amino acid permease | 0.9417 | 12 | 462 |
GO:0005886
GO:0022857 |
| AF-A0A2V9TW08-F1-model_v4 | Amino acid permease | 0.9412 | 1 | 475 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar