F459108

General Info

Members Datasets Scaffolds Average Seq Length
524 232 524 467

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100161157|Ga0070699_1001611571
Length 517
Sequence LQNEAAIASAGSITSAAQDAPHLRRVLGRMDLVLLFVVAVFNLNVVPSIAANGGVTVWLWIISLALFFWPQGIAVIELAHRYPGEGGVYLWAKEVFGDFHGFLSGWCYWTNNMMYVPTVMLYFVGVSVFALGSGHEGLADNKTFALTASLLLLVFLVVLNIVGLGVGKWINNLGAIGTGIAAAVLIGLGMVVWLRFGTTVTWADFRIPPNPRFVLNSFAVICFGLVGLELASIMGDEIENPQKTLPGAVAWGGVLSGALYIGATLTLLIAINKGDINVLQGIVQAVGHMAGRLGVGWIVAPFALMLSLSIAGIASAWLGGSARIPFVAGLDSYMPSWLGRVHPRYHTPYAALIVHAAVSMVLVVLNFSGWWIWNKLIGLSLVAYILRASGFVVANLMASPTGVQETFQKLLSLAVVLQLIPFLYMFGALLKIAFSDSFAKACYGKTKLILSGASGLITTILGIGLAFFPAQQVTSIFSYEVWMFGGTLFFIGLAAFFFFVYGRHKSARKLAEAVPLL

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
164 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.53
Rhizosphere 93.32
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10002304 3300002239 Bacteria 2614
2 Ga0070658_10026272 3300005327 Bacteria 4670
3 Ga0070676_10015943 3300005328 Bacteria 4147
4 Ga0070676_10031597 3300005328 Bacteria 3027
5 Ga0070683_100001410 3300005329 Bacteria 18459
6 Ga0070683_100020363 3300005329 Bacteria 5904
7 Ga0070683_100119095 3300005329 Unclassified 2493
8 Ga0070690_100007305 3300005330 Bacteria 6327
9 Ga0070670_100002128 3300005331 Bacteria 16247
10 Ga0070670_100016498 3300005331 Bacteria 6341
11 Ga0068869_100010897 3300005334 Bacteria 5947
12 Ga0068869_100025905 3300005334 Bacteria 4077
13 Ga0068869_100031928 3300005334 Bacteria 3708
14 Ga0070666_10010602 3300005335 Bacteria 5766
15 Ga0070666_10018971 3300005335 Bacteria 4432
16 Ga0070666_10024702 3300005335 Bacteria 3917
17 Ga0070680_100054480 3300005336 Bacteria 3266
18 Ga0068868_100001052 3300005338 Bacteria 18872
19 Ga0068868_100004660 3300005338 Bacteria 9625
20 Ga0070687_100009776 3300005343 Bacteria 4120
21 Ga0070661_100015954 3300005344 Bacteria 5302
22 Ga0070661_100016008 3300005344 Bacteria 5293
23 Ga0070661_100022947 3300005344 Bacteria 4470
24 Ga0070668_100001619 3300005347 Bacteria 16277
25 Ga0070669_100050826 3300005353 Bacteria 3028
26 Ga0070669_100050854 3300005353 Bacteria 3028
27 Ga0070671_100024078 3300005355 Bacteria 4983
28 Ga0070674_100030624 3300005356 Bacteria 3558
29 Ga0070673_100163068 3300005364 Unclassified 1897
30 Ga0070688_100006942 3300005365 Bacteria 6083
31 Ga0070659_100007111 3300005366 Bacteria 8116
32 Ga0070659_100015344 3300005366 Bacteria 5737
33 Ga0070667_100053799 3300005367 Bacteria 3398
34 Ga0070703_10002370 3300005406 Bacteria 5437
35 Ga0070709_10003654 3300005434 Bacteria 8255
36 Ga0070709_10004050 3300005434 Bacteria 7906
37 Ga0070709_10026558 3300005434 Bacteria 3433
38 Ga0070709_10080158 3300005434 Bacteria 2128
39 Ga0070709_10080334 3300005434 Bacteria 2126
40 Ga0070714_100000054 3300005435 Bacteria 104948
41 Ga0070714_100020160 3300005435 Bacteria 5441
42 Ga0070714_100042455 3300005435 Bacteria 3842
43 Ga0070713_100000188 3300005436 Bacteria 40867
44 Ga0070713_100005655 3300005436 Bacteria 8576
45 Ga0070713_100025798 3300005436 Bacteria 4602
46 Ga0070713_100043608 3300005436 Bacteria 3668
47 Ga0070713_100154210 3300005436 Unclassified 2046
48 Ga0070710_10005758 3300005437 Bacteria 5904
49 Ga0070710_10012414 3300005437 Bacteria 4231
50 Ga0070710_10019149 3300005437 Bacteria 3534
51 Ga0070710_10070205 3300005437 Unclassified 2017
52 Ga0070711_100005021 3300005439 Bacteria 7867
53 Ga0070711_100011852 3300005439 Bacteria 5426
54 Ga0070705_100001727 3300005440 Bacteria 11368
55 Ga0070694_100031627 3300005444 Bacteria 3470
56 Ga0070708_100000258 3300005445 Bacteria 39526
57 Ga0070708_100000730 3300005445 Bacteria 24932
58 Ga0070708_100002282 3300005445 Bacteria 14838
59 Ga0070708_100003396 3300005445 Bacteria 12471
60 Ga0070708_100003476 3300005445 Bacteria 12334
61 Ga0070708_100087578 3300005445 Bacteria 2830
62 Ga0070708_100131230 3300005445 Bacteria 2319
63 Ga0070708_100257672 3300005445 Unclassified 1639
64 Ga0070662_100001311 3300005457 Bacteria 15290
65 Ga0070681_10161405 3300005458 Bacteria 2165
66 Ga0068867_100017340 3300005459 Bacteria 5114
67 Ga0068867_100018927 3300005459 Bacteria 4901
68 Ga0068867_100022678 3300005459 Bacteria 4490
69 Ga0068867_100102443 3300005459 Bacteria 2188
70 Ga0070706_100001995 3300005467 Bacteria 21055
71 Ga0070706_100002945 3300005467 Bacteria 16899
72 Ga0070706_100035823 3300005467 Bacteria 4582
73 Ga0070706_100114165 3300005467 Bacteria 2515
74 Ga0070707_100003955 3300005468 Bacteria 13953
75 Ga0070707_100022628 3300005468 Bacteria 5943
76 Ga0070707_100023194 3300005468 Bacteria 5870
77 Ga0070707_100039468 3300005468 Bacteria 4512
78 Ga0070707_100052786 3300005468 Bacteria 3897
79 Ga0070707_100059365 3300005468 Bacteria 3669
80 Ga0070698_100000148 3300005471 Bacteria 63449
81 Ga0070698_100002041 3300005471 Bacteria 22434
82 Ga0070698_100136062 3300005471 Bacteria 2411
83 Ga0070699_100001045 3300005518 Bacteria 25776
84 Ga0070699_100006769 3300005518 Bacteria 9971
85 Ga0070699_100031914 3300005518 Bacteria 4548
86 Ga0070699_100067098 3300005518 Bacteria 3115
87 Ga0070699_100116533 3300005518 Bacteria 2348
88 Ga0070699_100161157 3300005518 Bacteria 1985
89 Ga0070684_100029051 3300005535 Bacteria 4682
90 Ga0070684_100040018 3300005535 Bacteria 4033
91 Ga0070684_100072169 3300005535 Bacteria 3039
92 Ga0070697_100000092 3300005536 Bacteria 75107
93 Ga0070697_100000570 3300005536 Bacteria 27832
94 Ga0070697_100000630 3300005536 Bacteria 26714
95 Ga0070697_100000921 3300005536 Bacteria 22143
96 Ga0070697_100062341 3300005536 Bacteria 3043
97 Ga0070697_100118734 3300005536 Bacteria 2210
98 Ga0070697_100221599 3300005536 Unclassified 1612
99 Ga0070686_100011250 3300005544 Bacteria 5070
100 Ga0070695_100035677 3300005545 Bacteria 3124
101 Ga0070696_100000413 3300005546 Bacteria 26661
102 Ga0070696_100121466 3300005546 Unclassified 1891
103 Ga0070696_100158675 3300005546 Bacteria 1665
104 Ga0070693_100000309 3300005547 Bacteria 22684
105 Ga0070693_100010569 3300005547 Bacteria 4628
106 Ga0070693_100028360 3300005547 Bacteria 3043
107 Ga0070665_100002088 3300005548 Bacteria 22395
108 Ga0070665_100009890 3300005548 Bacteria 9644
109 Ga0070704_100000191 3300005549 Bacteria 25096
110 Ga0070704_100042863 3300005549 Bacteria 3133
111 Ga0068855_100005150 3300005563 Bacteria 15945
112 Ga0068855_100055914 3300005563 Bacteria 4632
113 Ga0070664_100001802 3300005564 Bacteria 17165
114 Ga0070664_100017155 3300005564 Bacteria 5944
115 Ga0070664_100030028 3300005564 Bacteria 4533
116 Ga0068857_100068151 3300005577 Bacteria 3167
117 Ga0068857_100112114 3300005577 Bacteria 2452
118 Ga0068857_100182827 3300005577 Bacteria 1908
119 Ga0068854_100007433 3300005578 Bacteria 7000
120 Ga0068856_100000436 3300005614 Bacteria 45887
121 Ga0068856_100090018 3300005614 Bacteria 3052
122 Ga0070702_100019038 3300005615 Bacteria 3572
123 Ga0068852_100018688 3300005616 Bacteria 5464
124 Ga0068852_100026397 3300005616 Bacteria 4720
125 Ga0068852_100096151 3300005616 Unclassified 2661
126 Ga0068852_100132522 3300005616 Bacteria 2297
127 Ga0068859_100011960 3300005617 Bacteria 8717
128 Ga0068859_100035120 3300005617 Bacteria 5030
129 Ga0068859_100047598 3300005617 Bacteria 4309
130 Ga0068864_100006672 3300005618 Bacteria 9449
131 Ga0068864_100038468 3300005618 Bacteria 4085
132 Ga0068864_100051749 3300005618 Bacteria 3539
133 Ga0068866_10065874 3300005718 Unclassified 1896
134 Ga0068851_10010152 3300005834 Bacteria 4388
135 Ga0068870_10010366 3300005840 Bacteria 4280
136 Ga0068870_10029163 3300005840 Bacteria 2777
137 Ga0068863_100006247 3300005841 Bacteria 11704
138 Ga0068863_100034458 3300005841 Bacteria 4822
139 Ga0068858_100001669 3300005842 Bacteria 22692
140 Ga0068858_100005368 3300005842 Bacteria 12563
141 Ga0068858_100050011 3300005842 Bacteria 3869
142 Ga0068860_100027846 3300005843 Bacteria 5442
143 Ga0068860_100059154 3300005843 Bacteria 3644
144 Ga0068860_100135103 3300005843 Bacteria 2368
145 Ga0068862_100022178 3300005844 Bacteria 5313
146 Ga0081540_1030947 3300005983 Bacteria 2954
147 Ga0070717_10000472 3300006028 Bacteria 25636
148 Ga0070717_10001371 3300006028 Bacteria 16788
149 Ga0070717_10007398 3300006028 Bacteria 8152
150 Ga0070717_10014331 3300006028 Bacteria 6098
151 Ga0070717_10068647 3300006028 Bacteria 2951
152 Ga0070717_10267170 3300006028 Bacteria 1514
153 Ga0070715_10009345 3300006163 Bacteria 3454
154 Ga0070715_10012060 3300006163 Bacteria 3131
155 Ga0070715_10030848 3300006163 Bacteria 2171
156 Ga0070716_100000300 3300006173 Bacteria 19983
157 Ga0070716_100009732 3300006173 Bacteria 4799
158 Ga0070716_100013266 3300006173 Bacteria 4196
159 Ga0070716_100044114 3300006173 Bacteria 2497
160 Ga0070712_100006280 3300006175 Bacteria 7362
161 Ga0070712_100009078 3300006175 Bacteria 6260
162 Ga0070712_100009576 3300006175 Bacteria 6107
163 Ga0070712_100166673 3300006175 Bacteria 1706
164 Ga0097621_100000183 3300006237 Bacteria 39949
165 Ga0097621_100001802 3300006237 Bacteria 14707
166 Ga0097621_100004754 3300006237 Bacteria 9496
167 Ga0097621_100013368 3300006237 Bacteria 6118
168 Ga0097621_100101683 3300006237 Bacteria 2419
169 Ga0068871_100002972 3300006358 Bacteria 11632
170 Ga0068871_100007289 3300006358 Bacteria 7891
171 Ga0068871_100029002 3300006358 Bacteria 4344
172 Ga0075434_100046681 3300006871 Bacteria 4298
173 Ga0075436_100006574 3300006914 Bacteria 7961
174 Ga0075436_100007607 3300006914 Bacteria 7402
175 Ga0075436_100011669 3300006914 Bacteria 6029
176 Ga0075436_100014415 3300006914 Bacteria 5412
177 Ga0075436_100143371 3300006914 Unclassified 1680
178 Ga0097620_100011960 3300006931 Bacteria 8717
179 Ga0097620_100035120 3300006931 Bacteria 5030
180 Ga0097620_100047598 3300006931 Bacteria 4309
181 Ga0075435_100008964 3300007076 Bacteria 7213
182 Ga0075435_100011548 3300007076 Bacteria 6504
183 Ga0099794_10000669 3300007265 Bacteria 11473
184 Ga0099794_10009809 3300007265 Bacteria 4044
185 Ga0099794_10027161 3300007265 Bacteria 2651
186 Ga0099795_10021510 3300007788 Bacteria 2117
187 Ga0105251_10055370 3300009011 Bacteria 1881
188 Ga0105240_10022678 3300009093 Bacteria 8317
189 Ga0105240_10052964 3300009093 Bacteria 5098
190 Ga0105240_10055244 3300009093 Bacteria 4972
191 Ga0105240_10176428 3300009093 Unclassified 2526
192 Ga0105245_10005793 3300009098 Bacteria 10839
193 Ga0105245_10053219 3300009098 Bacteria 3633
194 Ga0105245_10077715 3300009098 Bacteria 3027
195 Ga0105247_10034392 3300009101 Bacteria 3086
196 Ga0105243_10069081 3300009148 Bacteria 2849
197 Ga0105241_10004694 3300009174 Bacteria 10088
198 Ga0105241_10014773 3300009174 Bacteria 5716
199 Ga0105241_10024601 3300009174 Bacteria 4472
200 Ga0105241_10026134 3300009174 Bacteria 4341
201 Ga0105242_10028250 3300009176 Bacteria 4464
202 Ga0105242_10032960 3300009176 Bacteria 4145
203 Ga0105242_10046508 3300009176 Bacteria 3521
204 Ga0105248_10010896 3300009177 Bacteria 10032
205 Ga0105248_10014251 3300009177 Bacteria 8751
206 Ga0105248_10026894 3300009177 Bacteria 6398
207 Ga0105248_10047499 3300009177 Bacteria 4814
208 Ga0105248_10056239 3300009177 Bacteria 4414
209 Ga0105248_10114221 3300009177 Bacteria 3046
210 Ga0105237_10034900 3300009545 Bacteria 5090
211 Ga0105237_10040485 3300009545 Bacteria 4699
212 Ga0105237_10050004 3300009545 Bacteria 4201
213 Ga0105237_10081906 3300009545 Bacteria 3218
214 Ga0105238_10007499 3300009551 Bacteria 10929
215 Ga0105238_10020954 3300009551 Bacteria 6660
216 Ga0105249_10013641 3300009553 Bacteria 7175
217 Ga0105239_10008576 3300010375 Bacteria 11598
218 Ga0105239_10047148 3300010375 Bacteria 4722
219 Ga0105246_10119211 3300011119 Bacteria 1952
220 Ga0157373_10006176 3300013100 Bacteria 8952
221 Ga0157373_10034470 3300013100 Bacteria 3635
222 Ga0157373_10102733 3300013100 Bacteria 2011
223 Ga0157371_10003936 3300013102 Bacteria 13191
224 Ga0157371_10013553 3300013102 Bacteria 6190
225 Ga0157371_10042869 3300013102 Unclassified 3225
226 Ga0157371_10158772 3300013102 Bacteria 1615
227 Ga0157369_10028452 3300013105 Bacteria 6185
228 Ga0157369_10044245 3300013105 Unclassified 4847
229 Ga0157369_10154202 3300013105 Bacteria 2427
230 Ga0157369_10163164 3300013105 Bacteria 2351
231 Ga0157374_10000187 3300013296 Bacteria 57781
232 Ga0157374_10007069 3300013296 Bacteria 9557
233 Ga0157374_10017621 3300013296 Bacteria 6292
234 Ga0157374_10024896 3300013296 Bacteria 5369
235 Ga0157374_10028852 3300013296 Bacteria 5017
236 Ga0157378_10000161 3300013297 Bacteria 63839
237 Ga0157378_10000181 3300013297 Bacteria 60266
238 Ga0157378_10000353 3300013297 Bacteria 45114
239 Ga0157378_10000739 3300013297 Bacteria 30524
240 Ga0157378_10005841 3300013297 Bacteria 10788
241 Ga0157378_10107199 3300013297 Bacteria 2557
242 Ga0157378_10130450 3300013297 Bacteria 2326
243 Ga0163162_10002288 3300013306 Bacteria 17976
244 Ga0163162_10008859 3300013306 Bacteria 9781
245 Ga0163162_10099282 3300013306 Bacteria 3002
246 Ga0157372_10001859 3300013307 Bacteria 22893
247 Ga0157372_10005390 3300013307 Bacteria 13600
248 Ga0157372_10006207 3300013307 Bacteria 12699
249 Ga0157372_10008201 3300013307 Bacteria 11101
250 Ga0157372_10013942 3300013307 Bacteria 8588
251 Ga0157372_10066198 3300013307 Bacteria 4059
252 Ga0157375_10098527 3300013308 Bacteria 3000
253 Ga0163163_10001664 3300014325 Bacteria 18732
254 Ga0163163_10012039 3300014325 Bacteria 7871
255 Ga0163163_10046496 3300014325 Bacteria 4263
256 Ga0163163_10060798 3300014325 Bacteria 3742
257 Ga0163163_10106682 3300014325 Bacteria 2827
258 Ga0157380_10096094 3300014326 Bacteria 2456
259 Ga0157377_10001157 3300014745 Bacteria 11181
260 Ga0157379_10001683 3300014968 Bacteria 18273
261 Ga0157379_10006009 3300014968 Bacteria 10465
262 Ga0157379_10023305 3300014968 Bacteria 5492
263 Ga0157379_10031396 3300014968 Bacteria 4732
264 Ga0157379_10167571 3300014968 Bacteria 1983
265 Ga0157376_10000008 3300014969 Bacteria 351192
266 Ga0157376_10000852 3300014969 Bacteria 20014
267 Ga0157376_10003365 3300014969 Bacteria 11002
268 Ga0157376_10036361 3300014969 Bacteria 3989
269 Ga0157376_10049130 3300014969 Bacteria 3493
270 Ga0213874_10018106 3300021377 Unclassified 1900
271 Ga0213876_10036462 3300021384 Unclassified 2593
272 Ga0228598_1001070 3300024227 Bacteria 6022
273 Ga0228598_1001796 3300024227 Bacteria 4678
274 Ga0207697_10031844 3300025315 Bacteria 2158
275 Ga0207656_10007524 3300025321 Bacteria 3971
276 Ga0207653_10004906 3300025885 Bacteria 4180
277 Ga0207692_10005292 3300025898 Bacteria 5159
278 Ga0207642_10006892 3300025899 Bacteria 3804
279 Ga0207680_10023226 3300025903 Bacteria 3383
280 Ga0207680_10054926 3300025903 Bacteria 2398
281 Ga0207647_10007769 3300025904 Bacteria 7719
282 Ga0207647_10008969 3300025904 Bacteria 7124
283 Ga0207647_10012828 3300025904 Bacteria 5822
284 Ga0207685_10006871 3300025905 Bacteria 3131
285 Ga0207685_10023098 3300025905 Bacteria 2112
286 Ga0207699_10007982 3300025906 Unclassified 5198
287 Ga0207699_10008109 3300025906 Bacteria 5167
288 Ga0207699_10008908 3300025906 Bacteria 4974
289 Ga0207699_10033284 3300025906 Bacteria 2912
290 Ga0207645_10000330 3300025907 Bacteria 39597
291 Ga0207645_10010617 3300025907 Bacteria 6318
292 Ga0207643_10000975 3300025908 Bacteria 17195
293 Ga0207643_10035523 3300025908 Bacteria 2795
294 Ga0207684_10000447 3300025910 Bacteria 54429
295 Ga0207684_10002057 3300025910 Bacteria 20692
296 Ga0207684_10002811 3300025910 Bacteria 17297
297 Ga0207684_10082853 3300025910 Bacteria 2732
298 Ga0207654_10014519 3300025911 Bacteria 4070
299 Ga0207654_10018553 3300025911 Bacteria 3653
300 Ga0207654_10023554 3300025911 Bacteria 3299
301 Ga0207654_10034960 3300025911 Bacteria 2796
302 Ga0207695_10035323 3300025913 Bacteria 5423
303 Ga0207695_10046682 3300025913 Bacteria 4589
304 Ga0207695_10070215 3300025913 Unclassified 3582
305 Ga0207695_10127400 3300025913 Unclassified 2506
306 Ga0207671_10022269 3300025914 Bacteria 4792
307 Ga0207671_10022952 3300025914 Bacteria 4711
308 Ga0207671_10045342 3300025914 Bacteria 3251
309 Ga0207693_10001184 3300025915 Bacteria 23296
310 Ga0207693_10003013 3300025915 Bacteria 14570
311 Ga0207693_10007281 3300025915 Bacteria 9106
312 Ga0207693_10016219 3300025915 Bacteria 5957
313 Ga0207663_10003294 3300025916 Bacteria 7871
314 Ga0207663_10033563 3300025916 Bacteria 3059
315 Ga0207663_10039944 3300025916 Bacteria 2847
316 Ga0207663_10054423 3300025916 Bacteria 2506
317 Ga0207662_10007683 3300025918 Bacteria 5874
318 Ga0207657_10000458 3300025919 Bacteria 43216
319 Ga0207657_10002016 3300025919 Bacteria 21946
320 Ga0207657_10002563 3300025919 Bacteria 19662
321 Ga0207649_10002595 3300025920 Bacteria 10036
322 Ga0207649_10053224 3300025920 Bacteria 2515
323 Ga0207652_10005526 3300025921 Bacteria 10247
324 Ga0207646_10000676 3300025922 Bacteria 44173
325 Ga0207646_10001577 3300025922 Bacteria 27856
326 Ga0207646_10005589 3300025922 Bacteria 13200
327 Ga0207646_10071315 3300025922 Bacteria 3103
328 Ga0207646_10079657 3300025922 Bacteria 2929
329 Ga0207646_10092553 3300025922 Bacteria 2706
330 Ga0207681_10039151 3300025923 Bacteria 3145
331 Ga0207650_10000058 3300025925 Bacteria 153056
332 Ga0207650_10009443 3300025925 Bacteria 6666
333 Ga0207659_10014384 3300025926 Bacteria 5102
334 Ga0207687_10025104 3300025927 Bacteria 3987
335 Ga0207687_10025467 3300025927 Bacteria 3958
336 Ga0207700_10004881 3300025928 Bacteria 7966
337 Ga0207700_10037500 3300025928 Bacteria 3511
338 Ga0207700_10058095 3300025928 Bacteria 2921
339 Ga0207700_10072857 3300025928 Bacteria 2650
340 Ga0207700_10145613 3300025928 Bacteria 1952
341 Ga0207664_10000954 3300025929 Bacteria 19503
342 Ga0207664_10004842 3300025929 Bacteria 9154
343 Ga0207664_10012565 3300025929 Bacteria 6058
344 Ga0207644_10013643 3300025931 Bacteria 5422
345 Ga0207706_10000245 3300025933 Bacteria 59509
346 Ga0207706_10000676 3300025933 Bacteria 35793
347 Ga0207706_10016843 3300025933 Bacteria 6596
348 Ga0207706_10192365 3300025933 Bacteria 1790
349 Ga0207686_10012288 3300025934 Bacteria 4705
350 Ga0207709_10015686 3300025935 Bacteria 4204
351 Ga0207670_10007488 3300025936 Bacteria 6095
352 Ga0207669_10033410 3300025937 Bacteria 2903
353 Ga0207665_10000049 3300025939 Bacteria 76350
354 Ga0207665_10000080 3300025939 Bacteria 62639
355 Ga0207665_10005337 3300025939 Bacteria 8587
356 Ga0207665_10021778 3300025939 Bacteria 4216
357 Ga0207665_10056305 3300025939 Bacteria 2654
358 Ga0207691_10031536 3300025940 Bacteria 4946
359 Ga0207711_10018376 3300025941 Bacteria 5812
360 Ga0207711_10021120 3300025941 Bacteria 5438
361 Ga0207689_10000734 3300025942 Bacteria 31550
362 Ga0207689_10004057 3300025942 Bacteria 13302
363 Ga0207689_10010914 3300025942 Bacteria 7810
364 Ga0207689_10027907 3300025942 Bacteria 4722
365 Ga0207661_10000551 3300025944 Bacteria 23963
366 Ga0207661_10222751 3300025944 Bacteria 1668
367 Ga0207679_10000170 3300025945 Bacteria 53584
368 Ga0207679_10053668 3300025945 Bacteria 2963
369 Ga0207667_10000694 3300025949 Bacteria 43647
370 Ga0207667_10022433 3300025949 Bacteria 6974
371 Ga0207667_10088311 3300025949 Bacteria 3207
372 Ga0207651_10017392 3300025960 Bacteria 4248
373 Ga0207712_10076207 3300025961 Bacteria 2427
374 Ga0207668_10056982 3300025972 Bacteria 2724
375 Ga0207640_10001398 3300025981 Bacteria 13020
376 Ga0207640_10037304 3300025981 Bacteria 3057
377 Ga0207640_10044511 3300025981 Bacteria 2845
378 Ga0207677_10001639 3300026023 Bacteria 11858
379 Ga0207677_10002373 3300026023 Bacteria 9859
380 Ga0207677_10010595 3300026023 Bacteria 5222
381 Ga0207677_10052811 3300026023 Bacteria 2763
382 Ga0207703_10003415 3300026035 Bacteria 13332
383 Ga0207703_10213856 3300026035 Bacteria 1720
384 Ga0207639_10039043 3300026041 Unclassified 3535
385 Ga0207639_10141830 3300026041 Bacteria 2003
386 Ga0207678_10000666 3300026067 Bacteria 31531
387 Ga0207678_10005878 3300026067 Bacteria 10936
388 Ga0207708_10077133 3300026075 Bacteria 2557
389 Ga0207702_10000657 3300026078 Bacteria 37655
390 Ga0207702_10009897 3300026078 Bacteria 7993
391 Ga0207702_10013784 3300026078 Bacteria 6714
392 Ga0207641_10000323 3300026088 Bacteria 58693
393 Ga0207641_10008200 3300026088 Bacteria 8635
394 Ga0207641_10020160 3300026088 Bacteria 5474
395 Ga0207648_10001360 3300026089 Bacteria 27048
396 Ga0207648_10012134 3300026089 Bacteria 8079
397 Ga0207648_10019307 3300026089 Bacteria 6152
398 Ga0207648_10022125 3300026089 Bacteria 5711
399 Ga0207676_10000163 3300026095 Bacteria 58243
400 Ga0207676_10004714 3300026095 Bacteria 9662
401 Ga0207674_10000164 3300026116 Bacteria 79381
402 Ga0207674_10000905 3300026116 Bacteria 38684
403 Ga0207674_10058520 3300026116 Bacteria 3903
404 Ga0207675_100032027 3300026118 Bacteria 4898
405 Ga0207683_10006145 3300026121 Bacteria 10290
406 Ga0207698_10052865 3300026142 Bacteria 3114
407 Ga0209179_1009170 3300027512 Unclassified 1688
408 Ga0209588_1001776 3300027671 Bacteria 5724
409 Ga0209588_1002774 3300027671 Bacteria 4794
410 Ga0265354_1002457 3300028016 Bacteria 2287
411 Ga0265357_1000346 3300028023 Bacteria 2530
412 Ga0268266_10000227 3300028379 Bacteria 97786
413 Ga0268266_10046087 3300028379 Bacteria 3732
414 Ga0268265_10021199 3300028380 Bacteria 4548
415 Ga0268265_10031505 3300028380 Bacteria 3829
416 Ga0268264_10029558 3300028381 Bacteria 4489
417 Ga0268264_10030611 3300028381 Bacteria 4411
418 Ga0268264_10042130 3300028381 Bacteria 3779
419 Ga0268264_10125159 3300028381 Bacteria 2271
420 Ga0265338_10004188 3300028800 Bacteria 19676
421 Ga0265338_10035922 3300028800 Bacteria 4752
422 Ga0265338_10069365 3300028800 Bacteria 3029
423 Ga0265762_1000325 3300030760 Bacteria 8066
424 Ga0265770_1000601 3300030878 Bacteria 4986
425 Ga0265770_1002307 3300030878 Bacteria 2593
426 Ga0265765_1000384 3300030879 Bacteria 3369
427 Ga0265760_10000141 3300031090 Bacteria 18302
428 Ga0265760_10003719 3300031090 Bacteria 4414
429 Ga0265316_10004327 3300031344 Bacteria 14159
430 Ga0265316_10042197 3300031344 Bacteria 3647
431 Ga0265314_10032002 3300031711 Bacteria 3875
432 Ga0316212_1000580 3300033547 Bacteria 4555
433 Ga0373936_0008709 3300035113 Bacteria 3820
434 Ga0373945_0000496 3300035116 Bacteria 11179
435 Ga0373953_0035093 3300035117 Bacteria 1969
436 Ga0373954_0036245 3300035118 Bacteria 2289
437 Ga0373956_0005475 3300035119 Bacteria 5084
438 Ga0373957_0005562 3300035120 Bacteria 3911
439 Ga0373943_0000045 3300035170 Bacteria 42005
440 Ga0373943_0004997 3300035170 Bacteria 5985
441 Ga0373946_0002383 3300035171 Bacteria 6649
442 Ga0373946_0003252 3300035171 Bacteria 5771
443 Ga0373931_0016020 3300035691 Bacteria 3685
444 Ga0373935_0018520 3300035692 Bacteria 4236
445 Ga0373927_0000094 3300035695 Bacteria 66764
446 Ga0373927_0002440 3300035695 Bacteria 13559
447 Ga0373927_0018433 3300035695 Bacteria 4588
448 Ga0373933_0028200 3300035724 Bacteria 3237
449 Ga0373947_0006702 3300035725 Bacteria 6683
450 Ga0373937_0000555 3300036401 Bacteria 33153
451 Ga0373937_0064562 3300036401 Bacteria 3368
452 Ga0373937_0255139 3300036401 Unclassified 1653
453 Ga0373925_0000297 3300037068 Bacteria 52136
454 Ga0373925_0003730 3300037068 Bacteria 11699
455 Ga0373925_0007729 3300037068 Bacteria 7829
456 Ga0373925_0024183 3300037068 Bacteria 4434
457 Ga0436364_0831126 3300037853 Bacteria 1725
458 Ga0436365_0942396 3300039437 Bacteria 6505
459 Ga0436363_0665316 3300039450 Bacteria 4015
460 Ga0495629_0015435 3300046459 Bacteria 5485
461 Ga0495653_0125873 3300046463 Unclassified 1820
462 Ga0495580_0000037 3300046472 Bacteria 71995
463 Ga0495580_0008672 3300046472 Bacteria 8060
464 Ga0495580_0008800 3300046472 Bacteria 7992
465 Ga0495580_0011396 3300046472 Bacteria 6880
466 Ga0495580_0014399 3300046472 Bacteria 5999
467 Ga0495580_0066309 3300046472 Bacteria 2527
468 Ga0495639_0002138 3300046475 Bacteria 8715
469 Ga0495662_0037673 3300046476 Bacteria 2336
470 Ga0495664_0026856 3300046477 Bacteria 3355
471 Ga0495594_0015281 3300046499 Unclassified 4030
472 Ga0495628_0004325 3300046516 Bacteria 12607
473 Ga0495630_0017481 3300046517 Bacteria 5254
474 Ga0495640_0002276 3300046533 Bacteria 15394
475 Ga0495586_0010064 3300046535 Bacteria 5034
476 Ga0495587_0002499 3300046536 Bacteria 12276
477 Ga0495647_0002553 3300046681 Bacteria 5769
478 Ga0495669_0048049 3300046684 Unclassified 1908
479 Ga0495613_0056299 3300046689 Bacteria 2887
480 Ga0495581_0046568 3300047315 Bacteria 2506
481 Ga0495674_0016465 3300047319 Bacteria 6896
482 Ga0495676_0047424 3300047321 Bacteria 3474
483 Ga0495675_0003992 3300047444 Bacteria 8941
484 Ga0495684_0047632 3300047471 Bacteria 3278
485 Ga0495602_0001204 3300048088 Bacteria 25464
486 Ga0495602_0150745 3300048088 Bacteria 1828
487 Ga0496100_0008437 3300048903 Bacteria 5747
488 Ga0496100_0042229 3300048903 Bacteria 2912
489 Ga0496101_0062585 3300048904 Bacteria 2706
490 Ga0496102_0004513 3300048905 Bacteria 11761
491 Ga0496102_0019020 3300048905 Bacteria 6044
492 Ga0496102_0041183 3300048905 Unclassified 4182
493 Ga0496102_0100259 3300048905 Unclassified 2689
494 Ga0496103_0008179 3300048906 Bacteria 6208
495 Ga0496103_0008280 3300048906 Bacteria 6175
496 Ga0496104_0172237 3300048907 Bacteria 2075
497 Ga0496106_0154965 3300048909 Bacteria 1809
498 Ga0496107_0043185 3300048910 Bacteria 3239
499 Ga0496107_0062791 3300048910 Unclassified 2691
500 Ga0496108_0010617 3300048911 Bacteria 7471
501 Ga0496109_0000169 3300048912 Bacteria 64301
502 Ga0496110_0001005 3300048913 Bacteria 19871
503 Ga0496110_0053160 3300048913 Bacteria 3560
504 Ga0496110_0204277 3300048913 Unclassified 1795
505 Ga0496111_0022660 3300048914 Bacteria 4399
506 Ga0496112_0000060 3300048915 Bacteria 74795
507 Ga0496112_0015045 3300048915 Bacteria 7203
508 Ga0496112_0040983 3300048915 Bacteria 4530
509 Ga0496112_0068355 3300048915 Bacteria 3508
510 Ga0496112_0083892 3300048915 Bacteria 3152
511 Ga0496112_0095150 3300048915 Bacteria 2949
512 Ga0496112_0220833 3300048915 Bacteria 1851
513 Ga0496113_0000553 3300048916 Bacteria 18549
514 Ga0496115_0003103 3300048918 Bacteria 11938
515 Ga0496115_0004025 3300048918 Bacteria 10613
516 Ga0501083_0064688 3300049744 Bacteria 2437
517 nmdc:mga0rr50_55056_c1 3300050513 Bacteria 2966
518 nmdc:mga08x19_12310_c1 3300050514 Bacteria 5151
519 nmdc:mga08x19_21384_c1 3300050514 Bacteria 3993
520 nmdc:mga08x19_242_c1 3300050514 Bacteria 41716
521 nmdc:mga08x19_4630_c1 3300050514 Bacteria 8163
522 nmdc:mga08x19_6770_c1 3300050514 Bacteria 6806
523 Ga0495619_0118663 3300053085 Bacteria 1813
524 Ga0495619_0129158 3300053085 Bacteria 1736

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0220833 Ga0496112_0220833_626_1810 373
2 3300031090 Ga0265760_10003719 Ga0265760_100037193 396
3 3300048909 Ga0496106_0154965 Ga0496106_0154965_443_1726 403
4 3300005437 Ga0070710_10005758 Ga0070710_100057583 408
5 3300025898 Ga0207692_10005292 Ga0207692_100052923 408
6 3300005434 Ga0070709_10003654 Ga0070709_100036543 419
7 3300005435 Ga0070714_100000054 Ga0070714_1000000544 419
8 3300005439 Ga0070711_100005021 Ga0070711_1000050212 419
9 3300025916 Ga0207663_10003294 Ga0207663_100032945 419
10 3300025929 Ga0207664_10000954 Ga0207664_100009544 419
11 3300035113 Ga0373936_0008709 Ga0373936_0008709_1051_2553 419
12 3300035116 Ga0373945_0000496 Ga0373945_0000496_6562_8064 419
13 3300035117 Ga0373953_0035093 Ga0373953_0035093_204_1706 419
14 3300035120 Ga0373957_0005562 Ga0373957_0005562_330_1832 419
15 3300035170 Ga0373943_0000045 Ga0373943_0000045_38910_40412 419
16 3300035171 Ga0373946_0003252 Ga0373946_0003252_227_1729 419
17 3300035692 Ga0373935_0018520 Ga0373935_0018520_888_2390 419
18 3300035695 Ga0373927_0000094 Ga0373927_0000094_49802_51304 419
19 3300035725 Ga0373947_0006702 Ga0373947_0006702_1061_2563 419
20 3300037068 Ga0373925_0000297 Ga0373925_0000297_22206_23708 419
21 3300047319 Ga0495674_0016465 Ga0495674_0016465_5265_6767 419
22 3300005434 Ga0070709_10080334 Ga0070709_100803342 425
23 3300005445 Ga0070708_100003396 Ga0070708_1000033963 425
24 3300005468 Ga0070707_100022628 Ga0070707_1000226283 425
25 3300005471 Ga0070698_100002041 Ga0070698_10000204111 425
26 3300005518 Ga0070699_100001045 Ga0070699_10000104521 425
27 3300005536 Ga0070697_100000092 Ga0070697_10000009269 425
28 3300025910 Ga0207684_10000447 Ga0207684_1000044738 425
29 3300025922 Ga0207646_10000676 Ga0207646_1000067638 425
30 3300046472 Ga0495580_0000037 Ga0495580_0000037_54289_55728 425
31 3300005983 Ga0081540_1030947 Ga0081540_10309472 429
32 3300021377 Ga0213874_10018106 Ga0213874_100181062 429
33 3300039450 Ga0436363_0665316 Ga0436363_0665316_2104_3474 429
34 3300005434 Ga0070709_10004050 Ga0070709_100040503 430
35 3300005436 Ga0070713_100000188 Ga0070713_10000018816 430
36 3300006163 Ga0070715_10030848 Ga0070715_100308482 430
37 3300006173 Ga0070716_100044114 Ga0070716_1000441142 430
38 3300006175 Ga0070712_100009078 Ga0070712_1000090782 430
39 3300025905 Ga0207685_10023098 Ga0207685_100230982 430
40 3300025906 Ga0207699_10008109 Ga0207699_100081093 430
41 3300025916 Ga0207663_10033563 Ga0207663_100335632 430
42 3300025928 Ga0207700_10004881 Ga0207700_100048812 430
43 3300025928 Ga0207700_10145613 Ga0207700_101456132 430
44 3300025939 Ga0207665_10021778 Ga0207665_100217782 430
45 3300048088 Ga0495602_0150745 Ga0495602_0150745_200_1660 433
46 3300005614 Ga0068856_100090018 Ga0068856_1000900182 435
47 3300005841 Ga0068863_100006247 Ga0068863_1000062474 435
48 3300006175 Ga0070712_100166673 Ga0070712_1001666732 435
49 3300007076 Ga0075435_100008964 Ga0075435_1000089644 435
50 3300009545 Ga0105237_10081906 Ga0105237_100819063 435
51 3300013100 Ga0157373_10102733 Ga0157373_101027332 435
52 3300013307 Ga0157372_10013942 Ga0157372_100139423 435
53 3300026088 Ga0207641_10008200 Ga0207641_100082002 435
54 3300046472 Ga0495580_0066309 Ga0495580_0066309_1019_2461 435
55 3300005445 Ga0070708_100003476 Ga0070708_1000034765 436
56 3300005467 Ga0070706_100001995 Ga0070706_1000019954 436
57 3300005536 Ga0070697_100000921 Ga0070697_10000092114 436
58 3300025910 Ga0207684_10002811 Ga0207684_100028116 436
59 3300005336 Ga0070680_100054480 Ga0070680_1000544802 437
60 3300005440 Ga0070705_100001727 Ga0070705_1000017275 437
61 3300005444 Ga0070694_100031627 Ga0070694_1000316272 437
62 3300005445 Ga0070708_100000258 Ga0070708_10000025823 437
63 3300005536 Ga0070697_100000570 Ga0070697_10000057013 437
64 3300005546 Ga0070696_100000413 Ga0070696_1000004139 437
65 3300005547 Ga0070693_100000309 Ga0070693_10000030917 437
66 3300005549 Ga0070704_100000191 Ga0070704_10000019110 437
67 3300025885 Ga0207653_10004906 Ga0207653_100049062 437
68 3300025921 Ga0207652_10005526 Ga0207652_100055267 437
69 3300005445 Ga0070708_100131230 Ga0070708_1001312302 438
70 3300005328 Ga0070676_10015943 Ga0070676_100159433 439
71 3300005329 Ga0070683_100020363 Ga0070683_1000203632 439
72 3300005335 Ga0070666_10010602 Ga0070666_100106022 439
73 3300005338 Ga0068868_100004660 Ga0068868_1000046603 439
74 3300005344 Ga0070661_100016008 Ga0070661_1000160083 439
75 3300005353 Ga0070669_100050854 Ga0070669_1000508542 439
76 3300005366 Ga0070659_100007111 Ga0070659_1000071113 439
77 3300005406 Ga0070703_10002370 Ga0070703_100023702 439
78 3300005457 Ga0070662_100001311 Ga0070662_10000131110 439
79 3300005459 Ga0068867_100018927 Ga0068867_1000189272 439
80 3300005535 Ga0070684_100029051 Ga0070684_1000290513 439
81 3300005544 Ga0070686_100011250 Ga0070686_1000112502 439
82 3300005545 Ga0070695_100035677 Ga0070695_1000356772 439
83 3300005548 Ga0070665_100009890 Ga0070665_1000098902 439
84 3300005564 Ga0070664_100017155 Ga0070664_1000171553 439
85 3300005577 Ga0068857_100112114 Ga0068857_1001121142 439
86 3300005616 Ga0068852_100018688 Ga0068852_1000186883 439
87 3300005617 Ga0068859_100011960 Ga0068859_1000119603 439
88 3300005618 Ga0068864_100038468 Ga0068864_1000384683 439
89 3300005834 Ga0068851_10010152 Ga0068851_100101522 439
90 3300005842 Ga0068858_100050011 Ga0068858_1000500113 439
91 3300005843 Ga0068860_100027846 Ga0068860_1000278462 439
92 3300005844 Ga0068862_100022178 Ga0068862_1000221783 439
93 3300006931 Ga0097620_100011960 Ga0097620_1000119603 439
94 3300009101 Ga0105247_10034392 Ga0105247_100343922 439
95 3300009148 Ga0105243_10069081 Ga0105243_100690812 439
96 3300009176 Ga0105242_10028250 Ga0105242_100282503 439
97 3300009177 Ga0105248_10026894 Ga0105248_100268943 439
98 3300011119 Ga0105246_10119211 Ga0105246_101192111 439
99 3300013102 Ga0157371_10003936 Ga0157371_1000393610 439
100 3300013105 Ga0157369_10028452 Ga0157369_100284524 439
101 3300013296 Ga0157374_10024896 Ga0157374_100248963 439
102 3300013306 Ga0163162_10008859 Ga0163162_100088593 439
103 3300014325 Ga0163163_10046496 Ga0163163_100464962 439
104 3300014968 Ga0157379_10031396 Ga0157379_100313963 439
105 3300025321 Ga0207656_10007524 Ga0207656_100075242 439
106 3300025903 Ga0207680_10054926 Ga0207680_100549262 439
107 3300025907 Ga0207645_10010617 Ga0207645_100106173 439
108 3300025911 Ga0207654_10018553 Ga0207654_100185532 439
109 3300025913 Ga0207695_10035323 Ga0207695_100353232 439
110 3300025914 Ga0207671_10022952 Ga0207671_100229523 439
111 3300025919 Ga0207657_10002563 Ga0207657_100025633 439
112 3300025933 Ga0207706_10000676 Ga0207706_1000067614 439
113 3300025935 Ga0207709_10015686 Ga0207709_100156863 439
114 3300025941 Ga0207711_10021120 Ga0207711_100211204 439
115 3300025942 Ga0207689_10004057 Ga0207689_100040578 439
116 3300025972 Ga0207668_10056982 Ga0207668_100569822 439
117 3300026067 Ga0207678_10000666 Ga0207678_100006663 439
118 3300026078 Ga0207702_10013784 Ga0207702_100137843 439
119 3300026089 Ga0207648_10012134 Ga0207648_100121344 439
120 3300026116 Ga0207674_10058520 Ga0207674_100585202 439
121 3300026118 Ga0207675_100032027 Ga0207675_1000320272 439
122 3300028380 Ga0268265_10021199 Ga0268265_100211992 439
123 3300028381 Ga0268264_10029558 Ga0268264_100295582 439
124 3300005547 Ga0070693_100028360 Ga0070693_1000283603 440
125 3300009093 Ga0105240_10176428 Ga0105240_101764282 440
126 3300009174 Ga0105241_10014773 Ga0105241_100147732 440
127 3300009177 Ga0105248_10014251 Ga0105248_100142514 440
128 3300013102 Ga0157371_10042869 Ga0157371_100428692 440
129 3300013296 Ga0157374_10000187 Ga0157374_1000018727 440
130 3300013297 Ga0157378_10000161 Ga0157378_1000016112 440
131 3300013307 Ga0157372_10005390 Ga0157372_100053902 440
132 3300014969 Ga0157376_10003365 Ga0157376_100033652 440
133 3300035695 Ga0373927_0018433 Ga0373927_0018433_1135_2553 440
134 3300005536 Ga0070697_100221599 Ga0070697_1002215991 442
135 3300006028 Ga0070717_10000472 Ga0070717_100004728 442
136 3300025910 Ga0207684_10082853 Ga0207684_100828532 442
137 3300009545 Ga0105237_10040485 Ga0105237_100404852 443
138 3300046472 Ga0495580_0008800 Ga0495580_0008800_2040_3449 443
139 3300007265 Ga0099794_10009809 Ga0099794_100098092 444
140 3300025906 Ga0207699_10008908 Ga0207699_100089082 445
141 3300028800 Ga0265338_10004188 Ga0265338_1000418819 446
142 3300006237 Ga0097621_100013368 Ga0097621_1000133683 447
143 3300014969 Ga0157376_10000008 Ga0157376_10000008259 447
144 3300046472 Ga0495580_0008672 Ga0495580_0008672_5117_6553 447
145 3300005536 Ga0070697_100118734 Ga0070697_1001187342 448
146 3300005841 Ga0068863_100034458 Ga0068863_1000344582 448
147 3300006173 Ga0070716_100009732 Ga0070716_1000097323 448
148 3300006237 Ga0097621_100004754 Ga0097621_1000047542 448
149 3300006358 Ga0068871_100002972 Ga0068871_1000029729 448
150 3300009174 Ga0105241_10004694 Ga0105241_100046945 448
151 3300009551 Ga0105238_10020954 Ga0105238_100209543 448
152 3300013296 Ga0157374_10028852 Ga0157374_100288523 448
153 3300013297 Ga0157378_10107199 Ga0157378_101071991 448
154 3300013306 Ga0163162_10002288 Ga0163162_100022883 448
155 3300025939 Ga0207665_10000080 Ga0207665_1000008044 448
156 3300026088 Ga0207641_10020160 Ga0207641_100201602 448
157 3300036401 Ga0373937_0064562 Ga0373937_0064562_1204_2748 448
158 3300048903 Ga0496100_0008437 Ga0496100_0008437_256_1677 448
159 3300048910 Ga0496107_0043185 Ga0496107_0043185_247_1668 448
160 3300048915 Ga0496112_0040983 Ga0496112_0040983_1612_3033 448
161 3300048918 Ga0496115_0003103 Ga0496115_0003103_3859_5280 448
162 3300053085 Ga0495619_0118663 Ga0495619_0118663_348_1769 448
163 3300014968 Ga0157379_10001683 Ga0157379_100016839 449
164 3300025911 Ga0207654_10014519 Ga0207654_100145193 449
165 3300048903 Ga0496100_0042229 Ga0496100_0042229_997_2475 449
166 3300048904 Ga0496101_0062585 Ga0496101_0062585_1076_2554 449
167 3300048905 Ga0496102_0004513 Ga0496102_0004513_1523_3001 449
168 3300048906 Ga0496103_0008179 Ga0496103_0008179_4744_6183 449
169 3300048907 Ga0496104_0172237 Ga0496104_0172237_360_1838 449
170 3300005445 Ga0070708_100000730 Ga0070708_10000073020 450
171 3300005467 Ga0070706_100002945 Ga0070706_10000294510 450
172 3300005468 Ga0070707_100003955 Ga0070707_1000039553 450
173 3300005471 Ga0070698_100000148 Ga0070698_10000014845 450
174 3300005518 Ga0070699_100067098 Ga0070699_1000670981 450
175 3300025910 Ga0207684_10002057 Ga0207684_1000205713 450
176 3300025922 Ga0207646_10001577 Ga0207646_1000157712 450
177 3300006871 Ga0075434_100046681 Ga0075434_1000466812 451
178 3300007076 Ga0075435_100011548 Ga0075435_1000115485 451
179 3300007265 Ga0099794_10027161 Ga0099794_100271612 451
180 3300025922 Ga0207646_10092553 Ga0207646_100925532 451
181 3300048913 Ga0496110_0053160 Ga0496110_0053160_140_1582 451
182 3300050513 nmdc:mga0rr50_55056_c1 nmdc:mga0rr50_55056_c1_75_1541 451
183 3300005468 Ga0070707_100052786 Ga0070707_1000527862 452
184 3300005518 Ga0070699_100006769 Ga0070699_1000067693 452
185 3300005536 Ga0070697_100000630 Ga0070697_1000006304 452
186 3300007265 Ga0099794_10000669 Ga0099794_100006692 452
187 3300013297 Ga0157378_10130450 Ga0157378_101304502 452
188 3300025906 Ga0207699_10007982 Ga0207699_100079824 452
189 3300025922 Ga0207646_10079657 Ga0207646_100796572 452
190 3300027671 Ga0209588_1001776 Ga0209588_10017763 452
191 3300009093 Ga0105240_10052964 Ga0105240_100529643 454
192 3300013105 Ga0157369_10163164 Ga0157369_101631642 454
193 3300013307 Ga0157372_10001859 Ga0157372_1000185916 454
194 3300025913 Ga0207695_10046682 Ga0207695_100466823 454
195 3300027671 Ga0209588_1002774 Ga0209588_10027742 454
196 3300028800 Ga0265338_10035922 Ga0265338_100359223 454
197 3300030878 Ga0265770_1002307 Ga0265770_10023072 454
198 3300031090 Ga0265760_10000141 Ga0265760_1000014110 454
199 3300031344 Ga0265316_10042197 Ga0265316_100421972 454
200 3300037853 Ga0436364_0831126 Ga0436364_0831126_220_1641 454
201 3300005335 Ga0070666_10018971 Ga0070666_100189712 455
202 3300005338 Ga0068868_100001052 Ga0068868_1000010528 455
203 3300005367 Ga0070667_100053799 Ga0070667_1000537992 455
204 3300005459 Ga0068867_100102443 Ga0068867_1001024432 455
205 3300005578 Ga0068854_100007433 Ga0068854_1000074333 455
206 3300005843 Ga0068860_100135103 Ga0068860_1001351032 455
207 3300006028 Ga0070717_10068647 Ga0070717_100686472 455
208 3300006028 Ga0070717_10267170 Ga0070717_102671701 455
209 3300006237 Ga0097621_100001802 Ga0097621_1000018024 455
210 3300009098 Ga0105245_10005793 Ga0105245_100057936 455
211 3300009176 Ga0105242_10046508 Ga0105242_100465082 455
212 3300013297 Ga0157378_10000353 Ga0157378_1000035328 455
213 3300013306 Ga0163162_10099282 Ga0163162_100992822 455
214 3300014969 Ga0157376_10049130 Ga0157376_100491302 455
215 3300025903 Ga0207680_10023226 Ga0207680_100232263 455
216 3300025922 Ga0207646_10071315 Ga0207646_100713152 455
217 3300025927 Ga0207687_10025104 Ga0207687_100251042 455
218 3300025981 Ga0207640_10044511 Ga0207640_100445112 455
219 3300026023 Ga0207677_10001639 Ga0207677_100016396 455
220 3300028016 Ga0265354_1002457 Ga0265354_10024572 455
221 3300028023 Ga0265357_1000346 Ga0265357_10003462 455
222 3300030878 Ga0265770_1000601 Ga0265770_10006012 455
223 3300030879 Ga0265765_1000384 Ga0265765_10003842 455
224 3300033547 Ga0316212_1000580 Ga0316212_10005802 455
225 3300035170 Ga0373943_0004997 Ga0373943_0004997_3268_4689 455
226 3300037068 Ga0373925_0024183 Ga0373925_0024183_791_2212 455
227 3300053085 Ga0495619_0129158 Ga0495619_0129158_47_1414 455
228 3300005445 Ga0070708_100002282 Ga0070708_1000022823 456
229 3300014968 Ga0157379_10006009 Ga0157379_100060093 456
230 3300005468 Ga0070707_100039468 Ga0070707_1000394682 457
231 3300014968 Ga0157379_10167571 Ga0157379_101675712 457
232 3300025914 Ga0207671_10022269 Ga0207671_100222693 457
233 3300005436 Ga0070713_100005655 Ga0070713_1000056555 458
234 3300005437 Ga0070710_10019149 Ga0070710_100191491 458
235 3300006028 Ga0070717_10007398 Ga0070717_100073983 458
236 3300025916 Ga0207663_10054423 Ga0207663_100544232 458
237 3300025928 Ga0207700_10072857 Ga0207700_100728572 458
238 3300025929 Ga0207664_10004842 Ga0207664_100048422 458
239 3300035171 Ga0373946_0002383 Ga0373946_0002383_5006_6463 458
240 3300035695 Ga0373927_0002440 Ga0373927_0002440_7598_9055 458
241 3300037068 Ga0373925_0003730 Ga0373925_0003730_6270_7727 458
242 3300046517 Ga0495630_0017481 Ga0495630_0017481_2147_3604 458
243 3300050514 nmdc:mga08x19_21384_c1 nmdc:mga08x19_21384_c1_1089_2525 458
244 3300005467 Ga0070706_100035823 Ga0070706_1000358232 459
245 3300013297 Ga0157378_10005841 Ga0157378_100058414 459
246 3300046472 Ga0495580_0014399 Ga0495580_0014399_3044_4471 459
247 3300005435 Ga0070714_100020160 Ga0070714_1000201603 460
248 3300005436 Ga0070713_100025798 Ga0070713_1000257982 460
249 3300006028 Ga0070717_10001371 Ga0070717_100013716 460
250 3300006358 Ga0068871_100029002 Ga0068871_1000290023 460
251 3300014969 Ga0157376_10000852 Ga0157376_100008527 460
252 3300025928 Ga0207700_10037500 Ga0207700_100375002 460
253 3300025929 Ga0207664_10012565 Ga0207664_100125654 460
254 3300028800 Ga0265338_10069365 Ga0265338_100693652 460
255 3300031344 Ga0265316_10004327 Ga0265316_100043275 460
256 3300037068 Ga0373925_0007729 Ga0373925_0007729_2313_3770 460
257 3300046459 Ga0495629_0015435 Ga0495629_0015435_2363_3778 460
258 3300046472 Ga0495580_0011396 Ga0495580_0011396_2593_4008 460
259 3300046475 Ga0495639_0002138 Ga0495639_0002138_1510_2925 460
260 3300046476 Ga0495662_0037673 Ga0495662_0037673_702_2117 460
261 3300046477 Ga0495664_0026856 Ga0495664_0026856_918_2333 460
262 3300046499 Ga0495594_0015281 Ga0495594_0015281_625_2040 460
263 3300046533 Ga0495640_0002276 Ga0495640_0002276_3477_4892 460
264 3300046535 Ga0495586_0010064 Ga0495586_0010064_1990_3405 460
265 3300046536 Ga0495587_0002499 Ga0495587_0002499_4440_5984 460
266 3300046681 Ga0495647_0002553 Ga0495647_0002553_1993_3408 460
267 3300046689 Ga0495613_0056299 Ga0495613_0056299_185_1600 460
268 3300047315 Ga0495581_0046568 Ga0495581_0046568_779_2194 460
269 3300047321 Ga0495676_0047424 Ga0495676_0047424_1839_3254 460
270 3300047471 Ga0495684_0047632 Ga0495684_0047632_1356_2771 460
271 3300005331 Ga0070670_100002128 Ga0070670_1000021282 461
272 3300005334 Ga0068869_100010897 Ga0068869_1000108971 461
273 3300005364 Ga0070673_100163068 Ga0070673_1001630682 461
274 3300005436 Ga0070713_100154210 Ga0070713_1001542102 461
275 3300005459 Ga0068867_100022678 Ga0068867_1000226782 461
276 3300005549 Ga0070704_100042863 Ga0070704_1000428632 461
277 3300005563 Ga0068855_100005150 Ga0068855_10000515015 461
278 3300005564 Ga0070664_100001802 Ga0070664_10000180211 461
279 3300005577 Ga0068857_100068151 Ga0068857_1000681512 461
280 3300005614 Ga0068856_100000436 Ga0068856_10000043622 461
281 3300005616 Ga0068852_100132522 Ga0068852_1001325222 461
282 3300005617 Ga0068859_100047598 Ga0068859_1000475983 461
283 3300005618 Ga0068864_100006672 Ga0068864_1000066724 461
284 3300005718 Ga0068866_10065874 Ga0068866_100658742 461
285 3300005840 Ga0068870_10029163 Ga0068870_100291632 461
286 3300005842 Ga0068858_100005368 Ga0068858_1000053686 461
287 3300005843 Ga0068860_100059154 Ga0068860_1000591542 461
288 3300006237 Ga0097621_100000183 Ga0097621_10000018321 461
289 3300006358 Ga0068871_100007289 Ga0068871_1000072893 461
290 3300006914 Ga0075436_100006574 Ga0075436_1000065744 461
291 3300006914 Ga0075436_100014415 Ga0075436_1000144153 461
292 3300006931 Ga0097620_100047598 Ga0097620_1000475982 461
293 3300009177 Ga0105248_10047499 Ga0105248_100474993 461
294 3300009177 Ga0105248_10056239 Ga0105248_100562392 461
295 3300013296 Ga0157374_10007069 Ga0157374_100070692 461
296 3300013297 Ga0157378_10000181 Ga0157378_1000018110 461
297 3300013297 Ga0157378_10000739 Ga0157378_100007397 461
298 3300013307 Ga0157372_10008201 Ga0157372_100082012 461
299 3300025904 Ga0207647_10012828 Ga0207647_100128283 461
300 3300025908 Ga0207643_10035523 Ga0207643_100355232 461
301 3300025911 Ga0207654_10034960 Ga0207654_100349601 461
302 3300025913 Ga0207695_10127400 Ga0207695_101274002 461
303 3300025920 Ga0207649_10053224 Ga0207649_100532242 461
304 3300025925 Ga0207650_10009443 Ga0207650_100094433 461
305 3300025933 Ga0207706_10192365 Ga0207706_101923652 461
306 3300025939 Ga0207665_10056305 Ga0207665_100563052 461
307 3300025941 Ga0207711_10018376 Ga0207711_100183764 461
308 3300025945 Ga0207679_10053668 Ga0207679_100536682 461
309 3300025949 Ga0207667_10000694 Ga0207667_1000069415 461
310 3300025949 Ga0207667_10022433 Ga0207667_100224333 461
311 3300025981 Ga0207640_10001398 Ga0207640_100013984 461
312 3300026023 Ga0207677_10002373 Ga0207677_100023733 461
313 3300026035 Ga0207703_10003415 Ga0207703_100034153 461
314 3300026041 Ga0207639_10141830 Ga0207639_101418302 461
315 3300026078 Ga0207702_10000657 Ga0207702_100006573 461
316 3300026078 Ga0207702_10009897 Ga0207702_100098973 461
317 3300026089 Ga0207648_10019307 Ga0207648_100193073 461
318 3300026095 Ga0207676_10004714 Ga0207676_100047142 461
319 3300026116 Ga0207674_10000905 Ga0207674_100009058 461
320 3300028381 Ga0268264_10042130 Ga0268264_100421302 461
321 3300028381 Ga0268264_10125159 Ga0268264_101251592 461
322 3300031711 Ga0265314_10032002 Ga0265314_100320023 461
323 3300035691 Ga0373931_0016020 Ga0373931_0016020_1580_3073 461
324 3300048915 Ga0496112_0068355 Ga0496112_0068355_1867_3327 461
325 3300048918 Ga0496115_0004025 Ga0496115_0004025_7336_8751 461
326 3300050514 nmdc:mga08x19_4630_c1 nmdc:mga08x19_4630_c1_1686_3101 461
327 3300050514 nmdc:mga08x19_6770_c1 nmdc:mga08x19_6770_c1_81_1586 461
328 3300005548 Ga0070665_100002088 Ga0070665_1000020883 462
329 3300028379 Ga0268266_10000227 Ga0268266_1000022717 462
330 3300006914 Ga0075436_100007607 Ga0075436_1000076072 463
331 3300009093 Ga0105240_10022678 Ga0105240_100226784 463
332 3300013296 Ga0157374_10017621 Ga0157374_100176213 463
333 3300025913 Ga0207695_10070215 Ga0207695_100702151 463
334 3300048915 Ga0496112_0083892 Ga0496112_0083892_1062_2498 463
335 3300050514 nmdc:mga08x19_12310_c1 nmdc:mga08x19_12310_c1_3412_4848 463
336 3300005434 Ga0070709_10080158 Ga0070709_100801582 465
337 3300005467 Ga0070706_100114165 Ga0070706_1001141652 465
338 3300005547 Ga0070693_100010569 Ga0070693_1000105693 465
339 3300007788 Ga0099795_10021510 Ga0099795_100215102 465
340 3300005536 Ga0070697_100062341 Ga0070697_1000623412 466
341 3300006914 Ga0075436_100011669 Ga0075436_1000116693 467
342 3300024227 Ga0228598_1001070 Ga0228598_10010702 467
343 3300050514 nmdc:mga08x19_242_c1 nmdc:mga08x19_242_c1_18321_19745 467
344 3300035118 Ga0373954_0036245 Ga0373954_0036245_69_1520 468
345 3300035119 Ga0373956_0005475 Ga0373956_0005475_2956_4407 468
346 3300035724 Ga0373933_0028200 Ga0373933_0028200_1710_3119 468
347 3300036401 Ga0373937_0000555 Ga0373937_0000555_11037_12446 468
348 3300046463 Ga0495653_0125873 Ga0495653_0125873_77_1486 468
349 3300047444 Ga0495675_0003992 Ga0495675_0003992_2797_4206 468
350 3300048088 Ga0495602_0001204 Ga0495602_0001204_14355_15764 468
351 3300005434 Ga0070709_10026558 Ga0070709_100265583 469
352 3300005437 Ga0070710_10012414 Ga0070710_100124142 469
353 3300005437 Ga0070710_10070205 Ga0070710_100702052 469
354 3300005468 Ga0070707_100023194 Ga0070707_1000231942 469
355 3300005471 Ga0070698_100136062 Ga0070698_1001360621 469
356 3300005518 Ga0070699_100031914 Ga0070699_1000319142 469
357 3300006163 Ga0070715_10009345 Ga0070715_100093452 469
358 3300006163 Ga0070715_10012060 Ga0070715_100120602 469
359 3300006173 Ga0070716_100000300 Ga0070716_1000003004 469
360 3300006173 Ga0070716_100013266 Ga0070716_1000132663 469
361 3300006175 Ga0070712_100006280 Ga0070712_1000062803 469
362 3300006175 Ga0070712_100009576 Ga0070712_1000095764 469
363 3300025905 Ga0207685_10006871 Ga0207685_100068712 469
364 3300025906 Ga0207699_10033284 Ga0207699_100332842 469
365 3300025915 Ga0207693_10001184 Ga0207693_1000118413 469
366 3300025915 Ga0207693_10003013 Ga0207693_1000301314 469
367 3300025915 Ga0207693_10016219 Ga0207693_100162192 469
368 3300025922 Ga0207646_10005589 Ga0207646_100055892 469
369 3300025939 Ga0207665_10000049 Ga0207665_1000004936 469
370 3300025939 Ga0207665_10005337 Ga0207665_100053373 469
371 3300027512 Ga0209179_1009170 Ga0209179_10091702 469
372 3300006028 Ga0070717_10014331 Ga0070717_100143312 470
373 3300006914 Ga0075436_100143371 Ga0075436_1001433712 470
374 3300048905 Ga0496102_0019020 Ga0496102_0019020_4123_5562 470
375 3300048906 Ga0496103_0008280 Ga0496103_0008280_1971_3410 470
376 3300005468 Ga0070707_100059365 Ga0070707_1000593653 471
377 3300014325 Ga0163163_10060798 Ga0163163_100607982 471
378 3300046684 Ga0495669_0048049 Ga0495669_0048049_388_1803 471
379 3300049744 Ga0501083_0064688 Ga0501083_0064688_424_1887 471
380 3300005445 Ga0070708_100087578 Ga0070708_1000875782 472
381 3300024227 Ga0228598_1001796 Ga0228598_10017962 472
382 3300025915 Ga0207693_10007281 Ga0207693_100072813 472
383 3300009174 Ga0105241_10024601 Ga0105241_100246012 473
384 3300025911 Ga0207654_10023554 Ga0207654_100235543 473
385 3300021384 Ga0213876_10036462 Ga0213876_100364622 474
386 3300039437 Ga0436365_0942396 Ga0436365_0942396_4252_5700 474
387 3300005334 Ga0068869_100025905 Ga0068869_1000259053 475
388 3300005436 Ga0070713_100043608 Ga0070713_1000436082 475
389 3300005439 Ga0070711_100011852 Ga0070711_1000118524 475
390 3300005445 Ga0070708_100257672 Ga0070708_1002576721 475
391 3300005518 Ga0070699_100161157 Ga0070699_1001611571 475
392 3300005546 Ga0070696_100121466 Ga0070696_1001214662 475
393 3300025916 Ga0207663_10039944 Ga0207663_100399442 475
394 3300025928 Ga0207700_10058095 Ga0207700_100580952 475
395 3300025942 Ga0207689_10027907 Ga0207689_100279073 475
396 3300036401 Ga0373937_0255139 Ga0373937_0255139_140_1582 475
397 3300046516 Ga0495628_0004325 Ga0495628_0004325_1275_2732 475
398 3300014325 Ga0163163_10106682 Ga0163163_101066822 477
399 3300005327 Ga0070658_10026272 Ga0070658_100262723 478
400 3300005329 Ga0070683_100119095 Ga0070683_1001190951 478
401 3300005334 Ga0068869_100031928 Ga0068869_1000319283 478
402 3300005344 Ga0070661_100015954 Ga0070661_1000159543 478
403 3300005355 Ga0070671_100024078 Ga0070671_1000240783 478
404 3300005366 Ga0070659_100015344 Ga0070659_1000153442 478
405 3300005458 Ga0070681_10161405 Ga0070681_101614052 478
406 3300005518 Ga0070699_100116533 Ga0070699_1001165332 478
407 3300005535 Ga0070684_100072169 Ga0070684_1000721692 478
408 3300005564 Ga0070664_100030028 Ga0070664_1000300282 478
409 3300005577 Ga0068857_100182827 Ga0068857_1001828272 478
410 3300005616 Ga0068852_100096151 Ga0068852_1000961512 478
411 3300005617 Ga0068859_100035120 Ga0068859_1000351202 478
412 3300005618 Ga0068864_100051749 Ga0068864_1000517492 478
413 3300005842 Ga0068858_100001669 Ga0068858_10000166913 478
414 3300006237 Ga0097621_100101683 Ga0097621_1001016832 478
415 3300006931 Ga0097620_100035120 Ga0097620_1000351203 478
416 3300009093 Ga0105240_10055244 Ga0105240_100552442 478
417 3300009098 Ga0105245_10053219 Ga0105245_100532192 478
418 3300009177 Ga0105248_10010896 Ga0105248_100108963 478
419 3300009545 Ga0105237_10050004 Ga0105237_100500043 478
420 3300009551 Ga0105238_10007499 Ga0105238_100074993 478
421 3300010375 Ga0105239_10008576 Ga0105239_100085763 478
422 3300010375 Ga0105239_10047148 Ga0105239_100471483 478
423 3300013100 Ga0157373_10006176 Ga0157373_100061763 478
424 3300013102 Ga0157371_10158772 Ga0157371_101587721 478
425 3300013105 Ga0157369_10154202 Ga0157369_101542022 478
426 3300013307 Ga0157372_10006207 Ga0157372_100062075 478
427 3300014325 Ga0163163_10012039 Ga0163163_100120394 478
428 3300014968 Ga0157379_10023305 Ga0157379_100233053 478
429 3300025904 Ga0207647_10008969 Ga0207647_100089693 478
430 3300025914 Ga0207671_10045342 Ga0207671_100453422 478
431 3300025919 Ga0207657_10002016 Ga0207657_100020164 478
432 3300025933 Ga0207706_10016843 Ga0207706_100168432 478
433 3300025942 Ga0207689_10010914 Ga0207689_100109143 478
434 3300025944 Ga0207661_10222751 Ga0207661_102227511 478
435 3300026023 Ga0207677_10010595 Ga0207677_100105952 478
436 3300026035 Ga0207703_10213856 Ga0207703_102138562 478
437 3300026041 Ga0207639_10039043 Ga0207639_100390432 478
438 3300026089 Ga0207648_10022125 Ga0207648_100221253 478
439 3300030760 Ga0265762_1000325 Ga0265762_10003254 478
440 3300048905 Ga0496102_0100259 Ga0496102_0100259_472_1908 478
441 3300048910 Ga0496107_0062791 Ga0496107_0062791_454_1890 478
442 3300048913 Ga0496110_0204277 Ga0496110_0204277_104_1540 478
443 3300048915 Ga0496112_0015045 Ga0496112_0015045_5543_6997 478
444 3300048915 Ga0496112_0095150 Ga0496112_0095150_1088_2524 478
445 3300005435 Ga0070714_100042455 Ga0070714_1000424553 479
446 3300002239 JGI24034J26672_10002304 JGI24034J26672_100023041 481
447 3300005328 Ga0070676_10031597 Ga0070676_100315972 481
448 3300005329 Ga0070683_100001410 Ga0070683_10000141013 481
449 3300005330 Ga0070690_100007305 Ga0070690_1000073053 481
450 3300005331 Ga0070670_100016498 Ga0070670_1000164983 481
451 3300005335 Ga0070666_10024702 Ga0070666_100247022 481
452 3300005343 Ga0070687_100009776 Ga0070687_1000097762 481
453 3300005344 Ga0070661_100022947 Ga0070661_1000229472 481
454 3300005347 Ga0070668_100001619 Ga0070668_1000016192 481
455 3300005353 Ga0070669_100050826 Ga0070669_1000508262 481
456 3300005356 Ga0070674_100030624 Ga0070674_1000306242 481
457 3300005365 Ga0070688_100006942 Ga0070688_1000069423 481
458 3300005459 Ga0068867_100017340 Ga0068867_1000173402 481
459 3300005535 Ga0070684_100040018 Ga0070684_1000400183 481
460 3300005546 Ga0070696_100158675 Ga0070696_1001586751 481
461 3300005563 Ga0068855_100055914 Ga0068855_1000559142 481
462 3300005615 Ga0070702_100019038 Ga0070702_1000190382 481
463 3300005616 Ga0068852_100026397 Ga0068852_1000263972 481
464 3300005840 Ga0068870_10010366 Ga0068870_100103663 481
465 3300009011 Ga0105251_10055370 Ga0105251_100553701 481
466 3300009098 Ga0105245_10077715 Ga0105245_100777152 481
467 3300009174 Ga0105241_10026134 Ga0105241_100261343 481
468 3300009176 Ga0105242_10032960 Ga0105242_100329602 481
469 3300009177 Ga0105248_10114221 Ga0105248_101142212 481
470 3300009545 Ga0105237_10034900 Ga0105237_100349001 481
471 3300009553 Ga0105249_10013641 Ga0105249_100136413 481
472 3300013100 Ga0157373_10034470 Ga0157373_100344702 481
473 3300013102 Ga0157371_10013553 Ga0157371_100135533 481
474 3300013105 Ga0157369_10044245 Ga0157369_100442452 481
475 3300013307 Ga0157372_10066198 Ga0157372_100661982 481
476 3300013308 Ga0157375_10098527 Ga0157375_100985272 481
477 3300014325 Ga0163163_10001664 Ga0163163_1000166412 481
478 3300014326 Ga0157380_10096094 Ga0157380_100960942 481
479 3300014745 Ga0157377_10001157 Ga0157377_100011575 481
480 3300014969 Ga0157376_10036361 Ga0157376_100363613 481
481 3300025315 Ga0207697_10031844 Ga0207697_100318442 481
482 3300025899 Ga0207642_10006892 Ga0207642_100068922 481
483 3300025904 Ga0207647_10007769 Ga0207647_100077693 481
484 3300025907 Ga0207645_10000330 Ga0207645_100003302 481
485 3300025908 Ga0207643_10000975 Ga0207643_100009753 481
486 3300025918 Ga0207662_10007683 Ga0207662_100076833 481
487 3300025919 Ga0207657_10000458 Ga0207657_1000045835 481
488 3300025920 Ga0207649_10002595 Ga0207649_100025957 481
489 3300025923 Ga0207681_10039151 Ga0207681_100391512 481
490 3300025925 Ga0207650_10000058 Ga0207650_1000005860 481
491 3300025926 Ga0207659_10014384 Ga0207659_100143842 481
492 3300025927 Ga0207687_10025467 Ga0207687_100254672 481
493 3300025931 Ga0207644_10013643 Ga0207644_100136433 481
494 3300025933 Ga0207706_10000245 Ga0207706_1000024546 481
495 3300025934 Ga0207686_10012288 Ga0207686_100122883 481
496 3300025936 Ga0207670_10007488 Ga0207670_100074883 481
497 3300025937 Ga0207669_10033410 Ga0207669_100334102 481
498 3300025940 Ga0207691_10031536 Ga0207691_100315362 481
499 3300025942 Ga0207689_10000734 Ga0207689_100007343 481
500 3300025944 Ga0207661_10000551 Ga0207661_100005514 481
501 3300025945 Ga0207679_10000170 Ga0207679_1000017023 481
502 3300025949 Ga0207667_10088311 Ga0207667_100883112 481
503 3300025960 Ga0207651_10017392 Ga0207651_100173922 481
504 3300025961 Ga0207712_10076207 Ga0207712_100762072 481
505 3300025981 Ga0207640_10037304 Ga0207640_100373042 481
506 3300026023 Ga0207677_10052811 Ga0207677_100528112 481
507 3300026067 Ga0207678_10005878 Ga0207678_100058782 481
508 3300026075 Ga0207708_10077133 Ga0207708_100771331 481
509 3300026088 Ga0207641_10000323 Ga0207641_100003237 481
510 3300026089 Ga0207648_10001360 Ga0207648_100013602 481
511 3300026095 Ga0207676_10000163 Ga0207676_1000016344 481
512 3300026116 Ga0207674_10000164 Ga0207674_1000016442 481
513 3300026121 Ga0207683_10006145 Ga0207683_100061453 481
514 3300026142 Ga0207698_10052865 Ga0207698_100528652 481
515 3300028379 Ga0268266_10046087 Ga0268266_100460872 481
516 3300028380 Ga0268265_10031505 Ga0268265_100315053 481
517 3300028381 Ga0268264_10030611 Ga0268264_100306113 481
518 3300048905 Ga0496102_0041183 Ga0496102_0041183_167_1612 481
519 3300048911 Ga0496108_0010617 Ga0496108_0010617_2402_3847 481
520 3300048912 Ga0496109_0000169 Ga0496109_0000169_55693_57138 481
521 3300048913 Ga0496110_0001005 Ga0496110_0001005_3839_5284 481
522 3300048914 Ga0496111_0022660 Ga0496111_0022660_1368_2813 481
523 3300048915 Ga0496112_0000060 Ga0496112_0000060_52215_53660 481
524 3300048916 Ga0496113_0000553 Ga0496113_0000553_224_1669 481

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13520

AA_permease_2

Amino acid permease

26

502

0.85

PF00324

AA_permease

Amino acid permease

42

510

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4djk-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.8598 16 460
4dji-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.8514 14 460
4dji-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.8478 16 460
4djk-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.8396 16 464
4djk-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.8296 16 460
ID Description Score Start End Superfamily
af_P63235_7_481_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9078 19 460 1.20.1740.10
af_P39282_4_494_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.882 15 460 1.20.1740.10
af_P42590_4_465_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8781 13 457 1.20.1740.10
af_P75835_4_476_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8737 13 463 1.20.1740.10
af_P63235_7_481_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8466 19 460 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2V9DJ03-F1-model_v4 Amino acid permease 0.9582 1 464 GO:0005886
GO:0022857
AF-A0A2V9TW08-F1-model_v4 Amino acid permease 0.9568 1 475 GO:0005886
GO:0022857
AF-A0A2V9GU99-F1-model_v4 Amino acid permease 0.9511 1 470 GO:0005886
GO:0022857
AF-A0A1Q7ZAR3-F1-model_v4 Amino acid permease 0.9417 12 462 GO:0005886
GO:0022857
AF-A0A2V9TW08-F1-model_v4 Amino acid permease 0.9412 1 475 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
81.07 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map