F458675

General Info

Members Datasets Scaffolds Average Seq Length
521 235 1042 119

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10132328|Ga0075367_101323282
Length 135
Sequence MGAVASFPLEHMGKNTTATSKQLDLVRGTLDVLILKALAWGSLHGYAITSLIHRQTGGALLVEEGTLYPALWRLEGKDLVAAEWGLSENNRKAKFYRLTPQGRRHLRDETRTWETYASAVNKMLQATQPPAPEEL

Samples

Sample ID Description Type Environment
1 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
81 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
82 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
83 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 1.92
Rhizosphere 95.78
Stem 0
Stem Tuber 0
Unclassified 33.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075367_10132328 3300006178 Bacteria 1542
2 JGI24743J22301_10009095 3300001991 Unclassified 1754
3 rootH2_10090347 3300003320 Bacteria 2596
4 rootH2_10151147 3300003320 Bacteria 5208
5 rootL2_10311386 3300003322 Bacteria 1253
6 Ga0070658_10018879 3300005327 Bacteria 5524
7 Ga0070658_10060067 3300005327 Bacteria 3095
8 Ga0070658_10322983 3300005327 Bacteria 1318
9 Ga0070683_100000253 3300005329 Bacteria 36681
10 Ga0070683_100174918 3300005329 Unclassified 2038
11 Ga0070670_100018762 3300005331 Bacteria 5932
12 Ga0068869_100000836 3300005334 Bacteria 17592
13 Ga0070666_10445495 3300005335 Bacteria 935
14 Ga0070680_101583651 3300005336 Unclassified 568
15 Ga0070682_100604748 3300005337 Unclassified 866
16 Ga0068868_100000485 3300005338 Bacteria 26433
17 Ga0068868_100074210 3300005338 Bacteria 2716
18 Ga0068868_101867758 3300005338 Unclassified 568
19 Ga0070660_101382890 3300005339 Bacteria 598
20 Ga0070661_100027815 3300005344 Unclassified 4075
21 Ga0070661_100995036 3300005344 Unclassified 695
22 Ga0070675_100358574 3300005354 Bacteria 1294
23 Ga0070675_100638411 3300005354 Unclassified 967
24 Ga0070671_100001876 3300005355 Bacteria 16074
25 Ga0070674_100729451 3300005356 Unclassified 850
26 Ga0070659_100801342 3300005366 Bacteria 819
27 Ga0070667_100000402 3300005367 Bacteria 46841
28 Ga0070667_101180991 3300005367 Unclassified 716
29 Ga0070709_10025141 3300005434 Bacteria 3515
30 Ga0070709_10034042 3300005434 Bacteria 3086
31 Ga0070709_10938653 3300005434 Unclassified 686
32 Ga0070714_100026842 3300005435 Bacteria 4762
33 Ga0070714_100115367 3300005435 Unclassified 2384
34 Ga0070714_100193381 3300005435 Unclassified 1858
35 Ga0070714_100474744 3300005435 Unclassified 1190
36 Ga0070714_100531715 3300005435 Unclassified 1124
37 Ga0070713_100039458 3300005436 Bacteria 3832
38 Ga0070713_100147747 3300005436 Unclassified 2088
39 Ga0070713_100365536 3300005436 Unclassified 1341
40 Ga0070713_101057049 3300005436 Unclassified 784
41 Ga0070711_100029160 3300005439 Plasmid 3639
42 Ga0070711_100036695 3300005439 Bacteria 3285
43 Ga0070708_100205462 3300005445 Bacteria 1845
44 Ga0070663_101349966 3300005455 Unclassified 630
45 Ga0070678_101008518 3300005456 Bacteria 765
46 Ga0070678_101594106 3300005456 Unclassified 613
47 Ga0070662_101964343 3300005457 Unclassified 505
48 Ga0070681_10058973 3300005458 Bacteria 3818
49 Ga0070681_10494367 3300005458 Unclassified 1136
50 Ga0070681_10568754 3300005458 Bacteria 1047
51 Ga0070681_10777371 3300005458 Bacteria 874
52 Ga0070706_100621596 3300005467 Bacteria 1003
53 Ga0070679_100000802 3300005530 Bacteria 27244
54 Ga0070679_100177157 3300005530 Unclassified 2105
55 Ga0070679_101273233 3300005530 Unclassified 681
56 Ga0070684_100000419 3300005535 Bacteria 29131
57 Ga0070684_100229011 3300005535 Bacteria 1697
58 Ga0070684_100479717 3300005535 Bacteria 1151
59 Ga0070665_100265469 3300005548 Bacteria 1718
60 Ga0068855_100171375 3300005563 Unclassified 2458
61 Ga0068855_100442257 3300005563 Bacteria 1420
62 Ga0070664_100122591 3300005564 Bacteria 2277
63 Ga0070664_102207133 3300005564 Unclassified 522
64 Ga0068857_100001475 3300005577 Bacteria 18714
65 Ga0068857_101228930 3300005577 Unclassified 726
66 Ga0068856_100003283 3300005614 Bacteria 16441
67 Ga0068856_100010220 3300005614 Bacteria 9125
68 Ga0068856_100649056 3300005614 Bacteria 1076
69 Ga0068856_101628837 3300005614 Unclassified 658
70 Ga0068852_100035274 3300005616 Bacteria 4171
71 Ga0068852_100037445 3300005616 Unclassified 4067
72 Ga0068852_102595180 3300005616 Unclassified 526
73 Ga0068859_100027546 3300005617 Bacteria 5700
74 Ga0068859_101808326 3300005617 Unclassified 675
75 Ga0068859_102110290 3300005617 Unclassified 622
76 Ga0068859_102606407 3300005617 Unclassified 556
77 Ga0068864_100000819 3300005618 Bacteria 26167
78 Ga0068864_100981173 3300005618 Unclassified 837
79 Ga0068866_10726262 3300005718 Unclassified 684
80 Ga0068851_10008103 3300005834 Bacteria 4849
81 Ga0068851_10020815 3300005834 Bacteria 3180
82 Ga0068863_100001642 3300005841 Bacteria 22126
83 Ga0068863_100045467 3300005841 Bacteria 4167
84 Ga0068858_100000905 3300005842 Bacteria 30763
85 Ga0068860_100002128 3300005843 Bacteria 20891
86 Ga0068862_100048626 3300005844 Unclassified 3621
87 Ga0070717_10000123 3300006028 Bacteria 58874
88 Ga0070717_10025247 3300006028 Bacteria 4724
89 Ga0070717_10162252 3300006028 Bacteria 1939
90 Ga0070717_10371289 3300006028 Bacteria 1282
91 Ga0070717_10403472 3300006028 Unclassified 1228
92 Ga0070717_10431435 3300006028 Unclassified 1186
93 Ga0070715_10153682 3300006163 Bacteria 1130
94 Ga0070716_100110887 3300006173 Bacteria 1700
95 Ga0070716_100766175 3300006173 Unclassified 744
96 Ga0070712_100005937 3300006175 Bacteria 7549
97 Ga0070712_100006262 3300006175 Bacteria 7371
98 Ga0097621_100001823 3300006237 Bacteria 14607
99 Ga0097621_100106634 3300006237 Bacteria 2364
100 Ga0097621_100663226 3300006237 Bacteria 958
101 Ga0068871_100000365 3300006358 Bacteria 31531
102 Ga0068871_100138209 3300006358 Bacteria 2070
103 Ga0068871_100241300 3300006358 Unclassified 1571
104 Ga0068871_101334442 3300006358 Unclassified 675
105 Ga0068865_101020514 3300006881 Bacteria 725
106 Ga0075436_100009091 3300006914 Bacteria 6800
107 Ga0097620_100027545 3300006931 Bacteria 5700
108 Ga0097620_101808008 3300006931 Unclassified 675
109 Ga0097620_102109925 3300006931 Unclassified 622
110 Ga0097620_102607009 3300006931 Unclassified 556
111 Ga0105240_10000458 3300009093 Bacteria 75168
112 Ga0105240_10005112 3300009093 Bacteria 19636
113 Ga0105240_10026188 3300009093 Bacteria 7652
114 Ga0105240_10507714 3300009093 Unclassified 1340
115 Ga0105240_11716034 3300009093 Bacteria 655
116 Ga0105245_10000763 3300009098 Bacteria 29108
117 Ga0105245_10038707 3300009098 Bacteria 4243
118 Ga0105245_10520610 3300009098 Unclassified 1208
119 Ga0105245_13167538 3300009098 Unclassified 510
120 Ga0105247_10003695 3300009101 Bacteria 9931
121 Ga0105247_10306560 3300009101 Unclassified 1103
122 Ga0105243_10078369 3300009148 Bacteria 2690
123 Ga0105241_10000848 3300009174 Bacteria 23164
124 Ga0105241_10136662 3300009174 Bacteria 1991
125 Ga0105241_10935614 3300009174 Unclassified 807
126 Ga0105241_11148064 3300009174 Unclassified 733
127 Ga0105242_11573675 3300009176 Unclassified 690
128 Ga0105242_12258107 3300009176 Unclassified 590
129 Ga0105248_10007758 3300009177 Bacteria 11781
130 Ga0105248_10416840 3300009177 Bacteria 1512
131 Ga0105248_11159255 3300009177 Unclassified 874
132 Ga0105237_10010752 3300009545 Bacteria 9711
133 Ga0105237_10027650 3300009545 Bacteria 5785
134 Ga0105237_10197497 3300009545 Bacteria 2011
135 Ga0105237_10457586 3300009545 Bacteria 1282
136 Ga0105237_11079954 3300009545 Bacteria 809
137 Ga0105237_11127531 3300009545 Unclassified 791
138 Ga0105238_10010445 3300009551 Bacteria 9319
139 Ga0105238_10015800 3300009551 Bacteria 7641
140 Ga0105238_10198484 3300009551 Bacteria 1982
141 Ga0105249_10035248 3300009553 Unclassified 4537
142 Ga0105239_10173121 3300010375 Bacteria 2414
143 Ga0105239_10184475 3300010375 Unclassified 2335
144 Ga0105239_10832521 3300010375 Bacteria 1058
145 Ga0105239_13293921 3300010375 Bacteria 526
146 Ga0105246_10005617 3300011119 Bacteria 7647
147 Ga0105246_10253961 3300011119 Unclassified 1397
148 Ga0157371_10137900 3300013102 Bacteria 1737
149 Ga0157370_10471628 3300013104 Unclassified 1153
150 Ga0157370_10978810 3300013104 Unclassified 766
151 Ga0157369_10003156 3300013105 Bacteria 19674
152 Ga0157369_10013389 3300013105 Bacteria 9277
153 Ga0157369_10032134 3300013105 Bacteria 5772
154 Ga0157369_10061781 3300013105 Unclassified 4038
155 Ga0157369_10313928 3300013105 Bacteria 1630
156 Ga0157369_10524921 3300013105 Bacteria 1225
157 Ga0157369_10951772 3300013105 Bacteria 880
158 Ga0157369_11677340 3300013105 Bacteria 646
159 Ga0157374_10017585 3300013296 Bacteria 6296
160 Ga0157374_10049279 3300013296 Unclassified 3912
161 Ga0157374_10064308 3300013296 Unclassified 3442
162 Ga0157374_10085485 3300013296 Bacteria 3000
163 Ga0157374_10092048 3300013296 Bacteria 2892
164 Ga0157374_10237063 3300013296 Bacteria 1793
165 Ga0157374_12082142 3300013296 Unclassified 594
166 Ga0157374_12397132 3300013296 Unclassified 555
167 Ga0157378_10053213 3300013297 Bacteria 3605
168 Ga0157378_10058298 3300013297 Bacteria 3443
169 Ga0157378_10071407 3300013297 Unclassified 3118
170 Ga0157378_10208041 3300013297 Unclassified 1854
171 Ga0157378_10787245 3300013297 Unclassified 976
172 Ga0163162_10068250 3300013306 Bacteria 3607
173 Ga0157372_10133004 3300013307 Bacteria 2863
174 Ga0157372_10169111 3300013307 Bacteria 2529
175 Ga0157372_10187568 3300013307 Bacteria 2395
176 Ga0157372_10403780 3300013307 Unclassified 1592
177 Ga0157372_10447910 3300013307 Bacteria 1505
178 Ga0157372_10995700 3300013307 Bacteria 971
179 Ga0157372_11228876 3300013307 Unclassified 865
180 Ga0157375_10007882 3300013308 Bacteria 9320
181 Ga0157375_11121932 3300013308 Unclassified 921
182 Ga0157375_11257077 3300013308 Bacteria 869
183 Ga0157375_11476995 3300013308 Unclassified 802
184 Ga0163163_10006655 3300014325 Bacteria 10125
185 Ga0163163_10112747 3300014325 Bacteria 2749
186 Ga0163163_10260572 3300014325 Unclassified 1785
187 Ga0157377_10603364 3300014745 Unclassified 783
188 Ga0157379_10000389 3300014968 Bacteria 35596
189 Ga0157379_10088489 3300014968 Bacteria 2777
190 Ga0157379_10316029 3300014968 Unclassified 1425
191 Ga0157376_10001089 3300014969 Bacteria 17793
192 Ga0157376_10001119 3300014969 Bacteria 17598
193 Ga0157376_10048483 3300014969 Bacteria 3512
194 Ga0157376_10051754 3300014969 Unclassified 3412
195 Ga0157376_11038650 3300014969 Unclassified 843
196 Ga0163161_10409611 3300017792 Unclassified 1089
197 Ga0224570_100995 3300022730 Bacteria 2231
198 Ga0224569_102012 3300022732 Bacteria 1675
199 Ga0224572_1037251 3300024225 Bacteria 920
200 Ga0228598_1001375 3300024227 Bacteria 5346
201 Ga0207656_10003478 3300025321 Bacteria 5418
202 Ga0207656_10034946 3300025321 Bacteria 2101
203 Ga0207692_10890457 3300025898 Bacteria 585
204 Ga0207710_10000705 3300025900 Bacteria 18745
205 Ga0207680_10435336 3300025903 Bacteria 930
206 Ga0207647_10333310 3300025904 Bacteria 861
207 Ga0207685_10337134 3300025905 Bacteria 756
208 Ga0207699_10042141 3300025906 Bacteria 2642
209 Ga0207699_10060055 3300025906 Bacteria 2281
210 Ga0207699_10143250 3300025906 Bacteria 1573
211 Ga0207699_10377699 3300025906 Unclassified 1005
212 Ga0207705_10067199 3300025909 Bacteria 2594
213 Ga0207705_10372374 3300025909 Unclassified 1102
214 Ga0207684_10032093 3300025910 Bacteria 4467
215 Ga0207684_11122687 3300025910 Bacteria 654
216 Ga0207654_10018855 3300025911 Unclassified 3628
217 Ga0207654_10968655 3300025911 Unclassified 618
218 Ga0207707_10097935 3300025912 Bacteria 2563
219 Ga0207707_10802587 3300025912 Unclassified 784
220 Ga0207695_10000611 3300025913 Bacteria 71758
221 Ga0207695_10001863 3300025913 Bacteria 33031
222 Ga0207695_10025386 3300025913 Bacteria 6634
223 Ga0207695_10062304 3300025913 Bacteria 3851
224 Ga0207695_10110907 3300025913 Bacteria 2723
225 Ga0207671_10000326 3300025914 Bacteria 69730
226 Ga0207671_10136907 3300025914 Bacteria 1883
227 Ga0207671_10252739 3300025914 Unclassified 1386
228 Ga0207671_10292762 3300025914 Bacteria 1285
229 Ga0207693_10000609 3300025915 Bacteria 32010
230 Ga0207663_10051369 3300025916 Bacteria 2566
231 Ga0207663_10157698 3300025916 Unclassified 1598
232 Ga0207663_10876066 3300025916 Unclassified 717
233 Ga0207660_10101378 3300025917 Unclassified 2151
234 Ga0207649_10025197 3300025920 Unclassified 3466
235 Ga0207649_10035190 3300025920 Bacteria 3008
236 Ga0207652_10011194 3300025921 Bacteria 7228
237 Ga0207652_10205370 3300025921 Unclassified 1773
238 Ga0207652_11222758 3300025921 Unclassified 653
239 Ga0207694_10000456 3300025924 Bacteria 38055
240 Ga0207694_10052479 3300025924 Bacteria 3161
241 Ga0207694_11190472 3300025924 Unclassified 645
242 Ga0207650_10174063 3300025925 Bacteria 1712
243 Ga0207659_10432667 3300025926 Unclassified 1105
244 Ga0207687_10013070 3300025927 Bacteria 5425
245 Ga0207687_10088423 3300025927 Bacteria 2254
246 Ga0207687_10802557 3300025927 Bacteria 803
247 Ga0207700_10004486 3300025928 Bacteria 8238
248 Ga0207700_10017920 3300025928 Bacteria 4741
249 Ga0207700_10530376 3300025928 Unclassified 1044
250 Ga0207700_10761357 3300025928 Unclassified 865
251 Ga0207700_10891542 3300025928 Unclassified 796
252 Ga0207664_10061794 3300025929 Bacteria 2990
253 Ga0207664_10073723 3300025929 Unclassified 2755
254 Ga0207664_10147671 3300025929 Bacteria 1995
255 Ga0207644_10005366 3300025931 Bacteria 8361
256 Ga0207706_10603102 3300025933 Bacteria 943
257 Ga0207669_10179105 3300025937 Unclassified 1518
258 Ga0207665_10087524 3300025939 Bacteria 2153
259 Ga0207711_10051977 3300025941 Unclassified 3510
260 Ga0207711_10104834 3300025941 Bacteria 2506
261 Ga0207711_10125007 3300025941 Bacteria 2300
262 Ga0207711_10259238 3300025941 Bacteria 1598
263 Ga0207689_10005741 3300025942 Bacteria 11027
264 Ga0207661_10397004 3300025944 Unclassified 1250
265 Ga0207667_10209727 3300025949 Bacteria 1997
266 Ga0207667_10596203 3300025949 Unclassified 1114
267 Ga0207712_10154118 3300025961 Unclassified 1778
268 Ga0207712_11406098 3300025961 Unclassified 624
269 Ga0207658_10005212 3300025986 Bacteria 8946
270 Ga0207658_10896427 3300025986 Unclassified 807
271 Ga0207677_10000064 3300026023 Bacteria 88785
272 Ga0207677_10447502 3300026023 Unclassified 1106
273 Ga0207703_10002709 3300026035 Bacteria 15174
274 Ga0207639_10002441 3300026041 Bacteria 12476
275 Ga0207702_10146939 3300026078 Bacteria 2140
276 Ga0207702_10550165 3300026078 Unclassified 1129
277 Ga0207702_11508642 3300026078 Unclassified 666
278 Ga0207641_10001741 3300026088 Bacteria 21011
279 Ga0207648_11229875 3300026089 Unclassified 704
280 Ga0207676_10002821 3300026095 Bacteria 12365
281 Ga0207676_10489859 3300026095 Bacteria 1166
282 Ga0207676_10635030 3300026095 Bacteria 1029
283 Ga0207674_10002227 3300026116 Bacteria 24558
284 Ga0207683_10646091 3300026121 Bacteria 980
285 Ga0207698_10029109 3300026142 Unclassified 3950
286 Ga0207698_10047160 3300026142 Bacteria 3261
287 Ga0207698_11667300 3300026142 Unclassified 653
288 Ga0265356_1000423 3300028017 Bacteria 7674
289 Ga0268265_10414245 3300028380 Unclassified 1249
290 Ga0265338_10002587 3300028800 Bacteria 26752
291 Ga0265338_10003779 3300028800 Bacteria 21040
292 Ga0265338_10009254 3300028800 Bacteria 11786
293 Ga0265338_10096317 3300028800 Bacteria 2428
294 Ga0265324_10056223 3300029957 Bacteria 1348
295 Ga0265762_1002849 3300030760 Bacteria 3091
296 Ga0265760_10050039 3300031090 Bacteria 1257
297 Ga0265328_10045667 3300031239 Bacteria 1610
298 Ga0265340_10125585 3300031247 Bacteria 1179
299 Ga0265339_10000204 3300031249 Bacteria 48602
300 Ga0265339_10000636 3300031249 Bacteria 27099
301 Ga0265339_10018858 3300031249 Bacteria 4060
302 Ga0265316_10015825 3300031344 Bacteria 6571
303 Ga0265316_10048832 3300031344 Bacteria 3337
304 Ga0265313_10137127 3300031595 Bacteria 1055
305 Ga0265314_10001414 3300031711 Bacteria 26900
306 Ga0265314_10002635 3300031711 Bacteria 18083
307 Ga0265314_10028544 3300031711 Bacteria 4159
308 Ga0265342_10071890 3300031712 Unclassified 2015
309 Ga0265342_10076127 3300031712 Bacteria 1946
310 Ga0373934_0052847 3300035086 Bacteria 1611
311 Ga0373954_0065098 3300035118 Bacteria 1725
312 Ga0373954_0191623 3300035118 Bacteria 1004
313 Ga0373954_0281175 3300035118 Bacteria 820
314 Ga0373957_0036163 3300035120 Bacteria 1839
315 Ga0373943_0190123 3300035170 Bacteria 1132
316 Ga0373946_0082140 3300035171 Unclassified 1413
317 Ga0373955_0050041 3300035172 Bacteria 2271
318 Ga0373955_0075538 3300035172 Bacteria 1894
319 Ga0373955_0099448 3300035172 Bacteria 1667
320 Ga0373935_0025097 3300035692 Bacteria 3673
321 Ga0373933_0711160 3300035724 Unclassified 661
322 Ga0373937_0028292 3300036401 Bacteria 5071
323 Ga0373937_0037189 3300036401 Bacteria 4436
324 Ga0373937_0177287 3300036401 Unclassified 2001
325 Ga0373937_0703614 3300036401 Unclassified 957
326 Ga0373925_0040157 3300037068 Unclassified 3463
327 Ga0373925_0254906 3300037068 Unclassified 1408
328 Ga0373925_1193885 3300037068 Unclassified 625
329 Ga0395898_0299241 3300037466 Unclassified 1535
330 Ga0436364_0621213 3300037853 Bacteria 2453
331 Ga0436363_0653847 3300039450 Unclassified 4373
332 Ga0436363_1557776 3300039450 Unclassified 1044
333 Ga0466969_0423695 3300044656 Bacteria 605
334 Ga0466961_0351281 3300044693 Unclassified 897
335 Ga0466963_0200193 3300044694 Bacteria 1397
336 Ga0466971_0197500 3300044719 Unclassified 949
337 Ga0466959_0366421 3300045049 Unclassified 981
338 Ga0466958_0276429 3300045836 Unclassified 1076
339 Ga0495629_0030765 3300046459 Bacteria 3803
340 Ga0495651_0054774 3300046462 Unclassified 3065
341 Ga0495651_0800689 3300046462 Unclassified 581
342 Ga0495580_0000164 3300046472 Bacteria 49081
343 Ga0495580_0605951 3300046472 Bacteria 723
344 Ga0495582_0009219 3300046473 Bacteria 5443
345 Ga0495585_0488947 3300046492 Unclassified 586
346 Ga0495594_0426596 3300046499 Unclassified 754
347 Ga0495594_0857867 3300046499 Bacteria 511
348 Ga0495608_0055817 3300046511 Unclassified 2610
349 Ga0495608_0729952 3300046511 Unclassified 588
350 Ga0495618_0026234 3300046514 Bacteria 3621
351 Ga0495628_0059957 3300046516 Bacteria 2986
352 Ga0495628_0119240 3300046516 Bacteria 2025
353 Ga0495628_0222523 3300046516 Bacteria 1417
354 Ga0495630_0749619 3300046517 Unclassified 746
355 Ga0495630_0920931 3300046517 Unclassified 665
356 Ga0495652_0249497 3300046529 Unclassified 1316
357 Ga0495652_0275550 3300046529 Bacteria 1234
358 Ga0495640_0173494 3300046533 Bacteria 1377
359 Ga0495640_0242453 3300046533 Unclassified 1131
360 Ga0495587_0021077 3300046536 Bacteria 4020
361 Ga0495587_0069642 3300046536 Bacteria 2048
362 Ga0495587_0133510 3300046536 Bacteria 1418
363 Ga0495587_0652635 3300046536 Bacteria 578
364 Ga0495645_0013290 3300046543 Bacteria 5818
365 Ga0495645_0144073 3300046543 Bacteria 1660
366 Ga0495667_0044895 3300046559 Bacteria 2926
367 Ga0495635_0094776 3300046663 Bacteria 2041
368 Ga0495635_1106354 3300046663 Unclassified 501
369 Ga0495657_0120675 3300046675 Bacteria 1651
370 Ga0495599_0018795 3300046678 Unclassified 4308
371 Ga0495599_0087401 3300046678 Bacteria 1946
372 Ga0495658_0391606 3300046683 Unclassified 885
373 Ga0495613_0030057 3300046689 Bacteria 4036
374 Ga0495613_0182479 3300046689 Bacteria 1486
375 Ga0495613_0548386 3300046689 Unclassified 774
376 Ga0495613_0948205 3300046689 Bacteria 555
377 Ga0495600_0156152 3300046809 Bacteria 1476
378 Ga0495581_0218368 3300047315 Unclassified 1115
379 Ga0495604_0030813 3300047317 Bacteria 4257
380 Ga0495604_0119745 3300047317 Bacteria 1907
381 Ga0495636_0338615 3300047318 Unclassified 709
382 Ga0495674_0146648 3300047319 Unclassified 1981
383 Ga0495674_0159866 3300047319 Bacteria 1885
384 Ga0495674_0168152 3300047319 Bacteria 1831
385 Ga0495674_0246486 3300047319 Bacteria 1471
386 Ga0495674_0357698 3300047319 Bacteria 1184
387 Ga0495675_0030136 3300047444 Bacteria 3462
388 Ga0495675_0522569 3300047444 Unclassified 679
389 Ga0495684_0028728 3300047471 Bacteria 4270
390 Ga0495684_0233457 3300047471 Bacteria 1344
391 Ga0495684_0592792 3300047471 Bacteria 749
392 Ga0495593_0206788 3300047673 Bacteria 986
393 Ga0495602_0057731 3300048088 Bacteria 3402
394 Ga0495602_0210147 3300048088 Bacteria 1478
395 Ga0495602_0231349 3300048088 Bacteria 1388
396 Ga0495614_0405934 3300048089 Unclassified 641
397 Ga0496100_0176260 3300048903 Bacteria 1544
398 Ga0496101_1558073 3300048904 Bacteria 514
399 Ga0496104_0496798 3300048907 Bacteria 1131
400 Ga0496104_0929002 3300048907 Bacteria 775
401 Ga0496105_1255008 3300048908 Bacteria 543
402 Ga0496110_1078529 3300048913 Bacteria 711
403 Ga0496113_0655315 3300048916 Bacteria 839
404 Ga0496114_0494696 3300048917 Bacteria 1082
405 Ga0496115_0063565 3300048918 Bacteria 2978
406 Ga0496115_0114276 3300048918 Bacteria 2219
407 Ga0496126_0177479 3300048929 Bacteria 1811
408 Ga0496126_0482319 3300048929 Bacteria 993
409 Ga0496126_0530125 3300048929 Bacteria 937
410 Ga0496126_0620374 3300048929 Bacteria 850
411 Ga0495682_0108451 3300049460 Unclassified 995
412 Ga0501031_0080910 3300049568 Unclassified 2117
413 Ga0501031_0126524 3300049568 Bacteria 1669
414 Ga0501031_0336387 3300049568 Bacteria 977
415 Ga0501032_0001178 3300049569 Bacteria 20976
416 Ga0501032_0013577 3300049569 Bacteria 5789
417 Ga0501032_0093199 3300049569 Unclassified 1997
418 Ga0501032_0250277 3300049569 Bacteria 1150
419 Ga0501033_0003486 3300049570 Bacteria 12903
420 Ga0501033_0022842 3300049570 Bacteria 4715
421 Ga0501033_0127049 3300049570 Bacteria 1848
422 Ga0501034_0008160 3300049571 Bacteria 11102
423 Ga0501034_0032415 3300049571 Bacteria 5306
424 Ga0501034_0032436 3300049571 Bacteria 5304
425 Ga0501034_0096009 3300049571 Bacteria 2960
426 Ga0501034_0126088 3300049571 Unclassified 2545
427 Ga0501034_0256432 3300049571 Bacteria 1692
428 Ga0501036_0001686 3300049572 Bacteria 17144
429 Ga0501036_0012449 3300049572 Bacteria 7050
430 Ga0501036_0033368 3300049572 Unclassified 4353
431 Ga0501037_0006516 3300049573 Bacteria 8541
432 Ga0501037_0101269 3300049573 Bacteria 2079
433 Ga0501037_0349974 3300049573 Bacteria 1019
434 Ga0501038_0003843 3300049574 Bacteria 13965
435 Ga0501038_0031892 3300049574 Bacteria 4654
436 Ga0501038_0045443 3300049574 Unclassified 3812
437 Ga0501038_0535266 3300049574 Bacteria 892
438 Ga0501039_0010514 3300049575 Bacteria 7053
439 Ga0501039_0034742 3300049575 Bacteria 3890
440 Ga0501039_0402140 3300049575 Unclassified 1075
441 Ga0501039_1416543 3300049575 Unclassified 535
442 Ga0501040_0784577 3300049576 Bacteria 689
443 Ga0501042_0678817 3300049578 Unclassified 749
444 Ga0501043_0005222 3300049579 Bacteria 10513
445 Ga0501043_0010833 3300049579 Bacteria 7140
446 Ga0501043_0022610 3300049579 Bacteria 4929
447 Ga0501043_0089505 3300049579 Bacteria 2419
448 Ga0501043_0177450 3300049579 Unclassified 1660
449 Ga0501043_0959233 3300049579 Bacteria 610
450 Ga0501046_0000201 3300049580 Bacteria 61759
451 Ga0501046_0029524 3300049580 Bacteria 4457
452 Ga0501046_0062840 3300049580 Bacteria 2900
453 Ga0501046_0166080 3300049580 Bacteria 1658
454 Ga0501047_0001344 3300049581 Bacteria 24139
455 Ga0501047_0043976 3300049581 Unclassified 4313
456 Ga0501047_0079735 3300049581 Bacteria 3147
457 Ga0501047_1419598 3300049581 Unclassified 509
458 Ga0501048_0006336 3300049582 Bacteria 8999
459 Ga0501048_0012614 3300049582 Bacteria 6285
460 Ga0501048_0119265 3300049582 Bacteria 1864
461 Ga0501067_0021285 3300049583 Unclassified 3588
462 Ga0501068_0006524 3300049584 Bacteria 6437
463 Ga0501068_0023098 3300049584 Bacteria 3643
464 Ga0501068_0266100 3300049584 Bacteria 1094
465 Ga0501069_0187458 3300049585 Unclassified 1196
466 Ga0501069_0204357 3300049585 Bacteria 1145
467 Ga0501070_0011317 3300049586 Bacteria 7538
468 Ga0501070_0014946 3300049586 Bacteria 6530
469 Ga0501070_0078853 3300049586 Bacteria 2725
470 Ga0501070_0259330 3300049586 Bacteria 1421
471 Ga0501072_0040819 3300049588 Bacteria 3644
472 Ga0501072_0051995 3300049588 Bacteria 3226
473 Ga0501072_0149764 3300049588 Unclassified 1860
474 Ga0501073_0002433 3300049589 Bacteria 13924
475 Ga0501073_0016613 3300049589 Bacteria 5332
476 Ga0501073_0078945 3300049589 Unclassified 2290
477 Ga0501073_0083926 3300049589 Unclassified 2216
478 Ga0501073_0394285 3300049589 Bacteria 956
479 Ga0501073_0553974 3300049589 Bacteria 794
480 Ga0501074_0017973 3300049590 Bacteria 5136
481 Ga0501074_0148372 3300049590 Bacteria 1677
482 Ga0501074_0202291 3300049590 Unclassified 1415
483 Ga0501076_0062618 3300049592 Bacteria 2963
484 Ga0501076_0298709 3300049592 Unclassified 1320
485 Ga0501076_0530284 3300049592 Bacteria 971
486 Ga0501076_1008367 3300049592 Bacteria 686
487 Ga0501077_0638295 3300049593 Bacteria 684
488 Ga0501077_0681729 3300049593 Unclassified 660
489 Ga0501079_0006443 3300049741 Bacteria 8815
490 Ga0501079_0180515 3300049741 Unclassified 1647
491 Ga0501079_0585632 3300049741 Unclassified 878
492 Ga0501079_1175729 3300049741 Bacteria 604
493 Ga0501080_0000497 3300049742 Bacteria 30732
494 Ga0501080_0034455 3300049742 Bacteria 4727
495 Ga0501080_0055791 3300049742 Bacteria 3679
496 Ga0501081_0214477 3300049743 Bacteria 1399
497 Ga0501083_0013665 3300049744 Bacteria 5677
498 Ga0501083_0013847 3300049744 Bacteria 5638
499 Ga0501083_0356128 3300049744 Unclassified 951
500 Ga0501083_0376255 3300049744 Unclassified 923
501 Ga0501035_0041027 3300049822 Bacteria 4179
502 Ga0501035_0111101 3300049822 Bacteria 2402
503 Ga0501035_0231728 3300049822 Unclassified 1573
504 Ga0501044_0003907 3300049823 Bacteria 16710
505 Ga0501044_0047179 3300049823 Bacteria 4456
506 Ga0501044_0081708 3300049823 Bacteria 3270
507 Ga0501044_0768535 3300049823 Unclassified 844
508 Ga0501045_0397012 3300049824 Bacteria 1026
509 Ga0501045_0628512 3300049824 Unclassified 794
510 nmdc:mga08x19_16344_c1 3300050514 Bacteria 4525
511 Ga0495601_0836306 3300053077 Unclassified 583
512 Ga0495619_0323603 3300053085 Bacteria 1067
513 Ga0500568_0000730 3300053139 Bacteria 23578
514 Ga0501084_0012971 3300054114 Bacteria 6899
515 Ga0501084_0025431 3300054114 Bacteria 4940
516 Ga0501084_0081905 3300054114 Bacteria 2707
517 Ga0501084_0248606 3300054114 Unclassified 1501
518 Ga0501082_0001791 3300060353 Bacteria 18894
519 Ga0501082_0025469 3300060353 Bacteria 5097
520 Ga0501082_0027717 3300060353 Bacteria 4876
521 Ga0501082_0070065 3300060353 Bacteria 3019
522 Ga0075367_10132328
523 JGI24743J22301_10009095
524 rootH2_10090347
525 rootH2_10151147
526 rootL2_10311386
527 Ga0070658_10018879
528 Ga0070658_10060067
529 Ga0070658_10322983
530 Ga0070683_100000253
531 Ga0070683_100174918
532 Ga0070670_100018762
533 Ga0068869_100000836
534 Ga0070666_10445495
535 Ga0070680_101583651
536 Ga0070682_100604748
537 Ga0068868_100000485
538 Ga0068868_100074210
539 Ga0068868_101867758
540 Ga0070660_101382890
541 Ga0070661_100027815
542 Ga0070661_100995036
543 Ga0070675_100358574
544 Ga0070675_100638411
545 Ga0070671_100001876
546 Ga0070674_100729451
547 Ga0070659_100801342
548 Ga0070667_100000402
549 Ga0070667_101180991
550 Ga0070709_10025141
551 Ga0070709_10034042
552 Ga0070709_10938653
553 Ga0070714_100026842
554 Ga0070714_100115367
555 Ga0070714_100193381
556 Ga0070714_100474744
557 Ga0070714_100531715
558 Ga0070713_100039458
559 Ga0070713_100147747
560 Ga0070713_100365536
561 Ga0070713_101057049
562 Ga0070711_100029160
563 Ga0070711_100036695
564 Ga0070708_100205462
565 Ga0070663_101349966
566 Ga0070678_101008518
567 Ga0070678_101594106
568 Ga0070662_101964343
569 Ga0070681_10058973
570 Ga0070681_10494367
571 Ga0070681_10568754
572 Ga0070681_10777371
573 Ga0070706_100621596
574 Ga0070679_100000802
575 Ga0070679_100177157
576 Ga0070679_101273233
577 Ga0070684_100000419
578 Ga0070684_100229011
579 Ga0070684_100479717
580 Ga0070665_100265469
581 Ga0068855_100171375
582 Ga0068855_100442257
583 Ga0070664_100122591
584 Ga0070664_102207133
585 Ga0068857_100001475
586 Ga0068857_101228930
587 Ga0068856_100003283
588 Ga0068856_100010220
589 Ga0068856_100649056
590 Ga0068856_101628837
591 Ga0068852_100035274
592 Ga0068852_100037445
593 Ga0068852_102595180
594 Ga0068859_100027546
595 Ga0068859_101808326
596 Ga0068859_102110290
597 Ga0068859_102606407
598 Ga0068864_100000819
599 Ga0068864_100981173
600 Ga0068866_10726262
601 Ga0068851_10008103
602 Ga0068851_10020815
603 Ga0068863_100001642
604 Ga0068863_100045467
605 Ga0068858_100000905
606 Ga0068860_100002128
607 Ga0068862_100048626
608 Ga0070717_10000123
609 Ga0070717_10025247
610 Ga0070717_10162252
611 Ga0070717_10371289
612 Ga0070717_10403472
613 Ga0070717_10431435
614 Ga0070715_10153682
615 Ga0070716_100110887
616 Ga0070716_100766175
617 Ga0070712_100005937
618 Ga0070712_100006262
619 Ga0097621_100001823
620 Ga0097621_100106634
621 Ga0097621_100663226
622 Ga0068871_100000365
623 Ga0068871_100138209
624 Ga0068871_100241300
625 Ga0068871_101334442
626 Ga0068865_101020514
627 Ga0075436_100009091
628 Ga0097620_100027545
629 Ga0097620_101808008
630 Ga0097620_102109925
631 Ga0097620_102607009
632 Ga0105240_10000458
633 Ga0105240_10005112
634 Ga0105240_10026188
635 Ga0105240_10507714
636 Ga0105240_11716034
637 Ga0105245_10000763
638 Ga0105245_10038707
639 Ga0105245_10520610
640 Ga0105245_13167538
641 Ga0105247_10003695
642 Ga0105247_10306560
643 Ga0105243_10078369
644 Ga0105241_10000848
645 Ga0105241_10136662
646 Ga0105241_10935614
647 Ga0105241_11148064
648 Ga0105242_11573675
649 Ga0105242_12258107
650 Ga0105248_10007758
651 Ga0105248_10416840
652 Ga0105248_11159255
653 Ga0105237_10010752
654 Ga0105237_10027650
655 Ga0105237_10197497
656 Ga0105237_10457586
657 Ga0105237_11079954
658 Ga0105237_11127531
659 Ga0105238_10010445
660 Ga0105238_10015800
661 Ga0105238_10198484
662 Ga0105249_10035248
663 Ga0105239_10173121
664 Ga0105239_10184475
665 Ga0105239_10832521
666 Ga0105239_13293921
667 Ga0105246_10005617
668 Ga0105246_10253961
669 Ga0157371_10137900
670 Ga0157370_10471628
671 Ga0157370_10978810
672 Ga0157369_10003156
673 Ga0157369_10013389
674 Ga0157369_10032134
675 Ga0157369_10061781
676 Ga0157369_10313928
677 Ga0157369_10524921
678 Ga0157369_10951772
679 Ga0157369_11677340
680 Ga0157374_10017585
681 Ga0157374_10049279
682 Ga0157374_10064308
683 Ga0157374_10085485
684 Ga0157374_10092048
685 Ga0157374_10237063
686 Ga0157374_12082142
687 Ga0157374_12397132
688 Ga0157378_10053213
689 Ga0157378_10058298
690 Ga0157378_10071407
691 Ga0157378_10208041
692 Ga0157378_10787245
693 Ga0163162_10068250
694 Ga0157372_10133004
695 Ga0157372_10169111
696 Ga0157372_10187568
697 Ga0157372_10403780
698 Ga0157372_10447910
699 Ga0157372_10995700
700 Ga0157372_11228876
701 Ga0157375_10007882
702 Ga0157375_11121932
703 Ga0157375_11257077
704 Ga0157375_11476995
705 Ga0163163_10006655
706 Ga0163163_10112747
707 Ga0163163_10260572
708 Ga0157377_10603364
709 Ga0157379_10000389
710 Ga0157379_10088489
711 Ga0157379_10316029
712 Ga0157376_10001089
713 Ga0157376_10001119
714 Ga0157376_10048483
715 Ga0157376_10051754
716 Ga0157376_11038650
717 Ga0163161_10409611
718 Ga0224570_100995
719 Ga0224569_102012
720 Ga0224572_1037251
721 Ga0228598_1001375
722 Ga0207656_10003478
723 Ga0207656_10034946
724 Ga0207692_10890457
725 Ga0207710_10000705
726 Ga0207680_10435336
727 Ga0207647_10333310
728 Ga0207685_10337134
729 Ga0207699_10042141
730 Ga0207699_10060055
731 Ga0207699_10143250
732 Ga0207699_10377699
733 Ga0207705_10067199
734 Ga0207705_10372374
735 Ga0207684_10032093
736 Ga0207684_11122687
737 Ga0207654_10018855
738 Ga0207654_10968655
739 Ga0207707_10097935
740 Ga0207707_10802587
741 Ga0207695_10000611
742 Ga0207695_10001863
743 Ga0207695_10025386
744 Ga0207695_10062304
745 Ga0207695_10110907
746 Ga0207671_10000326
747 Ga0207671_10136907
748 Ga0207671_10252739
749 Ga0207671_10292762
750 Ga0207693_10000609
751 Ga0207663_10051369
752 Ga0207663_10157698
753 Ga0207663_10876066
754 Ga0207660_10101378
755 Ga0207649_10025197
756 Ga0207649_10035190
757 Ga0207652_10011194
758 Ga0207652_10205370
759 Ga0207652_11222758
760 Ga0207694_10000456
761 Ga0207694_10052479
762 Ga0207694_11190472
763 Ga0207650_10174063
764 Ga0207659_10432667
765 Ga0207687_10013070
766 Ga0207687_10088423
767 Ga0207687_10802557
768 Ga0207700_10004486
769 Ga0207700_10017920
770 Ga0207700_10530376
771 Ga0207700_10761357
772 Ga0207700_10891542
773 Ga0207664_10061794
774 Ga0207664_10073723
775 Ga0207664_10147671
776 Ga0207644_10005366
777 Ga0207706_10603102
778 Ga0207669_10179105
779 Ga0207665_10087524
780 Ga0207711_10051977
781 Ga0207711_10104834
782 Ga0207711_10125007
783 Ga0207711_10259238
784 Ga0207689_10005741
785 Ga0207661_10397004
786 Ga0207667_10209727
787 Ga0207667_10596203
788 Ga0207712_10154118
789 Ga0207712_11406098
790 Ga0207658_10005212
791 Ga0207658_10896427
792 Ga0207677_10000064
793 Ga0207677_10447502
794 Ga0207703_10002709
795 Ga0207639_10002441
796 Ga0207702_10146939
797 Ga0207702_10550165
798 Ga0207702_11508642
799 Ga0207641_10001741
800 Ga0207648_11229875
801 Ga0207676_10002821
802 Ga0207676_10489859
803 Ga0207676_10635030
804 Ga0207674_10002227
805 Ga0207683_10646091
806 Ga0207698_10029109
807 Ga0207698_10047160
808 Ga0207698_11667300
809 Ga0265356_1000423
810 Ga0268265_10414245
811 Ga0265338_10002587
812 Ga0265338_10003779
813 Ga0265338_10009254
814 Ga0265338_10096317
815 Ga0265324_10056223
816 Ga0265762_1002849
817 Ga0265760_10050039
818 Ga0265328_10045667
819 Ga0265340_10125585
820 Ga0265339_10000204
821 Ga0265339_10000636
822 Ga0265339_10018858
823 Ga0265316_10015825
824 Ga0265316_10048832
825 Ga0265313_10137127
826 Ga0265314_10001414
827 Ga0265314_10002635
828 Ga0265314_10028544
829 Ga0265342_10071890
830 Ga0265342_10076127
831 Ga0373934_0052847
832 Ga0373954_0065098
833 Ga0373954_0191623
834 Ga0373954_0281175
835 Ga0373957_0036163
836 Ga0373943_0190123
837 Ga0373946_0082140
838 Ga0373955_0050041
839 Ga0373955_0075538
840 Ga0373955_0099448
841 Ga0373935_0025097
842 Ga0373933_0711160
843 Ga0373937_0028292
844 Ga0373937_0037189
845 Ga0373937_0177287
846 Ga0373937_0703614
847 Ga0373925_0040157
848 Ga0373925_0254906
849 Ga0373925_1193885
850 Ga0395898_0299241
851 Ga0436364_0621213
852 Ga0436363_0653847
853 Ga0436363_1557776
854 Ga0466969_0423695
855 Ga0466961_0351281
856 Ga0466963_0200193
857 Ga0466971_0197500
858 Ga0466959_0366421
859 Ga0466958_0276429
860 Ga0495629_0030765
861 Ga0495651_0054774
862 Ga0495651_0800689
863 Ga0495580_0000164
864 Ga0495580_0605951
865 Ga0495582_0009219
866 Ga0495585_0488947
867 Ga0495594_0426596
868 Ga0495594_0857867
869 Ga0495608_0055817
870 Ga0495608_0729952
871 Ga0495618_0026234
872 Ga0495628_0059957
873 Ga0495628_0119240
874 Ga0495628_0222523
875 Ga0495630_0749619
876 Ga0495630_0920931
877 Ga0495652_0249497
878 Ga0495652_0275550
879 Ga0495640_0173494
880 Ga0495640_0242453
881 Ga0495587_0021077
882 Ga0495587_0069642
883 Ga0495587_0133510
884 Ga0495587_0652635
885 Ga0495645_0013290
886 Ga0495645_0144073
887 Ga0495667_0044895
888 Ga0495635_0094776
889 Ga0495635_1106354
890 Ga0495657_0120675
891 Ga0495599_0018795
892 Ga0495599_0087401
893 Ga0495658_0391606
894 Ga0495613_0030057
895 Ga0495613_0182479
896 Ga0495613_0548386
897 Ga0495613_0948205
898 Ga0495600_0156152
899 Ga0495581_0218368
900 Ga0495604_0030813
901 Ga0495604_0119745
902 Ga0495636_0338615
903 Ga0495674_0146648
904 Ga0495674_0159866
905 Ga0495674_0168152
906 Ga0495674_0246486
907 Ga0495674_0357698
908 Ga0495675_0030136
909 Ga0495675_0522569
910 Ga0495684_0028728
911 Ga0495684_0233457
912 Ga0495684_0592792
913 Ga0495593_0206788
914 Ga0495602_0057731
915 Ga0495602_0210147
916 Ga0495602_0231349
917 Ga0495614_0405934
918 Ga0496100_0176260
919 Ga0496101_1558073
920 Ga0496104_0496798
921 Ga0496104_0929002
922 Ga0496105_1255008
923 Ga0496110_1078529
924 Ga0496113_0655315
925 Ga0496114_0494696
926 Ga0496115_0063565
927 Ga0496115_0114276
928 Ga0496126_0177479
929 Ga0496126_0482319
930 Ga0496126_0530125
931 Ga0496126_0620374
932 Ga0495682_0108451
933 Ga0501031_0080910
934 Ga0501031_0126524
935 Ga0501031_0336387
936 Ga0501032_0001178
937 Ga0501032_0013577
938 Ga0501032_0093199
939 Ga0501032_0250277
940 Ga0501033_0003486
941 Ga0501033_0022842
942 Ga0501033_0127049
943 Ga0501034_0008160
944 Ga0501034_0032415
945 Ga0501034_0032436
946 Ga0501034_0096009
947 Ga0501034_0126088
948 Ga0501034_0256432
949 Ga0501036_0001686
950 Ga0501036_0012449
951 Ga0501036_0033368
952 Ga0501037_0006516
953 Ga0501037_0101269
954 Ga0501037_0349974
955 Ga0501038_0003843
956 Ga0501038_0031892
957 Ga0501038_0045443
958 Ga0501038_0535266
959 Ga0501039_0010514
960 Ga0501039_0034742
961 Ga0501039_0402140
962 Ga0501039_1416543
963 Ga0501040_0784577
964 Ga0501042_0678817
965 Ga0501043_0005222
966 Ga0501043_0010833
967 Ga0501043_0022610
968 Ga0501043_0089505
969 Ga0501043_0177450
970 Ga0501043_0959233
971 Ga0501046_0000201
972 Ga0501046_0029524
973 Ga0501046_0062840
974 Ga0501046_0166080
975 Ga0501047_0001344
976 Ga0501047_0043976
977 Ga0501047_0079735
978 Ga0501047_1419598
979 Ga0501048_0006336
980 Ga0501048_0012614
981 Ga0501048_0119265
982 Ga0501067_0021285
983 Ga0501068_0006524
984 Ga0501068_0023098
985 Ga0501068_0266100
986 Ga0501069_0187458
987 Ga0501069_0204357
988 Ga0501070_0011317
989 Ga0501070_0014946
990 Ga0501070_0078853
991 Ga0501070_0259330
992 Ga0501072_0040819
993 Ga0501072_0051995
994 Ga0501072_0149764
995 Ga0501073_0002433
996 Ga0501073_0016613
997 Ga0501073_0078945
998 Ga0501073_0083926
999 Ga0501073_0394285
1000 Ga0501073_0553974
1001 Ga0501074_0017973
1002 Ga0501074_0148372
1003 Ga0501074_0202291
1004 Ga0501076_0062618
1005 Ga0501076_0298709
1006 Ga0501076_0530284
1007 Ga0501076_1008367
1008 Ga0501077_0638295
1009 Ga0501077_0681729
1010 Ga0501079_0006443
1011 Ga0501079_0180515
1012 Ga0501079_0585632
1013 Ga0501079_1175729
1014 Ga0501080_0000497
1015 Ga0501080_0034455
1016 Ga0501080_0055791
1017 Ga0501081_0214477
1018 Ga0501083_0013665
1019 Ga0501083_0013847
1020 Ga0501083_0356128
1021 Ga0501083_0376255
1022 Ga0501035_0041027
1023 Ga0501035_0111101
1024 Ga0501035_0231728
1025 Ga0501044_0003907
1026 Ga0501044_0047179
1027 Ga0501044_0081708
1028 Ga0501044_0768535
1029 Ga0501045_0397012
1030 Ga0501045_0628512
1031 nmdc:mga08x19_16344_c1
1032 Ga0495601_0836306
1033 Ga0495619_0323603
1034 Ga0500568_0000730
1035 Ga0501084_0012971
1036 Ga0501084_0025431
1037 Ga0501084_0081905
1038 Ga0501084_0248606
1039 Ga0501082_0001791
1040 Ga0501082_0025469
1041 Ga0501082_0027717
1042 Ga0501082_0070065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

34

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9167 11 106
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9159 10 107
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9084 11 106
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9006 10 110
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8954 10 109
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9084 11 106 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9049 12 113 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8856 14 94 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8815 7 110 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.876 12 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 1 12 89
AF-A0A843TB24-F1-model_v4 PadR family transcriptional regulator 0.9972 12 111
AF-A0A7V0Y143-F1-model_v4 PadR family transcriptional regulator 0.9961 12 115
AF-A0A2V8YVR9-F1-model_v4 PadR family transcriptional regulator 0.9943 12 111
AF-A0A6J4LNB7-F1-model_v4 Transcriptional regulator, PadR family 0.9928 12 115

Map