F458589

General Info

Members Datasets Scaffolds Average Seq Length
520 133 1040 214

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0098619|Ga0495583_0098619_93_866
Length 257
Sequence MMERNMNDHQLRPADLPGWGQRTALRLLQLFGWKVFHKPLPGPHGIAVVYPHTSNWDFIIGMLGKWSLGIHFRWLAKDSLFRGPMGTVMRYWGGVPVDRSAPMGATRALAERMLSEKWFWVAITPEGTRGHKPHWKSGFYHLALAAKVPVLLVCLDYRRKELRVQDYLDLTGNPDVDMARIAKVYADCQALYPGKAAPVKLAPARDKTGAARKHPQAGAHAPGAGHQRGADQQVSHVVRMDPDMAGMGAGGQDNRQR

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
27 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
32 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
33 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
34 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
35 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
36 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
41 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
42 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
43 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
48 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
49 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
50 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
51 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
52 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
53 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
54 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
55 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
56 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
57 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
58 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
59 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
60 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
61 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
62 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
63 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
64 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
65 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
68 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
69 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
72 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
77 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
98 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
110 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.85
Rhizosphere 94.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0098619 3300046506 Bacteria 1249
2 rootL2_10082194 3300003322 Bacteria 3830
3 Ga0070658_10222752 3300005327 Bacteria 1596
4 Ga0070658_10239131 3300005327 Bacteria 1539
5 Ga0070680_100053627 3300005336 Bacteria 3292
6 Ga0070660_100001948 3300005339 Bacteria 14236
7 Ga0070660_100013676 3300005339 Bacteria 5831
8 Ga0070660_100164059 3300005339 Bacteria 1791
9 Ga0070661_100095015 3300005344 Bacteria 2210
10 Ga0070659_100048852 3300005366 Bacteria 3325
11 Ga0070662_100297314 3300005457 Bacteria 1311
12 Ga0070664_100069805 3300005564 Bacteria 3007
13 Ga0070664_100128423 3300005564 Bacteria 2225
14 Ga0068852_100173009 3300005616 Bacteria 2026
15 Ga0068865_100146789 3300006881 Bacteria 1785
16 Ga0105245_10104905 3300009098 Bacteria 2621
17 Ga0105243_10186272 3300009148 Bacteria 1809
18 Ga0105241_10187724 3300009174 Bacteria 1719
19 Ga0157372_10382730 3300013307 Bacteria 1639
20 Ga0182006_1088788 3300015261 Bacteria 1115
21 Ga0182007_10059764 3300015262 Bacteria 1250
22 Ga0207705_10001979 3300025909 Bacteria 15937
23 Ga0207705_10120981 3300025909 Bacteria 1942
24 Ga0207705_10227412 3300025909 Bacteria 1418
25 Ga0207654_10111482 3300025911 Bacteria 1703
26 Ga0207660_10304871 3300025917 Bacteria 1269
27 Ga0207657_10005710 3300025919 Bacteria 12986
28 Ga0207657_10006504 3300025919 Bacteria 12106
29 Ga0207690_10015127 3300025932 Bacteria 4671
30 Ga0207690_10037101 3300025932 Bacteria 3162
31 Ga0207690_10126859 3300025932 Bacteria 1862
32 Ga0207686_10080396 3300025934 Bacteria 2125
33 Ga0207704_10289474 3300025938 Bacteria 1249
34 Ga0207679_10052950 3300025945 Bacteria 2979
35 Ga0207679_10150663 3300025945 Bacteria 1892
36 Ga0395899_0018597 3300037312 Bacteria 5280
37 Ga0395899_0034644 3300037312 Bacteria 3792
38 Ga0395899_0139673 3300037312 Bacteria 1724
39 Ga0395899_0153238 3300037312 Bacteria 1632
40 Ga0395899_0173255 3300037312 Bacteria 1518
41 Ga0395900_0011425 3300037418 Bacteria 9087
42 Ga0395900_0017921 3300037418 Bacteria 7227
43 Ga0395900_0027758 3300037418 Bacteria 5799
44 Ga0395900_0036060 3300037418 Bacteria 5096
45 Ga0395900_0037395 3300037418 Bacteria 5005
46 Ga0395900_0281088 3300037418 Bacteria 1656
47 Ga0395900_0306209 3300037418 Bacteria 1573
48 Ga0395898_0026783 3300037466 Bacteria 5795
49 Ga0395898_0037901 3300037466 Bacteria 4779
50 Ga0395898_0120107 3300037466 Bacteria 2518
51 Ga0395905_0016205 3300037471 Bacteria 7081
52 Ga0395905_0047286 3300037471 Bacteria 4033
53 Ga0395905_0058952 3300037471 Bacteria 3589
54 Ga0395905_0096295 3300037471 Bacteria 2778
55 Ga0395905_0131447 3300037471 Bacteria 2354
56 Ga0395905_0201374 3300037471 Bacteria 1866
57 Ga0395905_0345853 3300037471 Bacteria 1378
58 Ga0395905_0428713 3300037471 Bacteria 1219
59 Ga0395905_0481512 3300037471 Bacteria 1140
60 Ga0395901_0000212 3300038443 Bacteria 73375
61 Ga0395901_0000522 3300038443 Bacteria 44365
62 Ga0395901_0105097 3300038443 Bacteria 2963
63 Ga0395901_0127078 3300038443 Bacteria 2679
64 Ga0395901_0240976 3300038443 Bacteria 1886
65 Ga0395901_0254099 3300038443 Bacteria 1830
66 Ga0395901_0665803 3300038443 Bacteria 1042
67 Ga0439448_0002319 3300042005 Bacteria 5153
68 Ga0439448_0052362 3300042005 Bacteria 1338
69 Ga0439448_0075399 3300042005 Bacteria 1127
70 Ga0439450_001146 3300042008 Bacteria 3775
71 Ga0439455_0005982 3300042012 Bacteria 2501
72 Ga0439455_0035435 3300042012 Bacteria 1260
73 Ga0439458_0037429 3300042157 Bacteria 1170
74 Ga0439458_0039835 3300042157 Bacteria 1137
75 Ga0466969_0120271 3300044656 Bacteria 1223
76 Ga0466972_0040476 3300044658 Bacteria 2271
77 Ga0466965_0002093 3300044683 Bacteria 8366
78 Ga0466965_0164486 3300044683 Bacteria 1164
79 Ga0466966_0015081 3300044684 Bacteria 5111
80 Ga0466966_0026752 3300044684 Bacteria 3765
81 Ga0466961_0099822 3300044693 Bacteria 1829
82 Ga0466963_0180497 3300044694 Bacteria 1474
83 Ga0466964_0002325 3300044706 Bacteria 6742
84 Ga0466964_0070862 3300044706 Bacteria 1474
85 Ga0466968_0001426 3300044735 Bacteria 8574
86 Ga0466957_0042461 3300044842 Bacteria 2751
87 Ga0466957_0245329 3300044842 Bacteria 1189
88 Ga0466959_0542592 3300045049 Bacteria 784
89 Ga0466958_0013292 3300045836 Bacteria 4684
90 Ga0466967_0012418 3300045976 Bacteria 6513
91 Ga0466967_0059299 3300045976 Bacteria 3387
92 Ga0466967_0829758 3300045976 Bacteria 918
93 Ga0495617_001610 3300046452 Bacteria 9751
94 Ga0495627_000323 3300046453 Bacteria 46699
95 Ga0495590_0000008 3300046457 Bacteria 330520
96 Ga0495590_0006957 3300046457 Bacteria 4385
97 Ga0495591_000051 3300046458 Bacteria 137457
98 Ga0495638_0000027 3300046460 Bacteria 337569
99 Ga0495638_0032631 3300046460 Bacteria 3336
100 Ga0495638_0070726 3300046460 Bacteria 2136
101 Ga0495653_0014966 3300046463 Bacteria 6326
102 Ga0495653_0018324 3300046463 Bacteria 5688
103 Ga0495650_0009214 3300046471 Bacteria 5646
104 Ga0495650_0011817 3300046471 Bacteria 4745
105 Ga0495582_0029957 3300046473 Bacteria 2986
106 Ga0495605_0000049 3300046474 Bacteria 166669
107 Ga0495605_0000130 3300046474 Bacteria 98652
108 Ga0495605_0000766 3300046474 Bacteria 23278
109 Ga0495605_0007998 3300046474 Bacteria 5986
110 Ga0495605_0017554 3300046474 Bacteria 3849
111 Ga0495605_0027431 3300046474 Bacteria 2951
112 Ga0495605_0029444 3300046474 Bacteria 2824
113 Ga0495605_0033927 3300046474 Bacteria 2588
114 Ga0495605_0201720 3300046474 Bacteria 866
115 Ga0495639_0012274 3300046475 Bacteria 3695
116 Ga0495584_0000001 3300046491 Bacteria 649329
117 Ga0495584_0000024 3300046491 Bacteria 117259
118 Ga0495584_0000164 3300046491 Bacteria 46886
119 Ga0495584_0000337 3300046491 Bacteria 32525
120 Ga0495584_0003779 3300046491 Bacteria 8252
121 Ga0495584_0007355 3300046491 Bacteria 5743
122 Ga0495584_0011557 3300046491 Bacteria 4522
123 Ga0495584_0028145 3300046491 Bacteria 2847
124 Ga0495584_0074608 3300046491 Bacteria 1705
125 Ga0495584_0169539 3300046491 Bacteria 1109
126 Ga0495585_0000003 3300046492 Bacteria 406344
127 Ga0495585_0000011 3300046492 Bacteria 210440
128 Ga0495585_0001202 3300046492 Bacteria 21011
129 Ga0495585_0002536 3300046492 Bacteria 12973
130 Ga0495585_0004170 3300046492 Bacteria 9441
131 Ga0495585_0007957 3300046492 Bacteria 6443
132 Ga0495585_0012871 3300046492 Bacteria 4917
133 Ga0495585_0030203 3300046492 Bacteria 3082
134 Ga0495585_0035496 3300046492 Bacteria 2816
135 Ga0495585_0050246 3300046492 Bacteria 2313
136 Ga0495585_0064525 3300046492 Bacteria 2007
137 Ga0495585_0131001 3300046492 Bacteria 1320
138 Ga0495585_0133018 3300046492 Bacteria 1307
139 Ga0495585_0161074 3300046492 Bacteria 1164
140 Ga0495594_0002901 3300046499 Bacteria 8922
141 Ga0495594_0003164 3300046499 Bacteria 8519
142 Ga0495594_0010694 3300046499 Bacteria 4760
143 Ga0495594_0013848 3300046499 Bacteria 4217
144 Ga0495594_0049562 3300046499 Bacteria 2308
145 Ga0495594_0139567 3300046499 Bacteria 1374
146 Ga0495596_0001361 3300046500 Bacteria 14084
147 Ga0495596_0001942 3300046500 Bacteria 11431
148 Ga0495596_0002176 3300046500 Bacteria 10685
149 Ga0495596_0003204 3300046500 Bacteria 8414
150 Ga0495596_0005547 3300046500 Bacteria 5936
151 Ga0495596_0010400 3300046500 Bacteria 4052
152 Ga0495596_0014036 3300046500 Bacteria 3380
153 Ga0495596_0022358 3300046500 Bacteria 2575
154 Ga0495596_0033392 3300046500 Bacteria 2047
155 Ga0495596_0057702 3300046500 Bacteria 1514
156 Ga0495607_0000715 3300046501 Bacteria 32055
157 Ga0495607_0002565 3300046501 Bacteria 14674
158 Ga0495607_0004536 3300046501 Bacteria 10195
159 Ga0495607_0005576 3300046501 Bacteria 8978
160 Ga0495607_0024051 3300046501 Bacteria 3803
161 Ga0495607_0069436 3300046501 Bacteria 1972
162 Ga0495607_0106463 3300046501 Bacteria 1493
163 Ga0495583_0000006 3300046506 Bacteria 436893
164 Ga0495583_0000095 3300046506 Bacteria 152114
165 Ga0495583_0000381 3300046506 Bacteria 68754
166 Ga0495583_0000738 3300046506 Bacteria 41545
167 Ga0495583_0001723 3300046506 Bacteria 20990
168 Ga0495583_0002006 3300046506 Bacteria 18584
169 Ga0495583_0006928 3300046506 Bacteria 7277
170 Ga0495583_0018897 3300046506 Bacteria 3613
171 Ga0495583_0037501 3300046506 Bacteria 2297
172 Ga0495583_0038182 3300046506 Bacteria 2270
173 Ga0495583_0049723 3300046506 Bacteria 1918
174 Ga0495583_0051857 3300046506 Bacteria 1868
175 Ga0495583_0072831 3300046506 Bacteria 1507
176 Ga0495583_0084683 3300046506 Bacteria 1373
177 Ga0495583_0124873 3300046506 Bacteria 1080
178 Ga0495583_0130586 3300046506 Bacteria 1051
179 Ga0495606_0017106 3300046507 Bacteria 5498
180 Ga0495606_0021514 3300046507 Bacteria 4724
181 Ga0495606_0026639 3300046507 Bacteria 4118
182 Ga0495606_0044604 3300046507 Bacteria 2947
183 Ga0495606_0083347 3300046507 Bacteria 1983
184 Ga0495606_0085240 3300046507 Bacteria 1954
185 Ga0495606_0086496 3300046507 Bacteria 1937
186 Ga0495606_0173221 3300046507 Bacteria 1250
187 Ga0495606_0210592 3300046507 Bacteria 1101
188 Ga0495610_0014285 3300046512 Bacteria 4673
189 Ga0495616_0000075 3300046513 Bacteria 84686
190 Ga0495616_0000170 3300046513 Bacteria 56058
191 Ga0495616_0002668 3300046513 Bacteria 11703
192 Ga0495616_0005917 3300046513 Bacteria 7459
193 Ga0495616_0014805 3300046513 Bacteria 4354
194 Ga0495616_0018401 3300046513 Bacteria 3835
195 Ga0495616_0018802 3300046513 Bacteria 3783
196 Ga0495616_0021712 3300046513 Bacteria 3472
197 Ga0495616_0028498 3300046513 Bacteria 2956
198 Ga0495616_0030325 3300046513 Bacteria 2843
199 Ga0495616_0047398 3300046513 Bacteria 2164
200 Ga0495616_0064930 3300046513 Bacteria 1780
201 Ga0495616_0069927 3300046513 Bacteria 1700
202 Ga0495616_0131517 3300046513 Bacteria 1146
203 Ga0495620_0012616 3300046515 Bacteria 4356
204 Ga0495630_0317546 3300046517 Bacteria 1191
205 Ga0495631_0000039 3300046518 Bacteria 80275
206 Ga0495631_0006992 3300046518 Bacteria 5775
207 Ga0495631_0009595 3300046518 Bacteria 4827
208 Ga0495631_0009818 3300046518 Bacteria 4765
209 Ga0495631_0023846 3300046518 Bacteria 2831
210 Ga0495631_0025237 3300046518 Bacteria 2739
211 Ga0495631_0026481 3300046518 Bacteria 2662
212 Ga0495631_0033889 3300046518 Bacteria 2291
213 Ga0495631_0075228 3300046518 Bacteria 1457
214 Ga0495632_0000091 3300046519 Bacteria 93600
215 Ga0495632_0000420 3300046519 Bacteria 40173
216 Ga0495632_0001584 3300046519 Bacteria 18762
217 Ga0495632_0004770 3300046519 Bacteria 9131
218 Ga0495632_0007821 3300046519 Bacteria 6655
219 Ga0495632_0009614 3300046519 Bacteria 5809
220 Ga0495632_0027366 3300046519 Bacteria 2987
221 Ga0495632_0038308 3300046519 Bacteria 2428
222 Ga0495637_0000009 3300046520 Bacteria 402028
223 Ga0495637_0021615 3300046520 Bacteria 2948
224 Ga0495643_0000065 3300046522 Bacteria 179031
225 Ga0495643_0001833 3300046522 Bacteria 18075
226 Ga0495643_0002583 3300046522 Bacteria 14149
227 Ga0495643_0018411 3300046522 Bacteria 4060
228 Ga0495643_0022518 3300046522 Bacteria 3595
229 Ga0495643_0024649 3300046522 Bacteria 3411
230 Ga0495643_0118051 3300046522 Bacteria 1342
231 Ga0495643_0215837 3300046522 Bacteria 913
232 Ga0495644_0001514 3300046523 Bacteria 9471
233 Ga0495644_0001558 3300046523 Bacteria 9347
234 Ga0495644_0011182 3300046523 Bacteria 3459
235 Ga0495644_0011598 3300046523 Bacteria 3393
236 Ga0495644_0037403 3300046523 Bacteria 1831
237 Ga0495644_0066874 3300046523 Bacteria 1350
238 Ga0495644_0125696 3300046523 Bacteria 976
239 Ga0495648_0000031 3300046524 Bacteria 213136
240 Ga0495648_0000078 3300046524 Bacteria 127397
241 Ga0495648_0000883 3300046524 Bacteria 31505
242 Ga0495648_0000928 3300046524 Bacteria 30479
243 Ga0495648_0005054 3300046524 Bacteria 11071
244 Ga0495648_0019142 3300046524 Bacteria 4825
245 Ga0495648_0020883 3300046524 Bacteria 4554
246 Ga0495648_0178253 3300046524 Bacteria 1082
247 Ga0495666_0008568 3300046526 Bacteria 5125
248 Ga0495666_0053404 3300046526 Bacteria 1939
249 Ga0495666_0064435 3300046526 Bacteria 1749
250 Ga0495666_0152904 3300046526 Bacteria 1072
251 Ga0495666_0152936 3300046526 Bacteria 1072
252 Ga0495642_0000012 3300046528 Bacteria 127229
253 Ga0495642_0000326 3300046528 Bacteria 26021
254 Ga0495642_0000791 3300046528 Bacteria 15345
255 Ga0495642_0002249 3300046528 Bacteria 7902
256 Ga0495642_0002396 3300046528 Bacteria 7636
257 Ga0495642_0003658 3300046528 Bacteria 6042
258 Ga0495642_0005649 3300046528 Bacteria 4804
259 Ga0495642_0008366 3300046528 Bacteria 3960
260 Ga0495642_0014076 3300046528 Bacteria 3100
261 Ga0495642_0021133 3300046528 Bacteria 2558
262 Ga0495642_0022834 3300046528 Bacteria 2467
263 Ga0495642_0053173 3300046528 Bacteria 1668
264 Ga0495642_0116961 3300046528 Bacteria 1142
265 Ga0495652_0231104 3300046529 Bacteria 1383
266 Ga0495654_0007354 3300046530 Bacteria 6161
267 Ga0495654_0022089 3300046530 Bacteria 3308
268 Ga0495654_0026560 3300046530 Bacteria 2975
269 Ga0495665_0052028 3300046531 Bacteria 2168
270 Ga0495586_0003505 3300046535 Bacteria 8408
271 Ga0495586_0035227 3300046535 Bacteria 2688
272 Ga0495586_0145114 3300046535 Bacteria 1333
273 Ga0495587_0030203 3300046536 Bacteria 3287
274 Ga0495587_0134847 3300046536 Bacteria 1411
275 Ga0495587_0181666 3300046536 Bacteria 1193
276 Ga0495587_0278515 3300046536 Bacteria 937
277 Ga0495609_0000001 3300046538 Bacteria 1060094
278 Ga0495609_0000678 3300046538 Bacteria 26308
279 Ga0495609_0001091 3300046538 Bacteria 18869
280 Ga0495609_0004200 3300046538 Bacteria 7984
281 Ga0495609_0007558 3300046538 Bacteria 5403
282 Ga0495609_0011462 3300046538 Bacteria 4221
283 Ga0495609_0033965 3300046538 Bacteria 2313
284 Ga0495609_0047139 3300046538 Bacteria 1929
285 Ga0495609_0055265 3300046538 Bacteria 1762
286 Ga0495609_0154418 3300046538 Bacteria 975
287 Ga0495609_0173321 3300046538 Bacteria 910
288 Ga0495597_0000009 3300046542 Bacteria 227319
289 Ga0495597_0000029 3300046542 Bacteria 136312
290 Ga0495597_0000335 3300046542 Bacteria 42105
291 Ga0495597_0001211 3300046542 Bacteria 19233
292 Ga0495597_0006071 3300046542 Bacteria 6289
293 Ga0495597_0006309 3300046542 Bacteria 6142
294 Ga0495597_0022701 3300046542 Bacteria 2909
295 Ga0495597_0039130 3300046542 Bacteria 2124
296 Ga0495622_0000043 3300046557 Bacteria 115796
297 Ga0495622_0014417 3300046557 Bacteria 3670
298 Ga0495633_0000381 3300046558 Bacteria 47007
299 Ga0495633_0003347 3300046558 Bacteria 10754
300 Ga0495633_0006315 3300046558 Bacteria 7058
301 Ga0495633_0010310 3300046558 Bacteria 5111
302 Ga0495633_0011581 3300046558 Bacteria 4746
303 Ga0495633_0012338 3300046558 Bacteria 4551
304 Ga0495633_0021221 3300046558 Bacteria 3251
305 Ga0495633_0038213 3300046558 Bacteria 2294
306 Ga0495633_0044461 3300046558 Bacteria 2105
307 Ga0495633_0046717 3300046558 Bacteria 2047
308 Ga0495633_0057318 3300046558 Bacteria 1830
309 Ga0495633_0093925 3300046558 Bacteria 1394
310 Ga0495633_0145337 3300046558 Bacteria 1096
311 Ga0495633_0229320 3300046558 Bacteria 849
312 Ga0495656_0012465 3300046615 Bacteria 3139
313 Ga0495656_0071189 3300046615 Bacteria 1545
314 Ga0495656_0154011 3300046615 Bacteria 1112
315 Ga0495656_0238854 3300046615 Bacteria 914
316 Ga0495656_0257024 3300046615 Bacteria 884
317 Ga0495668_0000096 3300046616 Bacteria 139693
318 Ga0495668_0000180 3300046616 Bacteria 94157
319 Ga0495668_0000946 3300046616 Bacteria 32288
320 Ga0495668_0001031 3300046616 Bacteria 29510
321 Ga0495668_0003852 3300046616 Bacteria 10976
322 Ga0495668_0005029 3300046616 Bacteria 9111
323 Ga0495668_0010507 3300046616 Bacteria 5600
324 Ga0495668_0024059 3300046616 Bacteria 3466
325 Ga0495668_0096289 3300046616 Bacteria 1619
326 Ga0495668_0101198 3300046616 Bacteria 1576
327 Ga0495668_0156895 3300046616 Bacteria 1246
328 Ga0495668_0224180 3300046616 Bacteria 1029
329 Ga0495668_0260962 3300046616 Bacteria 948
330 Ga0495611_0000013 3300046648 Bacteria 130500
331 Ga0495611_0001317 3300046648 Bacteria 12624
332 Ga0495611_0019331 3300046648 Bacteria 2925
333 Ga0495611_0025421 3300046648 Bacteria 2580
334 Ga0495611_0037477 3300046648 Bacteria 2154
335 Ga0495611_0075636 3300046648 Bacteria 1543
336 Ga0495611_0153758 3300046648 Bacteria 1074
337 Ga0495625_0000053 3300046660 Bacteria 190575
338 Ga0495625_0020961 3300046660 Bacteria 5039
339 Ga0495625_0037231 3300046660 Bacteria 3571
340 Ga0495625_0046448 3300046660 Bacteria 3134
341 Ga0495625_0069630 3300046660 Bacteria 2471
342 Ga0495625_0071441 3300046660 Bacteria 2436
343 Ga0495625_0094345 3300046660 Bacteria 2065
344 Ga0495625_0107547 3300046660 Bacteria 1909
345 Ga0495635_0009894 3300046663 Bacteria 6666
346 Ga0495661_0000023 3300046665 Bacteria 189053
347 Ga0495661_0000800 3300046665 Bacteria 29767
348 Ga0495661_0007384 3300046665 Bacteria 7657
349 Ga0495661_0009477 3300046665 Bacteria 6682
350 Ga0495661_0009805 3300046665 Bacteria 6553
351 Ga0495661_0011754 3300046665 Bacteria 5930
352 Ga0495661_0019334 3300046665 Bacteria 4465
353 Ga0495661_0027310 3300046665 Bacteria 3665
354 Ga0495661_0029149 3300046665 Bacteria 3526
355 Ga0495661_0056055 3300046665 Bacteria 2359
356 Ga0495661_0115437 3300046665 Bacteria 1491
357 Ga0495588_0000041 3300046674 Bacteria 377896
358 Ga0495588_0002574 3300046674 Bacteria 7757
359 Ga0495588_0051742 3300046674 Bacteria 2116
360 Ga0495588_0069199 3300046674 Bacteria 1834
361 Ga0495588_0073261 3300046674 Bacteria 1783
362 Ga0495623_0005448 3300046679 Bacteria 8316
363 Ga0495623_0030224 3300046679 Bacteria 3485
364 Ga0495669_0000017 3300046684 Bacteria 131447
365 Ga0495669_0005621 3300046684 Bacteria 5232
366 Ga0495669_0006571 3300046684 Bacteria 4861
367 Ga0495669_0012102 3300046684 Bacteria 3667
368 Ga0495669_0013892 3300046684 Bacteria 3437
369 Ga0495669_0046588 3300046684 Bacteria 1935
370 Ga0495669_0063676 3300046684 Bacteria 1673
371 Ga0495669_0109063 3300046684 Bacteria 1291
372 Ga0495669_0135603 3300046684 Bacteria 1160
373 Ga0495613_0067509 3300046689 Bacteria 2610
374 Ga0495670_0003492 3300046691 Bacteria 7722
375 Ga0495670_0003649 3300046691 Bacteria 7565
376 Ga0495670_0003881 3300046691 Bacteria 7342
377 Ga0495670_0010490 3300046691 Bacteria 4552
378 Ga0495670_0020043 3300046691 Bacteria 3295
379 Ga0495670_0022042 3300046691 Bacteria 3145
380 Ga0495670_0028834 3300046691 Bacteria 2752
381 Ga0495670_0031107 3300046691 Bacteria 2652
382 Ga0495670_0135724 3300046691 Bacteria 1284
383 Ga0495670_0188444 3300046691 Bacteria 1091
384 Ga0495671_0000590 3300046692 Bacteria 26842
385 Ga0495671_0001741 3300046692 Bacteria 14110
386 Ga0495671_0011815 3300046692 Bacteria 4787
387 Ga0495649_0000062 3300046694 Bacteria 96596
388 Ga0495649_0001085 3300046694 Bacteria 21225
389 Ga0495649_0029917 3300046694 Bacteria 3009
390 Ga0495649_0157700 3300046694 Bacteria 1190
391 Ga0495649_0186604 3300046694 Bacteria 1080
392 Ga0495649_0208129 3300046694 Bacteria 1014
393 Ga0495649_0228514 3300046694 Bacteria 961
394 Ga0495589_0000027 3300046794 Bacteria 181084
395 Ga0495589_0000034 3300046794 Bacteria 162449
396 Ga0495589_0000162 3300046794 Bacteria 61314
397 Ga0495589_0003493 3300046794 Bacteria 8504
398 Ga0495589_0006982 3300046794 Bacteria 5924
399 Ga0495589_0019503 3300046794 Bacteria 3475
400 Ga0495589_0020901 3300046794 Bacteria 3345
401 Ga0495589_0035342 3300046794 Bacteria 2505
402 Ga0495589_0079531 3300046794 Bacteria 1595
403 Ga0495660_0000132 3300046810 Bacteria 81849
404 Ga0495660_0001676 3300046810 Bacteria 14828
405 Ga0495660_0003722 3300046810 Bacteria 9362
406 Ga0495660_0007521 3300046810 Bacteria 6394
407 Ga0495660_0008925 3300046810 Bacteria 5857
408 Ga0495660_0042908 3300046810 Bacteria 2497
409 Ga0495660_0072131 3300046810 Bacteria 1829
410 Ga0495581_0005113 3300047315 Bacteria 7595
411 Ga0495604_0027207 3300047317 Bacteria 4550
412 Ga0495636_0008727 3300047318 Bacteria 3995
413 Ga0495672_0000055 3300047320 Bacteria 229428
414 Ga0495672_0000231 3300047320 Bacteria 79748
415 Ga0495672_0010993 3300047320 Bacteria 6413
416 Ga0495672_0011034 3300047320 Bacteria 6399
417 Ga0495672_0012790 3300047320 Bacteria 5831
418 Ga0495672_0029080 3300047320 Bacteria 3486
419 Ga0495676_0018708 3300047321 Bacteria 6108
420 Ga0495676_0051329 3300047321 Bacteria 3301
421 Ga0495680_0002129 3300047322 Bacteria 20555
422 Ga0495683_0000005 3300047323 Bacteria 287871
423 Ga0495683_0000222 3300047323 Bacteria 53417
424 Ga0495683_0003913 3300047323 Bacteria 8565
425 Ga0495683_0029976 3300047323 Bacteria 2778
426 Ga0495683_0032621 3300047323 Bacteria 2652
427 Ga0495683_0033202 3300047323 Bacteria 2627
428 Ga0495683_0093508 3300047323 Bacteria 1454
429 Ga0495683_0105030 3300047323 Bacteria 1354
430 Ga0495687_000012 3300047443 Bacteria 391586
431 Ga0495687_000023 3300047443 Bacteria 317750
432 Ga0495687_000027 3300047443 Bacteria 299689
433 Ga0495687_000048 3300047443 Bacteria 205967
434 Ga0495687_000535 3300047443 Bacteria 45436
435 Ga0495687_012520 3300047443 Bacteria 4478
436 Ga0495687_070820 3300047443 Bacteria 1399
437 Ga0495687_105865 3300047443 Bacteria 1045
438 Ga0495675_0043365 3300047444 Bacteria 2866
439 Ga0495675_0100812 3300047444 Bacteria 1807
440 Ga0495677_0000001 3300047445 Bacteria 715000
441 Ga0495677_0000216 3300047445 Bacteria 26250
442 Ga0495677_0002569 3300047445 Bacteria 7106
443 Ga0495677_0004323 3300047445 Bacteria 5459
444 Ga0495677_0004385 3300047445 Bacteria 5424
445 Ga0495677_0004727 3300047445 Bacteria 5189
446 Ga0495677_0010116 3300047445 Bacteria 3469
447 Ga0495677_0018811 3300047445 Bacteria 2505
448 Ga0495677_0039692 3300047445 Bacteria 1721
449 Ga0495677_0047254 3300047445 Bacteria 1580
450 Ga0495677_0110618 3300047445 Bacteria 1044
451 Ga0495679_005084 3300047446 Bacteria 5902
452 Ga0495679_011201 3300047446 Bacteria 3476
453 Ga0495679_022801 3300047446 Bacteria 2136
454 Ga0495679_038321 3300047446 Bacteria 1501
455 Ga0495685_000467 3300047447 Bacteria 12601
456 Ga0495685_007270 3300047447 Bacteria 3652
457 Ga0495681_0001052 3300047470 Bacteria 21061
458 Ga0495681_0007851 3300047470 Bacteria 6749
459 Ga0495681_0015301 3300047470 Bacteria 4347
460 Ga0495681_0017521 3300047470 Bacteria 3973
461 Ga0495681_0054741 3300047470 Bacteria 1863
462 Ga0495681_0175945 3300047470 Bacteria 882
463 Ga0495686_0003619 3300047472 Bacteria 13255
464 Ga0495686_0185132 3300047472 Bacteria 1204
465 Ga0495593_0086645 3300047673 Bacteria 1615
466 Ga0495602_0020868 3300048088 Bacteria 6465
467 Ga0495614_0025409 3300048089 Bacteria 2554
468 Ga0495614_0068542 3300048089 Bacteria 1527
469 Ga0495614_0168517 3300048089 Bacteria 982
470 Ga0495626_0000037 3300048091 Bacteria 178573
471 Ga0495626_0000746 3300048091 Bacteria 30036
472 Ga0495626_0003279 3300048091 Bacteria 10448
473 Ga0495626_0005014 3300048091 Bacteria 7908
474 Ga0495626_0006253 3300048091 Bacteria 6801
475 Ga0495626_0006558 3300048091 Bacteria 6606
476 Ga0495626_0006572 3300048091 Bacteria 6596
477 Ga0495626_0024942 3300048091 Bacteria 2927
478 Ga0495626_0036537 3300048091 Bacteria 2339
479 Ga0495626_0048010 3300048091 Bacteria 1982
480 Ga0495626_0084139 3300048091 Bacteria 1408
481 Ga0496100_0027699 3300048903 Bacteria 3487
482 Ga0496100_0338969 3300048903 Bacteria 1133
483 Ga0496100_0499875 3300048903 Bacteria 937
484 Ga0496101_0042167 3300048904 Bacteria 3257
485 Ga0496102_0000151 3300048905 Bacteria 94403
486 Ga0496103_0311333 3300048906 Bacteria 1013
487 Ga0496106_0026845 3300048909 Bacteria 4288
488 Ga0496106_0177282 3300048909 Bacteria 1691
489 Ga0496107_0014585 3300048910 Bacteria 5500
490 Ga0496109_0014499 3300048912 Bacteria 6856
491 Ga0496109_0109574 3300048912 Bacteria 2567
492 Ga0496109_0159248 3300048912 Bacteria 2115
493 Ga0496109_0928351 3300048912 Bacteria 808
494 Ga0496110_0000001 3300048913 Bacteria 232652
495 Ga0496113_0001093 3300048916 Bacteria 14686
496 Ga0496113_0031785 3300048916 Bacteria 3833
497 Ga0496113_0380757 3300048916 Bacteria 1132
498 Ga0496113_0812701 3300048916 Bacteria 742
499 Ga0496115_0043070 3300048918 Bacteria 3599
500 Ga0496115_0493553 3300048918 Bacteria 985
501 Ga0496122_0000712 3300048925 Bacteria 65645
502 Ga0496122_0003090 3300048925 Bacteria 22393
503 Ga0496123_0000502 3300048926 Bacteria 67921
504 Ga0496123_0051390 3300048926 Bacteria 2745
505 Ga0496124_0058011 3300048927 Bacteria 3258
506 Ga0496124_0069256 3300048927 Bacteria 2929
507 Ga0496124_0121275 3300048927 Bacteria 2089
508 Ga0496125_0002315 3300048928 Bacteria 25135
509 Ga0496125_0275856 3300048928 Bacteria 1045
510 Ga0495678_000025 3300049459 Bacteria 227891
511 Ga0495678_000286 3300049459 Bacteria 55456
512 Ga0495678_000438 3300049459 Bacteria 41566
513 Ga0495678_000705 3300049459 Bacteria 30390
514 Ga0495678_006386 3300049459 Bacteria 6283
515 Ga0495678_012740 3300049459 Bacteria 3974
516 Ga0495678_017977 3300049459 Bacteria 3188
517 Ga0495682_0004982 3300049460 Bacteria 5585
518 Ga0495682_0008366 3300049460 Bacteria 4077
519 Ga0495682_0138850 3300049460 Bacteria 868
520 8047679236 8047673197 Bacteria 7395230
521 Ga0495583_0098619
522 rootL2_10082194
523 Ga0070658_10222752
524 Ga0070658_10239131
525 Ga0070680_100053627
526 Ga0070660_100001948
527 Ga0070660_100013676
528 Ga0070660_100164059
529 Ga0070661_100095015
530 Ga0070659_100048852
531 Ga0070662_100297314
532 Ga0070664_100069805
533 Ga0070664_100128423
534 Ga0068852_100173009
535 Ga0068865_100146789
536 Ga0105245_10104905
537 Ga0105243_10186272
538 Ga0105241_10187724
539 Ga0157372_10382730
540 Ga0182006_1088788
541 Ga0182007_10059764
542 Ga0207705_10001979
543 Ga0207705_10120981
544 Ga0207705_10227412
545 Ga0207654_10111482
546 Ga0207660_10304871
547 Ga0207657_10005710
548 Ga0207657_10006504
549 Ga0207690_10015127
550 Ga0207690_10037101
551 Ga0207690_10126859
552 Ga0207686_10080396
553 Ga0207704_10289474
554 Ga0207679_10052950
555 Ga0207679_10150663
556 Ga0395899_0018597
557 Ga0395899_0034644
558 Ga0395899_0139673
559 Ga0395899_0153238
560 Ga0395899_0173255
561 Ga0395900_0011425
562 Ga0395900_0017921
563 Ga0395900_0027758
564 Ga0395900_0036060
565 Ga0395900_0037395
566 Ga0395900_0281088
567 Ga0395900_0306209
568 Ga0395898_0026783
569 Ga0395898_0037901
570 Ga0395898_0120107
571 Ga0395905_0016205
572 Ga0395905_0047286
573 Ga0395905_0058952
574 Ga0395905_0096295
575 Ga0395905_0131447
576 Ga0395905_0201374
577 Ga0395905_0345853
578 Ga0395905_0428713
579 Ga0395905_0481512
580 Ga0395901_0000212
581 Ga0395901_0000522
582 Ga0395901_0105097
583 Ga0395901_0127078
584 Ga0395901_0240976
585 Ga0395901_0254099
586 Ga0395901_0665803
587 Ga0439448_0002319
588 Ga0439448_0052362
589 Ga0439448_0075399
590 Ga0439450_001146
591 Ga0439455_0005982
592 Ga0439455_0035435
593 Ga0439458_0037429
594 Ga0439458_0039835
595 Ga0466969_0120271
596 Ga0466972_0040476
597 Ga0466965_0002093
598 Ga0466965_0164486
599 Ga0466966_0015081
600 Ga0466966_0026752
601 Ga0466961_0099822
602 Ga0466963_0180497
603 Ga0466964_0002325
604 Ga0466964_0070862
605 Ga0466968_0001426
606 Ga0466957_0042461
607 Ga0466957_0245329
608 Ga0466959_0542592
609 Ga0466958_0013292
610 Ga0466967_0012418
611 Ga0466967_0059299
612 Ga0466967_0829758
613 Ga0495617_001610
614 Ga0495627_000323
615 Ga0495590_0000008
616 Ga0495590_0006957
617 Ga0495591_000051
618 Ga0495638_0000027
619 Ga0495638_0032631
620 Ga0495638_0070726
621 Ga0495653_0014966
622 Ga0495653_0018324
623 Ga0495650_0009214
624 Ga0495650_0011817
625 Ga0495582_0029957
626 Ga0495605_0000049
627 Ga0495605_0000130
628 Ga0495605_0000766
629 Ga0495605_0007998
630 Ga0495605_0017554
631 Ga0495605_0027431
632 Ga0495605_0029444
633 Ga0495605_0033927
634 Ga0495605_0201720
635 Ga0495639_0012274
636 Ga0495584_0000001
637 Ga0495584_0000024
638 Ga0495584_0000164
639 Ga0495584_0000337
640 Ga0495584_0003779
641 Ga0495584_0007355
642 Ga0495584_0011557
643 Ga0495584_0028145
644 Ga0495584_0074608
645 Ga0495584_0169539
646 Ga0495585_0000003
647 Ga0495585_0000011
648 Ga0495585_0001202
649 Ga0495585_0002536
650 Ga0495585_0004170
651 Ga0495585_0007957
652 Ga0495585_0012871
653 Ga0495585_0030203
654 Ga0495585_0035496
655 Ga0495585_0050246
656 Ga0495585_0064525
657 Ga0495585_0131001
658 Ga0495585_0133018
659 Ga0495585_0161074
660 Ga0495594_0002901
661 Ga0495594_0003164
662 Ga0495594_0010694
663 Ga0495594_0013848
664 Ga0495594_0049562
665 Ga0495594_0139567
666 Ga0495596_0001361
667 Ga0495596_0001942
668 Ga0495596_0002176
669 Ga0495596_0003204
670 Ga0495596_0005547
671 Ga0495596_0010400
672 Ga0495596_0014036
673 Ga0495596_0022358
674 Ga0495596_0033392
675 Ga0495596_0057702
676 Ga0495607_0000715
677 Ga0495607_0002565
678 Ga0495607_0004536
679 Ga0495607_0005576
680 Ga0495607_0024051
681 Ga0495607_0069436
682 Ga0495607_0106463
683 Ga0495583_0000006
684 Ga0495583_0000095
685 Ga0495583_0000381
686 Ga0495583_0000738
687 Ga0495583_0001723
688 Ga0495583_0002006
689 Ga0495583_0006928
690 Ga0495583_0018897
691 Ga0495583_0037501
692 Ga0495583_0038182
693 Ga0495583_0049723
694 Ga0495583_0051857
695 Ga0495583_0072831
696 Ga0495583_0084683
697 Ga0495583_0124873
698 Ga0495583_0130586
699 Ga0495606_0017106
700 Ga0495606_0021514
701 Ga0495606_0026639
702 Ga0495606_0044604
703 Ga0495606_0083347
704 Ga0495606_0085240
705 Ga0495606_0086496
706 Ga0495606_0173221
707 Ga0495606_0210592
708 Ga0495610_0014285
709 Ga0495616_0000075
710 Ga0495616_0000170
711 Ga0495616_0002668
712 Ga0495616_0005917
713 Ga0495616_0014805
714 Ga0495616_0018401
715 Ga0495616_0018802
716 Ga0495616_0021712
717 Ga0495616_0028498
718 Ga0495616_0030325
719 Ga0495616_0047398
720 Ga0495616_0064930
721 Ga0495616_0069927
722 Ga0495616_0131517
723 Ga0495620_0012616
724 Ga0495630_0317546
725 Ga0495631_0000039
726 Ga0495631_0006992
727 Ga0495631_0009595
728 Ga0495631_0009818
729 Ga0495631_0023846
730 Ga0495631_0025237
731 Ga0495631_0026481
732 Ga0495631_0033889
733 Ga0495631_0075228
734 Ga0495632_0000091
735 Ga0495632_0000420
736 Ga0495632_0001584
737 Ga0495632_0004770
738 Ga0495632_0007821
739 Ga0495632_0009614
740 Ga0495632_0027366
741 Ga0495632_0038308
742 Ga0495637_0000009
743 Ga0495637_0021615
744 Ga0495643_0000065
745 Ga0495643_0001833
746 Ga0495643_0002583
747 Ga0495643_0018411
748 Ga0495643_0022518
749 Ga0495643_0024649
750 Ga0495643_0118051
751 Ga0495643_0215837
752 Ga0495644_0001514
753 Ga0495644_0001558
754 Ga0495644_0011182
755 Ga0495644_0011598
756 Ga0495644_0037403
757 Ga0495644_0066874
758 Ga0495644_0125696
759 Ga0495648_0000031
760 Ga0495648_0000078
761 Ga0495648_0000883
762 Ga0495648_0000928
763 Ga0495648_0005054
764 Ga0495648_0019142
765 Ga0495648_0020883
766 Ga0495648_0178253
767 Ga0495666_0008568
768 Ga0495666_0053404
769 Ga0495666_0064435
770 Ga0495666_0152904
771 Ga0495666_0152936
772 Ga0495642_0000012
773 Ga0495642_0000326
774 Ga0495642_0000791
775 Ga0495642_0002249
776 Ga0495642_0002396
777 Ga0495642_0003658
778 Ga0495642_0005649
779 Ga0495642_0008366
780 Ga0495642_0014076
781 Ga0495642_0021133
782 Ga0495642_0022834
783 Ga0495642_0053173
784 Ga0495642_0116961
785 Ga0495652_0231104
786 Ga0495654_0007354
787 Ga0495654_0022089
788 Ga0495654_0026560
789 Ga0495665_0052028
790 Ga0495586_0003505
791 Ga0495586_0035227
792 Ga0495586_0145114
793 Ga0495587_0030203
794 Ga0495587_0134847
795 Ga0495587_0181666
796 Ga0495587_0278515
797 Ga0495609_0000001
798 Ga0495609_0000678
799 Ga0495609_0001091
800 Ga0495609_0004200
801 Ga0495609_0007558
802 Ga0495609_0011462
803 Ga0495609_0033965
804 Ga0495609_0047139
805 Ga0495609_0055265
806 Ga0495609_0154418
807 Ga0495609_0173321
808 Ga0495597_0000009
809 Ga0495597_0000029
810 Ga0495597_0000335
811 Ga0495597_0001211
812 Ga0495597_0006071
813 Ga0495597_0006309
814 Ga0495597_0022701
815 Ga0495597_0039130
816 Ga0495622_0000043
817 Ga0495622_0014417
818 Ga0495633_0000381
819 Ga0495633_0003347
820 Ga0495633_0006315
821 Ga0495633_0010310
822 Ga0495633_0011581
823 Ga0495633_0012338
824 Ga0495633_0021221
825 Ga0495633_0038213
826 Ga0495633_0044461
827 Ga0495633_0046717
828 Ga0495633_0057318
829 Ga0495633_0093925
830 Ga0495633_0145337
831 Ga0495633_0229320
832 Ga0495656_0012465
833 Ga0495656_0071189
834 Ga0495656_0154011
835 Ga0495656_0238854
836 Ga0495656_0257024
837 Ga0495668_0000096
838 Ga0495668_0000180
839 Ga0495668_0000946
840 Ga0495668_0001031
841 Ga0495668_0003852
842 Ga0495668_0005029
843 Ga0495668_0010507
844 Ga0495668_0024059
845 Ga0495668_0096289
846 Ga0495668_0101198
847 Ga0495668_0156895
848 Ga0495668_0224180
849 Ga0495668_0260962
850 Ga0495611_0000013
851 Ga0495611_0001317
852 Ga0495611_0019331
853 Ga0495611_0025421
854 Ga0495611_0037477
855 Ga0495611_0075636
856 Ga0495611_0153758
857 Ga0495625_0000053
858 Ga0495625_0020961
859 Ga0495625_0037231
860 Ga0495625_0046448
861 Ga0495625_0069630
862 Ga0495625_0071441
863 Ga0495625_0094345
864 Ga0495625_0107547
865 Ga0495635_0009894
866 Ga0495661_0000023
867 Ga0495661_0000800
868 Ga0495661_0007384
869 Ga0495661_0009477
870 Ga0495661_0009805
871 Ga0495661_0011754
872 Ga0495661_0019334
873 Ga0495661_0027310
874 Ga0495661_0029149
875 Ga0495661_0056055
876 Ga0495661_0115437
877 Ga0495588_0000041
878 Ga0495588_0002574
879 Ga0495588_0051742
880 Ga0495588_0069199
881 Ga0495588_0073261
882 Ga0495623_0005448
883 Ga0495623_0030224
884 Ga0495669_0000017
885 Ga0495669_0005621
886 Ga0495669_0006571
887 Ga0495669_0012102
888 Ga0495669_0013892
889 Ga0495669_0046588
890 Ga0495669_0063676
891 Ga0495669_0109063
892 Ga0495669_0135603
893 Ga0495613_0067509
894 Ga0495670_0003492
895 Ga0495670_0003649
896 Ga0495670_0003881
897 Ga0495670_0010490
898 Ga0495670_0020043
899 Ga0495670_0022042
900 Ga0495670_0028834
901 Ga0495670_0031107
902 Ga0495670_0135724
903 Ga0495670_0188444
904 Ga0495671_0000590
905 Ga0495671_0001741
906 Ga0495671_0011815
907 Ga0495649_0000062
908 Ga0495649_0001085
909 Ga0495649_0029917
910 Ga0495649_0157700
911 Ga0495649_0186604
912 Ga0495649_0208129
913 Ga0495649_0228514
914 Ga0495589_0000027
915 Ga0495589_0000034
916 Ga0495589_0000162
917 Ga0495589_0003493
918 Ga0495589_0006982
919 Ga0495589_0019503
920 Ga0495589_0020901
921 Ga0495589_0035342
922 Ga0495589_0079531
923 Ga0495660_0000132
924 Ga0495660_0001676
925 Ga0495660_0003722
926 Ga0495660_0007521
927 Ga0495660_0008925
928 Ga0495660_0042908
929 Ga0495660_0072131
930 Ga0495581_0005113
931 Ga0495604_0027207
932 Ga0495636_0008727
933 Ga0495672_0000055
934 Ga0495672_0000231
935 Ga0495672_0010993
936 Ga0495672_0011034
937 Ga0495672_0012790
938 Ga0495672_0029080
939 Ga0495676_0018708
940 Ga0495676_0051329
941 Ga0495680_0002129
942 Ga0495683_0000005
943 Ga0495683_0000222
944 Ga0495683_0003913
945 Ga0495683_0029976
946 Ga0495683_0032621
947 Ga0495683_0033202
948 Ga0495683_0093508
949 Ga0495683_0105030
950 Ga0495687_000012
951 Ga0495687_000023
952 Ga0495687_000027
953 Ga0495687_000048
954 Ga0495687_000535
955 Ga0495687_012520
956 Ga0495687_070820
957 Ga0495687_105865
958 Ga0495675_0043365
959 Ga0495675_0100812
960 Ga0495677_0000001
961 Ga0495677_0000216
962 Ga0495677_0002569
963 Ga0495677_0004323
964 Ga0495677_0004385
965 Ga0495677_0004727
966 Ga0495677_0010116
967 Ga0495677_0018811
968 Ga0495677_0039692
969 Ga0495677_0047254
970 Ga0495677_0110618
971 Ga0495679_005084
972 Ga0495679_011201
973 Ga0495679_022801
974 Ga0495679_038321
975 Ga0495685_000467
976 Ga0495685_007270
977 Ga0495681_0001052
978 Ga0495681_0007851
979 Ga0495681_0015301
980 Ga0495681_0017521
981 Ga0495681_0054741
982 Ga0495681_0175945
983 Ga0495686_0003619
984 Ga0495686_0185132
985 Ga0495593_0086645
986 Ga0495602_0020868
987 Ga0495614_0025409
988 Ga0495614_0068542
989 Ga0495614_0168517
990 Ga0495626_0000037
991 Ga0495626_0000746
992 Ga0495626_0003279
993 Ga0495626_0005014
994 Ga0495626_0006253
995 Ga0495626_0006558
996 Ga0495626_0006572
997 Ga0495626_0024942
998 Ga0495626_0036537
999 Ga0495626_0048010
1000 Ga0495626_0084139
1001 Ga0496100_0027699
1002 Ga0496100_0338969
1003 Ga0496100_0499875
1004 Ga0496101_0042167
1005 Ga0496102_0000151
1006 Ga0496103_0311333
1007 Ga0496106_0026845
1008 Ga0496106_0177282
1009 Ga0496107_0014585
1010 Ga0496109_0014499
1011 Ga0496109_0109574
1012 Ga0496109_0159248
1013 Ga0496109_0928351
1014 Ga0496110_0000001
1015 Ga0496113_0001093
1016 Ga0496113_0031785
1017 Ga0496113_0380757
1018 Ga0496113_0812701
1019 Ga0496115_0043070
1020 Ga0496115_0493553
1021 Ga0496122_0000712
1022 Ga0496122_0003090
1023 Ga0496123_0000502
1024 Ga0496123_0051390
1025 Ga0496124_0058011
1026 Ga0496124_0069256
1027 Ga0496124_0121275
1028 Ga0496125_0002315
1029 Ga0496125_0275856
1030 Ga0495678_000025
1031 Ga0495678_000286
1032 Ga0495678_000438
1033 Ga0495678_000705
1034 Ga0495678_006386
1035 Ga0495678_012740
1036 Ga0495678_017977
1037 Ga0495682_0004982
1038 Ga0495682_0008366
1039 Ga0495682_0138850
1040 8047679236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

35

156

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6357 16 183
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.5302 16 183
3kwp-assembly1.cif.gz_A-2 crystal structure of putative methyltransferase from lactobacillus brevis 0.5187 37 147
3hh1-assembly2.cif.gz_C the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.516 38 147
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.509 16 186
ID Description Score Start End Superfamily
af_Q22267_77_205_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.759 31 148 3.40.50.2000
af_Q54Q97_99_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7517 41 122 3.40.50.620
af_P26647_52_180_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7284 32 148 3.40.50.620
af_Q8I5S7_22_233_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7276 35 151 3.40.50.2000
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7216 33 150 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7W2EHU9-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9646 1 198 GO:0016746
AF-A0A7Y1ZEX5-F1-model_v4 Acyltransferase 0.9571 101 196 GO:0016746
AF-A0A376ECF7-F1-model_v4 deleted 0.9566 118 196
AF-A0A2U2HFS2-F1-model_v4 Glycerol acyltransferase 0.9548 1 199 GO:0003841
GO:0006654
AF-A0A7Y5EZY3-F1-model_v4 Lysophospholipid acyltransferase family protein 0.9504 12 197 GO:0003841
GO:0006654

Map