F458503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 520 | 274 | 493 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100221821|Ga0070682_1002218211 |
| Length | 302 |
| Sequence | MTLIPSYKYNKIVNFLLMKLIRFGKNGEEKPGIIIDDVYYDVSGIGEDYNETFFETGGLKRLEKFVKENKNTLPKIRSDIRLGSPVGRPSKIVCIGLNYADHAKETNAAVPSEPVIFLKASSSLCGPFDDIIIPKNSEKTDWEVELAVVIEKKASYVDEADAMNYVAGYCLHNDVSERNFQLERNGTWDKGKGCDTFAPIGPWLVTKDEIKDVNNLRLWLTVNGRTMQDGTTSNLIFKIPFLVSYVSQFMSLLPGDLISTGTPAGVGLGMKPNVYLRDGDVVELGIDGLGKAKQNVRAYQYG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 4 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 5 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 6 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 7 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 8 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 9 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 10 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 11 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 12 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 13 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 14 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 15 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 16 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 17 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 18 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 19 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 20 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 21 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 22 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 23 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 24 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 25 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 26 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 27 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 28 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 29 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 30 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 194 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 203 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 204 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 205 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 206 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 207 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 252 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 262 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 263 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 264 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 265 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 267 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 268 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 269 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 270 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 271 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 273 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 274 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.81 |
| Metatranscriptomes | 0 |
| Isolates | 5.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.12 |
| Nodule | 0 |
| Rhizoplane | 0.96 |
| Rhizosphere | 84.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1583141 | 2162886007 | Bacteria | 3127 |
| 2 | JGI24740J21852_10007571 | 3300001979 | Bacteria | 4399 |
| 3 | JGI25154J39366_1000007 | 3300002738 | Bacteria | 335932 |
| 4 | JGI25157J39369_1007547 | 3300002741 | Bacteria | 1564 |
| 5 | JGI25150J39212_1000057 | 3300002774 | Bacteria | 66456 |
| 6 | JGI25151J46595_10000229 | 3300003187 | Bacteria | 66456 |
| 7 | JGI25153J46596_10000164 | 3300003215 | Bacteria | 66576 |
| 8 | JGI25153J46596_10010292 | 3300003215 | Bacteria | 4246 |
| 9 | rootL2_10005675 | 3300003322 | Bacteria | 5197 |
| 10 | rootL2_10037414 | 3300003322 | Bacteria | 5002 |
| 11 | rootL2_10215410 | 3300003322 | Bacteria | 2458 |
| 12 | rootL2_10275501 | 3300003322 | Unclassified | 2253 |
| 13 | rootH1_10029353 | 3300003323 | Unclassified | 3862 |
| 14 | rootH1_10114266 | 3300003323 | Bacteria | 6762 |
| 15 | rootH1_10118678 | 3300003323 | Bacteria | 9644 |
| 16 | rootH1_10140347 | 3300003323 | Bacteria | 4176 |
| 17 | JGI25160J50197_1011861 | 3300003354 | Bacteria | 3058 |
| 18 | Ga0055536_1000011 | 3300003781 | Bacteria | 275969 |
| 19 | Ga0055530_10009676 | 3300003791 | Bacteria | 3670 |
| 20 | Ga0055531_10000020 | 3300003794 | Bacteria | 170186 |
| 21 | Ga0065165_1011718 | 3300005262 | Bacteria | 3624 |
| 22 | Ga0065714_10001191 | 3300005288 | Bacteria | 2235 |
| 23 | Ga0065714_10064816 | 3300005288 | Bacteria | 18060 |
| 24 | Ga0065714_10101906 | 3300005288 | Bacteria | 1633 |
| 25 | Ga0065704_10072354 | 3300005289 | Bacteria | 8680 |
| 26 | Ga0070658_10002567 | 3300005327 | Bacteria | 15136 |
| 27 | Ga0070658_10146353 | 3300005327 | Bacteria | 1976 |
| 28 | Ga0070683_100000662 | 3300005329 | Bacteria | 24891 |
| 29 | Ga0070683_100001724 | 3300005329 | Bacteria | 17005 |
| 30 | Ga0070683_100017331 | 3300005329 | Bacteria | 6366 |
| 31 | Ga0070683_100025005 | 3300005329 | Bacteria | 5356 |
| 32 | Ga0068869_100001942 | 3300005334 | Bacteria | 12403 |
| 33 | Ga0068869_100136677 | 3300005334 | Unclassified | 1889 |
| 34 | Ga0068869_100189904 | 3300005334 | Bacteria | 1615 |
| 35 | Ga0068869_100273248 | 3300005334 | Bacteria | 1357 |
| 36 | Ga0068869_100398916 | 3300005334 | Bacteria | 1131 |
| 37 | Ga0070666_10200457 | 3300005335 | Unclassified | 1404 |
| 38 | Ga0070682_100020469 | 3300005337 | Bacteria | 3892 |
| 39 | Ga0070682_100057376 | 3300005337 | Bacteria | 2453 |
| 40 | Ga0070682_100221821 | 3300005337 | Bacteria | 1346 |
| 41 | Ga0068868_100008319 | 3300005338 | Bacteria | 7425 |
| 42 | Ga0068868_100019295 | 3300005338 | Bacteria | 5108 |
| 43 | Ga0070660_100001082 | 3300005339 | Bacteria | 18309 |
| 44 | Ga0070660_100016725 | 3300005339 | Bacteria | 5332 |
| 45 | Ga0070660_100018715 | 3300005339 | Bacteria | 5066 |
| 46 | Ga0070660_100145900 | 3300005339 | Bacteria | 1901 |
| 47 | Ga0070689_100006896 | 3300005340 | Bacteria | 7905 |
| 48 | Ga0070689_100008285 | 3300005340 | Bacteria | 7315 |
| 49 | Ga0070661_100038728 | 3300005344 | Bacteria | 3471 |
| 50 | Ga0070661_100086262 | 3300005344 | Bacteria | 2321 |
| 51 | Ga0070692_10290318 | 3300005345 | Bacteria | 995 |
| 52 | Ga0070669_100042261 | 3300005353 | Bacteria | 3317 |
| 53 | Ga0070675_100051747 | 3300005354 | Bacteria | 3376 |
| 54 | Ga0070675_100065316 | 3300005354 | Bacteria | 3008 |
| 55 | Ga0070675_100260944 | 3300005354 | Bacteria | 1518 |
| 56 | Ga0070675_100516621 | 3300005354 | Unclassified | 1077 |
| 57 | Ga0070671_100031889 | 3300005355 | Bacteria | 4356 |
| 58 | Ga0070671_100065207 | 3300005355 | Bacteria | 3033 |
| 59 | Ga0070671_100311668 | 3300005355 | Bacteria | 1340 |
| 60 | Ga0070674_100035124 | 3300005356 | Bacteria | 3355 |
| 61 | Ga0070673_100010330 | 3300005364 | Bacteria | 6315 |
| 62 | Ga0070673_100043172 | 3300005364 | Bacteria | 3482 |
| 63 | Ga0070673_100140388 | 3300005364 | Bacteria | 2037 |
| 64 | Ga0070673_100178364 | 3300005364 | Unclassified | 1817 |
| 65 | Ga0070688_100209991 | 3300005365 | Unclassified | 1366 |
| 66 | Ga0070659_100002774 | 3300005366 | Bacteria | 12470 |
| 67 | Ga0070659_100005067 | 3300005366 | Bacteria | 9446 |
| 68 | Ga0070659_100028075 | 3300005366 | Bacteria | 4342 |
| 69 | Ga0070659_100062646 | 3300005366 | Bacteria | 2940 |
| 70 | Ga0070659_100261221 | 3300005366 | Bacteria | 1437 |
| 71 | Ga0070659_100356393 | 3300005366 | Unclassified | 1228 |
| 72 | Ga0070667_100022919 | 3300005367 | Bacteria | 5177 |
| 73 | Ga0070667_100143922 | 3300005367 | Bacteria | 2090 |
| 74 | Ga0070694_100009375 | 3300005444 | Bacteria | 6009 |
| 75 | Ga0070708_100211966 | 3300005445 | Bacteria | 1815 |
| 76 | Ga0070663_100168612 | 3300005455 | Unclassified | 1691 |
| 77 | Ga0070663_100436919 | 3300005455 | Bacteria | 1076 |
| 78 | Ga0070678_100151871 | 3300005456 | Bacteria | 1866 |
| 79 | Ga0070678_100294265 | 3300005456 | Unclassified | 1377 |
| 80 | Ga0070662_100007507 | 3300005457 | Bacteria | 7071 |
| 81 | Ga0070662_100018322 | 3300005457 | Bacteria | 4735 |
| 82 | Ga0070662_100021170 | 3300005457 | Bacteria | 4438 |
| 83 | Ga0070662_100214274 | 3300005457 | Unclassified | 1534 |
| 84 | Ga0070681_10172250 | 3300005458 | Bacteria | 2086 |
| 85 | Ga0070681_10347823 | 3300005458 | Bacteria | 1393 |
| 86 | Ga0070685_10291492 | 3300005466 | Bacteria | 1096 |
| 87 | Ga0070707_100366821 | 3300005468 | Bacteria | 1399 |
| 88 | Ga0070679_100000484 | 3300005530 | Bacteria | 34148 |
| 89 | Ga0070679_100004268 | 3300005530 | Bacteria | 13186 |
| 90 | Ga0070679_100242189 | 3300005530 | Unclassified | 1761 |
| 91 | Ga0070684_100000417 | 3300005535 | Bacteria | 29183 |
| 92 | Ga0070684_100005368 | 3300005535 | Bacteria | 9819 |
| 93 | Ga0070684_100115144 | 3300005535 | Bacteria | 2414 |
| 94 | Ga0070684_100269577 | 3300005535 | Bacteria | 1558 |
| 95 | Ga0068853_100014103 | 3300005539 | Bacteria | 6543 |
| 96 | Ga0068853_100042478 | 3300005539 | Bacteria | 3887 |
| 97 | Ga0068853_100053696 | 3300005539 | Bacteria | 3470 |
| 98 | Ga0068853_100184681 | 3300005539 | Bacteria | 1892 |
| 99 | Ga0070686_100116719 | 3300005544 | Unclassified | 1827 |
| 100 | Ga0070695_100003070 | 3300005545 | Bacteria | 9714 |
| 101 | Ga0070696_100257466 | 3300005546 | Bacteria | 1322 |
| 102 | Ga0070693_100177956 | 3300005547 | Unclassified | 1367 |
| 103 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 104 | Ga0070665_100456546 | 3300005548 | Bacteria | 1288 |
| 105 | Ga0070704_100004154 | 3300005549 | Bacteria | 8357 |
| 106 | Ga0068855_100000360 | 3300005563 | Bacteria | 56448 |
| 107 | Ga0068855_100027207 | 3300005563 | Bacteria | 6842 |
| 108 | Ga0068855_100044591 | 3300005563 | Bacteria | 5248 |
| 109 | Ga0068855_100048426 | 3300005563 | Bacteria | 5016 |
| 110 | Ga0068855_100148926 | 3300005563 | Bacteria | 2662 |
| 111 | Ga0068855_100150462 | 3300005563 | Unclassified | 2647 |
| 112 | Ga0068855_100532704 | 3300005563 | Bacteria | 1273 |
| 113 | Ga0070664_100000360 | 3300005564 | Bacteria | 33570 |
| 114 | Ga0070664_100007587 | 3300005564 | Bacteria | 8758 |
| 115 | Ga0070664_100012371 | 3300005564 | Bacteria | 6935 |
| 116 | Ga0070664_100132763 | 3300005564 | Unclassified | 2188 |
| 117 | Ga0070664_100221358 | 3300005564 | Bacteria | 1693 |
| 118 | Ga0070664_100374352 | 3300005564 | Bacteria | 1299 |
| 119 | Ga0068857_100000323 | 3300005577 | Bacteria | 32881 |
| 120 | Ga0068857_100042788 | 3300005577 | Bacteria | 4019 |
| 121 | Ga0068857_100078124 | 3300005577 | Bacteria | 2954 |
| 122 | Ga0068854_100054505 | 3300005578 | Bacteria | 2876 |
| 123 | Ga0068854_100101274 | 3300005578 | Bacteria | 2160 |
| 124 | Ga0068854_100402360 | 3300005578 | Bacteria | 1133 |
| 125 | Ga0068856_100004342 | 3300005614 | Bacteria | 14127 |
| 126 | Ga0068856_100018340 | 3300005614 | Bacteria | 6784 |
| 127 | Ga0068856_100094214 | 3300005614 | Bacteria | 2981 |
| 128 | Ga0068856_100116075 | 3300005614 | Bacteria | 2677 |
| 129 | Ga0068856_100188479 | 3300005614 | Bacteria | 2076 |
| 130 | Ga0068852_100039083 | 3300005616 | Bacteria | 3993 |
| 131 | Ga0068852_100041718 | 3300005616 | Bacteria | 3880 |
| 132 | Ga0068859_100028162 | 3300005617 | Bacteria | 5633 |
| 133 | Ga0068859_100032535 | 3300005617 | Bacteria | 5238 |
| 134 | Ga0068859_100037950 | 3300005617 | Bacteria | 4834 |
| 135 | Ga0068859_100048570 | 3300005617 | Bacteria | 4263 |
| 136 | Ga0068859_100066384 | 3300005617 | Bacteria | 3643 |
| 137 | Ga0068859_100078812 | 3300005617 | Bacteria | 3334 |
| 138 | Ga0068864_100087836 | 3300005618 | Bacteria | 2738 |
| 139 | Ga0068864_100327623 | 3300005618 | Bacteria | 1440 |
| 140 | Ga0068851_10025221 | 3300005834 | Bacteria | 2916 |
| 141 | Ga0068863_100010153 | 3300005841 | Bacteria | 9156 |
| 142 | Ga0068863_100261126 | 3300005841 | Bacteria | 1674 |
| 143 | Ga0068858_100096731 | 3300005842 | Bacteria | 2752 |
| 144 | Ga0068860_100026962 | 3300005843 | Bacteria | 5537 |
| 145 | Ga0068860_100036841 | 3300005843 | Bacteria | 4684 |
| 146 | Ga0068860_100052154 | 3300005843 | Bacteria | 3891 |
| 147 | Ga0068862_100019860 | 3300005844 | Bacteria | 5610 |
| 148 | Ga0068862_100024670 | 3300005844 | Bacteria | 5046 |
| 149 | Ga0068862_100078764 | 3300005844 | Bacteria | 2856 |
| 150 | Ga0081455_10014354 | 3300005937 | Bacteria | 7772 |
| 151 | Ga0097621_100157334 | 3300006237 | Bacteria | 1951 |
| 152 | Ga0097621_100432602 | 3300006237 | Bacteria | 1183 |
| 153 | Ga0068871_100028668 | 3300006358 | Bacteria | 4367 |
| 154 | Ga0068871_100060592 | 3300006358 | Bacteria | 3087 |
| 155 | Ga0068871_100138233 | 3300006358 | Unclassified | 2070 |
| 156 | Ga0068871_100141162 | 3300006358 | Bacteria | 2048 |
| 157 | Ga0068871_100561494 | 3300006358 | Unclassified | 1035 |
| 158 | Ga0075433_10171645 | 3300006852 | Bacteria | 1930 |
| 159 | Ga0075434_100465277 | 3300006871 | Bacteria | 1286 |
| 160 | Ga0097620_100028161 | 3300006931 | Bacteria | 5633 |
| 161 | Ga0097620_100032535 | 3300006931 | Bacteria | 5238 |
| 162 | Ga0097620_100037950 | 3300006931 | Bacteria | 4834 |
| 163 | Ga0097620_100048565 | 3300006931 | Bacteria | 4263 |
| 164 | Ga0097620_100066384 | 3300006931 | Bacteria | 3643 |
| 165 | Ga0097620_100078812 | 3300006931 | Bacteria | 3334 |
| 166 | Ga0075435_100084027 | 3300007076 | Bacteria | 2618 |
| 167 | Ga0105251_10124678 | 3300009011 | Bacteria | 1169 |
| 168 | Ga0105240_10010765 | 3300009093 | Bacteria | 12824 |
| 169 | Ga0105240_10213603 | 3300009093 | Bacteria | 2252 |
| 170 | Ga0105240_10280398 | 3300009093 | Bacteria | 1914 |
| 171 | Ga0111539_10058661 | 3300009094 | Bacteria | 4566 |
| 172 | Ga0114129_10007108 | 3300009147 | Bacteria | 15926 |
| 173 | Ga0114129_10316847 | 3300009147 | Bacteria | 2074 |
| 174 | Ga0105242_10094888 | 3300009176 | Bacteria | 2517 |
| 175 | Ga0105248_10125559 | 3300009177 | Bacteria | 2895 |
| 176 | Ga0105248_10269510 | 3300009177 | Unclassified | 1917 |
| 177 | Ga0105237_10001536 | 3300009545 | Bacteria | 30198 |
| 178 | Ga0105237_10026706 | 3300009545 | Bacteria | 5901 |
| 179 | Ga0105237_10032188 | 3300009545 | Bacteria | 5311 |
| 180 | Ga0105238_10428263 | 3300009551 | Bacteria | 1319 |
| 181 | Ga0105249_10268600 | 3300009553 | Bacteria | 1698 |
| 182 | Ga0105239_10000280 | 3300010375 | Bacteria | 75222 |
| 183 | Ga0105239_10002087 | 3300010375 | Bacteria | 25905 |
| 184 | Ga0105239_10040348 | 3300010375 | Bacteria | 5115 |
| 185 | Ga0105239_10076122 | 3300010375 | Bacteria | 3691 |
| 186 | Ga0105239_10412246 | 3300010375 | Unclassified | 1530 |
| 187 | Ga0105239_10476226 | 3300010375 | Bacteria | 1418 |
| 188 | Ga0105246_10016410 | 3300011119 | Bacteria | 4690 |
| 189 | Ga0105246_10042710 | 3300011119 | Unclassified | 3071 |
| 190 | Ga0157373_10000005 | 3300013100 | Bacteria | 262158 |
| 191 | Ga0157373_10002699 | 3300013100 | Bacteria | 13449 |
| 192 | Ga0157373_10003444 | 3300013100 | Bacteria | 11972 |
| 193 | Ga0157373_10008374 | 3300013100 | Bacteria | 7681 |
| 194 | Ga0157373_10019198 | 3300013100 | Bacteria | 4977 |
| 195 | Ga0157373_10043695 | 3300013100 | Bacteria | 3200 |
| 196 | Ga0157371_10000124 | 3300013102 | Bacteria | 117860 |
| 197 | Ga0157371_10003262 | 3300013102 | Bacteria | 14878 |
| 198 | Ga0157371_10006892 | 3300013102 | Bacteria | 9275 |
| 199 | Ga0157371_10029255 | 3300013102 | Bacteria | 3987 |
| 200 | Ga0157371_10205796 | 3300013102 | Unclassified | 1411 |
| 201 | Ga0157370_10015356 | 3300013104 | Bacteria | 7784 |
| 202 | Ga0157370_10044831 | 3300013104 | Bacteria | 4247 |
| 203 | Ga0157370_10081676 | 3300013104 | Bacteria | 3041 |
| 204 | Ga0157370_10149638 | 3300013104 | Bacteria | 2173 |
| 205 | Ga0157370_10182328 | 3300013104 | Bacteria | 1951 |
| 206 | Ga0157370_10230144 | 3300013104 | Bacteria | 1716 |
| 207 | Ga0157370_10329469 | 3300013104 | Bacteria | 1408 |
| 208 | Ga0157370_10351156 | 3300013104 | Bacteria | 1359 |
| 209 | Ga0157370_10537853 | 3300013104 | Bacteria | 1071 |
| 210 | Ga0157369_10000002 | 3300013105 | Bacteria | 524510 |
| 211 | Ga0157369_10018091 | 3300013105 | Bacteria | 7904 |
| 212 | Ga0157369_10054509 | 3300013105 | Bacteria | 4318 |
| 213 | Ga0157369_10062149 | 3300013105 | Bacteria | 4025 |
| 214 | Ga0157369_10303814 | 3300013105 | Bacteria | 1659 |
| 215 | Ga0157374_10006776 | 3300013296 | Bacteria | 9739 |
| 216 | Ga0157374_10007311 | 3300013296 | Bacteria | 9415 |
| 217 | Ga0157374_10023239 | 3300013296 | Bacteria | 5542 |
| 218 | Ga0157374_10057220 | 3300013296 | Bacteria | 3641 |
| 219 | Ga0157374_10327246 | 3300013296 | Unclassified | 1520 |
| 220 | Ga0157374_10465558 | 3300013296 | Bacteria | 1266 |
| 221 | Ga0157378_10163877 | 3300013297 | Bacteria | 2081 |
| 222 | Ga0163162_10006780 | 3300013306 | Bacteria | 11112 |
| 223 | Ga0163162_10007403 | 3300013306 | Bacteria | 10676 |
| 224 | Ga0163162_10024117 | 3300013306 | Bacteria | 6003 |
| 225 | Ga0163162_10038703 | 3300013306 | Bacteria | 4760 |
| 226 | Ga0163162_10039322 | 3300013306 | Bacteria | 4726 |
| 227 | Ga0163162_10267243 | 3300013306 | Bacteria | 1842 |
| 228 | Ga0157372_10000449 | 3300013307 | Bacteria | 45309 |
| 229 | Ga0157372_10093998 | 3300013307 | Bacteria | 3413 |
| 230 | Ga0157372_10156261 | 3300013307 | Bacteria | 2635 |
| 231 | Ga0157372_10334227 | 3300013307 | Bacteria | 1765 |
| 232 | Ga0157372_10601494 | 3300013307 | Bacteria | 1282 |
| 233 | Ga0157375_10002645 | 3300013308 | Bacteria | 15517 |
| 234 | Ga0157375_10046150 | 3300013308 | Bacteria | 4246 |
| 235 | Ga0157375_10839582 | 3300013308 | Unclassified | 1066 |
| 236 | Ga0163163_10246818 | 3300014325 | Bacteria | 1835 |
| 237 | Ga0182008_10000037 | 3300014497 | Bacteria | 129884 |
| 238 | Ga0182008_10000319 | 3300014497 | Bacteria | 37848 |
| 239 | Ga0157377_10083345 | 3300014745 | Bacteria | 1873 |
| 240 | Ga0157379_10015571 | 3300014968 | Bacteria | 6676 |
| 241 | Ga0157379_10143813 | 3300014968 | Bacteria | 2150 |
| 242 | Ga0157379_10161936 | 3300014968 | Bacteria | 2019 |
| 243 | Ga0157379_10172100 | 3300014968 | Unclassified | 1955 |
| 244 | Ga0157376_10034240 | 3300014969 | Unclassified | 4100 |
| 245 | Ga0157376_10058283 | 3300014969 | Bacteria | 3234 |
| 246 | Ga0182006_1000597 | 3300015261 | Bacteria | 26372 |
| 247 | Ga0182006_1001812 | 3300015261 | Bacteria | 12304 |
| 248 | Ga0182006_1009706 | 3300015261 | Bacteria | 4305 |
| 249 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 250 | Ga0183373_1010 | 3300015682 | Bacteria | 196982 |
| 251 | Ga0163161_10000930 | 3300017792 | Bacteria | 22600 |
| 252 | Ga0163161_10001712 | 3300017792 | Bacteria | 16070 |
| 253 | Ga0163161_10001917 | 3300017792 | Bacteria | 15190 |
| 254 | Ga0163161_10096314 | 3300017792 | Unclassified | 2196 |
| 255 | Ga0163161_10404531 | 3300017792 | Bacteria | 1095 |
| 256 | Ga0213876_10084459 | 3300021384 | Unclassified | 1680 |
| 257 | Ga0209436_100330 | 3300025208 | Bacteria | 21518 |
| 258 | Ga0209437_100089 | 3300025233 | Bacteria | 250476 |
| 259 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 260 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 261 | Ga0209026_1000698 | 3300025250 | Bacteria | 19945 |
| 262 | Ga0209026_1001164 | 3300025250 | Bacteria | 12249 |
| 263 | Ga0209026_1004091 | 3300025250 | Bacteria | 4496 |
| 264 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 265 | Ga0209130_1002521 | 3300025284 | Bacteria | 8997 |
| 266 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 267 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 268 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 269 | Ga0209758_1004196 | 3300025297 | Bacteria | 12227 |
| 270 | Ga0209050_1000016 | 3300025298 | Bacteria | 729149 |
| 271 | Ga0207426_1001505 | 3300025302 | Bacteria | 19050 |
| 272 | Ga0207426_1001587 | 3300025302 | Bacteria | 18222 |
| 273 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 274 | Ga0207697_10023220 | 3300025315 | Bacteria | 2539 |
| 275 | Ga0207697_10080861 | 3300025315 | Bacteria | 1369 |
| 276 | Ga0207655_1099966 | 3300025728 | Bacteria | 1001 |
| 277 | Ga0207647_10019002 | 3300025904 | Bacteria | 4629 |
| 278 | Ga0207645_10027321 | 3300025907 | Bacteria | 3686 |
| 279 | Ga0207645_10058288 | 3300025907 | Bacteria | 2465 |
| 280 | Ga0207643_10008915 | 3300025908 | Bacteria | 5387 |
| 281 | Ga0207705_10000494 | 3300025909 | Bacteria | 33635 |
| 282 | Ga0207705_10007832 | 3300025909 | Bacteria | 7845 |
| 283 | Ga0207707_10185507 | 3300025912 | Bacteria | 1815 |
| 284 | Ga0207695_10051070 | 3300025913 | Bacteria | 4344 |
| 285 | Ga0207695_10064702 | 3300025913 | Bacteria | 3763 |
| 286 | Ga0207695_10155415 | 3300025913 | Bacteria | 2222 |
| 287 | Ga0207671_10000983 | 3300025914 | Bacteria | 35275 |
| 288 | Ga0207671_10006269 | 3300025914 | Bacteria | 10641 |
| 289 | Ga0207660_10040992 | 3300025917 | Bacteria | 3243 |
| 290 | Ga0207662_10121353 | 3300025918 | Bacteria | 1640 |
| 291 | Ga0207657_10001634 | 3300025919 | Bacteria | 24147 |
| 292 | Ga0207657_10003056 | 3300025919 | Bacteria | 17905 |
| 293 | Ga0207657_10060013 | 3300025919 | Bacteria | 3265 |
| 294 | Ga0207657_10078237 | 3300025919 | Bacteria | 2785 |
| 295 | Ga0207649_10017024 | 3300025920 | Bacteria | 4114 |
| 296 | Ga0207649_10031708 | 3300025920 | Unclassified | 3144 |
| 297 | Ga0207652_10000011 | 3300025921 | Bacteria | 246742 |
| 298 | Ga0207652_10000043 | 3300025921 | Bacteria | 128581 |
| 299 | Ga0207652_10021792 | 3300025921 | Bacteria | 5292 |
| 300 | Ga0207681_10015596 | 3300025923 | Bacteria | 4741 |
| 301 | Ga0207650_10031374 | 3300025925 | Bacteria | 3837 |
| 302 | Ga0207687_10407093 | 3300025927 | Bacteria | 1120 |
| 303 | Ga0207644_10151696 | 3300025931 | Bacteria | 1794 |
| 304 | Ga0207644_10317946 | 3300025931 | Bacteria | 1258 |
| 305 | Ga0207690_10003665 | 3300025932 | Bacteria | 9145 |
| 306 | Ga0207690_10028013 | 3300025932 | Bacteria | 3566 |
| 307 | Ga0207690_10124049 | 3300025932 | Bacteria | 1880 |
| 308 | Ga0207690_10211158 | 3300025932 | Bacteria | 1480 |
| 309 | Ga0207690_10316368 | 3300025932 | Unclassified | 1226 |
| 310 | Ga0207706_10002652 | 3300025933 | Bacteria | 17429 |
| 311 | Ga0207706_10006057 | 3300025933 | Bacteria | 11244 |
| 312 | Ga0207706_10017808 | 3300025933 | Bacteria | 6400 |
| 313 | Ga0207670_10009679 | 3300025936 | Bacteria | 5512 |
| 314 | Ga0207669_10114871 | 3300025937 | Bacteria | 1813 |
| 315 | Ga0207691_10010366 | 3300025940 | Bacteria | 8939 |
| 316 | Ga0207691_10024494 | 3300025940 | Bacteria | 5676 |
| 317 | Ga0207691_10135874 | 3300025940 | Bacteria | 2168 |
| 318 | Ga0207691_10260600 | 3300025940 | Unclassified | 1495 |
| 319 | Ga0207711_10127656 | 3300025941 | Bacteria | 2277 |
| 320 | Ga0207711_10272027 | 3300025941 | Bacteria | 1559 |
| 321 | Ga0207689_10003219 | 3300025942 | Bacteria | 14956 |
| 322 | Ga0207689_10004134 | 3300025942 | Bacteria | 13188 |
| 323 | Ga0207689_10055565 | 3300025942 | Bacteria | 3258 |
| 324 | Ga0207689_10064649 | 3300025942 | Bacteria | 3009 |
| 325 | Ga0207689_10205433 | 3300025942 | Bacteria | 1627 |
| 326 | Ga0207689_10405942 | 3300025942 | Bacteria | 1136 |
| 327 | Ga0207661_10005273 | 3300025944 | Bacteria | 9099 |
| 328 | Ga0207661_10088997 | 3300025944 | Bacteria | 2567 |
| 329 | Ga0207661_10116829 | 3300025944 | Bacteria | 2265 |
| 330 | Ga0207661_10206807 | 3300025944 | Bacteria | 1728 |
| 331 | Ga0207679_10019908 | 3300025945 | Bacteria | 4520 |
| 332 | Ga0207679_10117060 | 3300025945 | Bacteria | 2114 |
| 333 | Ga0207679_10155819 | 3300025945 | Bacteria | 1865 |
| 334 | Ga0207679_10379106 | 3300025945 | Bacteria | 1239 |
| 335 | Ga0207679_10495832 | 3300025945 | Bacteria | 1089 |
| 336 | Ga0207667_10000430 | 3300025949 | Bacteria | 56466 |
| 337 | Ga0207667_10004619 | 3300025949 | Bacteria | 16896 |
| 338 | Ga0207667_10015868 | 3300025949 | Bacteria | 8533 |
| 339 | Ga0207667_10060771 | 3300025949 | Bacteria | 3955 |
| 340 | Ga0207667_10139458 | 3300025949 | Bacteria | 2496 |
| 341 | Ga0207667_10235988 | 3300025949 | Bacteria | 1872 |
| 342 | Ga0207651_10048170 | 3300025960 | Bacteria | 2879 |
| 343 | Ga0207651_10295440 | 3300025960 | Unclassified | 1345 |
| 344 | Ga0207712_10401773 | 3300025961 | Bacteria | 1152 |
| 345 | Ga0207640_10251369 | 3300025981 | Bacteria | 1372 |
| 346 | Ga0207640_10380274 | 3300025981 | Bacteria | 1144 |
| 347 | Ga0207658_10029060 | 3300025986 | Bacteria | 3899 |
| 348 | Ga0207658_10067215 | 3300025986 | Unclassified | 2699 |
| 349 | Ga0207677_10013772 | 3300026023 | Bacteria | 4697 |
| 350 | Ga0207677_10014146 | 3300026023 | Bacteria | 4649 |
| 351 | Ga0207677_10131974 | 3300026023 | Bacteria | 1898 |
| 352 | Ga0207639_10006556 | 3300026041 | Bacteria | 7914 |
| 353 | Ga0207639_10062669 | 3300026041 | Bacteria | 2877 |
| 354 | Ga0207639_10140044 | 3300026041 | Bacteria | 2014 |
| 355 | Ga0207639_10310770 | 3300026041 | Bacteria | 1396 |
| 356 | Ga0207678_10024389 | 3300026067 | Bacteria | 5281 |
| 357 | Ga0207702_10000165 | 3300026078 | Bacteria | 79066 |
| 358 | Ga0207702_10070362 | 3300026078 | Bacteria | 3009 |
| 359 | Ga0207702_10195720 | 3300026078 | Bacteria | 1871 |
| 360 | Ga0207641_10014633 | 3300026088 | Bacteria | 6432 |
| 361 | Ga0207641_10028898 | 3300026088 | Bacteria | 4583 |
| 362 | Ga0207648_10112157 | 3300026089 | Unclassified | 2394 |
| 363 | Ga0207648_10626776 | 3300026089 | Unclassified | 993 |
| 364 | Ga0207676_10012612 | 3300026095 | Bacteria | 6062 |
| 365 | Ga0207674_10001817 | 3300026116 | Bacteria | 27232 |
| 366 | Ga0207674_10065198 | 3300026116 | Bacteria | 3672 |
| 367 | Ga0207674_10094772 | 3300026116 | Unclassified | 2971 |
| 368 | Ga0207674_10099393 | 3300026116 | Bacteria | 2892 |
| 369 | Ga0207683_10059307 | 3300026121 | Bacteria | 3362 |
| 370 | Ga0207698_10073993 | 3300026142 | Bacteria | 2715 |
| 371 | Ga0207698_10076461 | 3300026142 | Unclassified | 2680 |
| 372 | Ga0268266_10000094 | 3300028379 | Bacteria | 190917 |
| 373 | Ga0268266_10051486 | 3300028379 | Bacteria | 3535 |
| 374 | Ga0268265_10052470 | 3300028380 | Bacteria | 3084 |
| 375 | Ga0268265_10063821 | 3300028380 | Bacteria | 2835 |
| 376 | Ga0268265_10116274 | 3300028380 | Unclassified | 2194 |
| 377 | Ga0268264_10009666 | 3300028381 | Bacteria | 7989 |
| 378 | Ga0268264_10019657 | 3300028381 | Bacteria | 5517 |
| 379 | Ga0268264_10039743 | 3300028381 | Bacteria | 3887 |
| 380 | Ga0268264_10086691 | 3300028381 | Bacteria | 2690 |
| 381 | Ga0268264_10133939 | 3300028381 | Bacteria | 2201 |
| 382 | Ga0307517_10001745 | 3300028786 | Bacteria | 35870 |
| 383 | Ga0307517_10174366 | 3300028786 | Bacteria | 1405 |
| 384 | Ga0307515_10000036 | 3300028794 | Bacteria | 332188 |
| 385 | Ga0307515_10138380 | 3300028794 | Bacteria | 2629 |
| 386 | Ga0307508_10000439 | 3300031616 | Bacteria | 49671 |
| 387 | Ga0307508_10051566 | 3300031616 | Bacteria | 3657 |
| 388 | Ga0307405_10000019 | 3300031731 | Bacteria | 167960 |
| 389 | Ga0307405_10199491 | 3300031731 | Bacteria | 1452 |
| 390 | Ga0307407_10000078 | 3300031903 | Bacteria | 34709 |
| 391 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 392 | Ga0307412_10000283 | 3300031911 | Bacteria | 32305 |
| 393 | Ga0307416_100000375 | 3300032002 | Bacteria | 23156 |
| 394 | Ga0307416_100057440 | 3300032002 | Bacteria | 3148 |
| 395 | Ga0307414_10000046 | 3300032004 | Bacteria | 133496 |
| 396 | Ga0307414_10000947 | 3300032004 | Bacteria | 14835 |
| 397 | Ga0307414_10012740 | 3300032004 | Bacteria | 4986 |
| 398 | Ga0316583_10000120 | 3300032133 | Bacteria | 18362 |
| 399 | Ga0307510_10039466 | 3300033180 | Bacteria | 5200 |
| 400 | Ga0373949_0037098 | 3300035090 | Bacteria | 1184 |
| 401 | Ga0373947_0328959 | 3300035725 | Bacteria | 1023 |
| 402 | Ga0395899_0133325 | 3300037312 | Bacteria | 1772 |
| 403 | Ga0395900_0373455 | 3300037418 | Bacteria | 1395 |
| 404 | Ga0395900_0418873 | 3300037418 | Bacteria | 1300 |
| 405 | Ga0395900_0629260 | 3300037418 | Bacteria | 1011 |
| 406 | Ga0395898_0070268 | 3300037466 | Bacteria | 3385 |
| 407 | Ga0395898_0209418 | 3300037466 | Bacteria | 1860 |
| 408 | Ga0395905_0204367 | 3300037471 | Bacteria | 1852 |
| 409 | Ga0436365_0999976 | 3300039437 | Bacteria | 2389 |
| 410 | Ga0439466_0018491 | 3300041411 | Bacteria | 2500 |
| 411 | Ga0439465_0000153 | 3300041413 | Bacteria | 17071 |
| 412 | Ga0439431_0034372 | 3300041997 | Bacteria | 1271 |
| 413 | Ga0439445_0000001 | 3300042004 | Bacteria | 97032 |
| 414 | Ga0439432_017643 | 3300042006 | Bacteria | 2394 |
| 415 | Ga0450896_003380 | 3300042133 | Unclassified | 2117 |
| 416 | Ga0451577_0100543 | 3300042876 | Bacteria | 2583 |
| 417 | Ga0466972_0000004 | 3300044658 | Bacteria | 314413 |
| 418 | Ga0453683_0161323 | 3300044673 | Bacteria | 1418 |
| 419 | Ga0466965_0107621 | 3300044683 | Bacteria | 1431 |
| 420 | Ga0466970_0000038 | 3300044765 | Bacteria | 47830 |
| 421 | Ga0451576_0032071 | 3300045051 | Bacteria | 5599 |
| 422 | Ga0495627_000002 | 3300046453 | Bacteria | 903861 |
| 423 | Ga0495627_015607 | 3300046453 | Bacteria | 2618 |
| 424 | Ga0495651_0032175 | 3300046462 | Bacteria | 4092 |
| 425 | Ga0495606_0010400 | 3300046507 | Bacteria | 7727 |
| 426 | Ga0495608_0076625 | 3300046511 | Bacteria | 2178 |
| 427 | Ga0495610_0000035 | 3300046512 | Bacteria | 189683 |
| 428 | Ga0495610_0003002 | 3300046512 | Bacteria | 13569 |
| 429 | Ga0495616_0014695 | 3300046513 | Bacteria | 4375 |
| 430 | Ga0495630_0045235 | 3300046517 | Bacteria | 3289 |
| 431 | Ga0495632_0005245 | 3300046519 | Bacteria | 8619 |
| 432 | Ga0495643_0001223 | 3300046522 | Bacteria | 24830 |
| 433 | Ga0495643_0024420 | 3300046522 | Bacteria | 3429 |
| 434 | Ga0495654_0000056 | 3300046530 | Bacteria | 140658 |
| 435 | Ga0495609_0000025 | 3300046538 | Bacteria | 256898 |
| 436 | Ga0495633_0000090 | 3300046558 | Bacteria | 122693 |
| 437 | Ga0495633_0000562 | 3300046558 | Bacteria | 36317 |
| 438 | Ga0495633_0049577 | 3300046558 | Bacteria | 1981 |
| 439 | Ga0495668_0000918 | 3300046616 | Bacteria | 32911 |
| 440 | Ga0495668_0002782 | 3300046616 | Bacteria | 13931 |
| 441 | Ga0495625_0002377 | 3300046660 | Bacteria | 20476 |
| 442 | Ga0495672_0018865 | 3300047320 | Bacteria | 4569 |
| 443 | Ga0495676_0125571 | 3300047321 | Bacteria | 1860 |
| 444 | Ga0495675_0051412 | 3300047444 | Bacteria | 2617 |
| 445 | Ga0495686_0000034 | 3300047472 | Bacteria | 325038 |
| 446 | Ga0495686_0000386 | 3300047472 | Bacteria | 70225 |
| 447 | Ga0495686_0011573 | 3300047472 | Bacteria | 6211 |
| 448 | Ga0496100_0216020 | 3300048903 | Bacteria | 1405 |
| 449 | Ga0496101_0197404 | 3300048904 | Bacteria | 1555 |
| 450 | Ga0496109_0532900 | 3300048912 | Bacteria | 1108 |
| 451 | Ga0496110_0212204 | 3300048913 | Unclassified | 1760 |
| 452 | Ga0496113_0008058 | 3300048916 | Bacteria | 6837 |
| 453 | Ga0496125_0018749 | 3300048928 | Bacteria | 6558 |
| 454 | Ga0496126_0015826 | 3300048929 | Bacteria | 7574 |
| 455 | Ga0501034_0152355 | 3300049571 | Bacteria | 2287 |
| 456 | Ga0501036_0334741 | 3300049572 | Bacteria | 1264 |
| 457 | Ga0501039_0125619 | 3300049575 | Bacteria | 2012 |
| 458 | Ga0501043_0038937 | 3300049579 | Bacteria | 3737 |
| 459 | Ga0501046_0038773 | 3300049580 | Bacteria | 3821 |
| 460 | Ga0501048_0043101 | 3300049582 | Bacteria | 3230 |
| 461 | Ga0501073_0223255 | 3300049589 | Bacteria | 1301 |
| 462 | Ga0501074_0012038 | 3300049590 | Bacteria | 6283 |
| 463 | Ga0501249_024132 | 3300049679 | Bacteria | 1339 |
| 464 | Ga0501251_001570 | 3300049681 | Bacteria | 2151 |
| 465 | Ga0501080_0450076 | 3300049742 | Unclassified | 1154 |
| 466 | Ga0501083_0194844 | 3300049744 | Unclassified | 1322 |
| 467 | Ga0501083_0239525 | 3300049744 | Bacteria | 1181 |
| 468 | Ga0501241_000020 | 3300049758 | Bacteria | 83005 |
| 469 | Ga0501241_011219 | 3300049758 | Bacteria | 1628 |
| 470 | Ga0501269_000181 | 3300049766 | Bacteria | 19450 |
| 471 | Ga0501269_001120 | 3300049766 | Bacteria | 3716 |
| 472 | Ga0501035_0007882 | 3300049822 | Bacteria | 9950 |
| 473 | Ga0501044_0253206 | 3300049823 | Bacteria | 1701 |
| 474 | nmdc:mga05p37_88161_c1 | 3300050507 | Bacteria | 3825 |
| 475 | nmdc:mga08y16_53864_c1 | 3300050511 | Bacteria | 4205 |
| 476 | nmdc:mga0n895_46339_c1 | 3300050512 | Bacteria | 4247 |
| 477 | nmdc:mga0rr50_182091_c1 | 3300050513 | Bacteria | 1718 |
| 478 | nmdc:mga0a205_77832_c1 | 3300050515 | Bacteria | 3204 |
| 479 | Ga0500644_0008114 | 3300053088 | Bacteria | 2762 |
| 480 | Ga0500583_0045760 | 3300053092 | Bacteria | 2011 |
| 481 | Ga0500651_0000357 | 3300053093 | Bacteria | 25575 |
| 482 | Ga0500562_000047 | 3300053108 | Bacteria | 62430 |
| 483 | Ga0500608_000365 | 3300053122 | Bacteria | 17523 |
| 484 | Ga0500608_001724 | 3300053122 | Bacteria | 7810 |
| 485 | Ga0500564_148426 | 3300053138 | Bacteria | 1001 |
| 486 | Ga0500568_0035235 | 3300053139 | Bacteria | 2043 |
| 487 | Ga0500589_091128 | 3300053147 | Bacteria | 1343 |
| 488 | Ga0500604_0030522 | 3300053151 | Bacteria | 1577 |
| 489 | Ga0500616_0000853 | 3300053153 | Bacteria | 33843 |
| 490 | Ga0500616_0011999 | 3300053153 | Bacteria | 5088 |
| 491 | Ga0500624_000829 | 3300053157 | Bacteria | 7053 |
| 492 | Ga0500627_0007087 | 3300053158 | Bacteria | 3874 |
| 493 | Ga0500645_031185 | 3300053730 | Bacteria | 1602 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10005675 | rootL2_100056755 | 265 |
| 2 | 3300046519 | Ga0495632_0005245 | Ga0495632_0005245_4775_5734 | 266 |
| 3 | 3300005329 | Ga0070683_100025005 | Ga0070683_1000250053 | 270 |
| 4 | 3300005337 | Ga0070682_100020469 | Ga0070682_1000204693 | 270 |
| 5 | 3300005338 | Ga0068868_100019295 | Ga0068868_1000192953 | 270 |
| 6 | 3300005339 | Ga0070660_100018715 | Ga0070660_1000187153 | 270 |
| 7 | 3300005344 | Ga0070661_100038728 | Ga0070661_1000387283 | 270 |
| 8 | 3300005354 | Ga0070675_100051747 | Ga0070675_1000517473 | 270 |
| 9 | 3300005366 | Ga0070659_100028075 | Ga0070659_1000280752 | 270 |
| 10 | 3300005456 | Ga0070678_100151871 | Ga0070678_1001518712 | 270 |
| 11 | 3300005457 | Ga0070662_100021170 | Ga0070662_1000211706 | 270 |
| 12 | 3300005530 | Ga0070679_100242189 | Ga0070679_1002421892 | 270 |
| 13 | 3300005535 | Ga0070684_100115144 | Ga0070684_1001151442 | 270 |
| 14 | 3300005539 | Ga0068853_100053696 | Ga0068853_1000536966 | 270 |
| 15 | 3300005547 | Ga0070693_100177956 | Ga0070693_1001779561 | 270 |
| 16 | 3300005577 | Ga0068857_100042788 | Ga0068857_1000427884 | 270 |
| 17 | 3300005578 | Ga0068854_100101274 | Ga0068854_1001012744 | 270 |
| 18 | 3300005614 | Ga0068856_100188479 | Ga0068856_1001884793 | 270 |
| 19 | 3300005616 | Ga0068852_100041718 | Ga0068852_1000417183 | 270 |
| 20 | 3300006358 | Ga0068871_100060592 | Ga0068871_1000605921 | 270 |
| 21 | 3300009177 | Ga0105248_10125559 | Ga0105248_101255593 | 270 |
| 22 | 3300013306 | Ga0163162_10007403 | Ga0163162_100074031 | 270 |
| 23 | 3300025919 | Ga0207657_10003056 | Ga0207657_100030563 | 270 |
| 24 | 3300025920 | Ga0207649_10031708 | Ga0207649_100317082 | 270 |
| 25 | 3300025933 | Ga0207706_10002652 | Ga0207706_1000265211 | 270 |
| 26 | 3300025941 | Ga0207711_10272027 | Ga0207711_102720272 | 270 |
| 27 | 3300025945 | Ga0207679_10117060 | Ga0207679_101170603 | 270 |
| 28 | 3300026023 | Ga0207677_10013772 | Ga0207677_100137725 | 270 |
| 29 | 3300026041 | Ga0207639_10062669 | Ga0207639_100626694 | 270 |
| 30 | 3300026116 | Ga0207674_10065198 | Ga0207674_100651984 | 270 |
| 31 | 3300010375 | Ga0105239_10076122 | Ga0105239_100761226 | 273 |
| 32 | 3300025925 | Ga0207650_10031374 | Ga0207650_100313743 | 276 |
| 33 | 3300003322 | rootL2_10037414 | rootL2_100374142 | 277 |
| 34 | 3300003322 | rootL2_10275501 | rootL2_102755013 | 277 |
| 35 | 3300003323 | rootH1_10114266 | rootH1_101142668 | 277 |
| 36 | 3300005841 | Ga0068863_100261126 | Ga0068863_1002611262 | 277 |
| 37 | 3300005937 | Ga0081455_10014354 | Ga0081455_100143544 | 277 |
| 38 | 3300007076 | Ga0075435_100084027 | Ga0075435_1000840272 | 277 |
| 39 | 3300014969 | Ga0157376_10034240 | Ga0157376_100342402 | 277 |
| 40 | 3300026088 | Ga0207641_10014633 | Ga0207641_100146336 | 277 |
| 41 | 3300028794 | Ga0307515_10138380 | Ga0307515_101383803 | 277 |
| 42 | 3300035090 | Ga0373949_0037098 | Ga0373949_0037098_19_876 | 277 |
| 43 | 3300050507 | nmdc:mga05p37_88161_c1 | nmdc:mga05p37_88161_c1_2897_3754 | 277 |
| 44 | 3300050512 | nmdc:mga0n895_46339_c1 | nmdc:mga0n895_46339_c1_555_1412 | 277 |
| 45 | 3300050513 | nmdc:mga0rr50_182091_c1 | nmdc:mga0rr50_182091_c1_495_1352 | 277 |
| 46 | 3300050515 | nmdc:mga0a205_77832_c1 | nmdc:mga0a205_77832_c1_1934_2791 | 277 |
| 47 | iso_pu_bacteria | 2738541273 | 2738698313 | 277 |
| 48 | iso_pu_bacteria | 2738543014 | 2739252639 | 277 |
| 49 | 3300009545 | Ga0105237_10001536 | Ga0105237_1000153627 | 278 |
| 50 | 3300025914 | Ga0207671_10000983 | Ga0207671_1000098327 | 278 |
| 51 | 3300028786 | Ga0307517_10001745 | Ga0307517_1000174511 | 278 |
| 52 | 3300042876 | Ga0451577_0100543 | Ga0451577_0100543_619_1470 | 278 |
| 53 | 3300044673 | Ga0453683_0161323 | Ga0453683_0161323_56_907 | 278 |
| 54 | 3300045051 | Ga0451576_0032071 | Ga0451576_0032071_4007_4858 | 278 |
| 55 | iso_pu_bacteria | 2585428061 | 2587751790 | 278 |
| 56 | iso_pu_bacteria | 2585428095 | 2587865784 | 278 |
| 57 | iso_pu_bacteria | 2585428115 | 2587943943 | 278 |
| 58 | iso_pu_bacteria | 2585428187 | 2588231822 | 278 |
| 59 | iso_pu_bacteria | 2739367656 | 2739615776 | 278 |
| 60 | iso_pu_bacteria | 2775506739 | 2775672155 | 278 |
| 61 | iso_pu_bacteria | 2919097161 | 2919099238 | 278 |
| 62 | iso_pu_bacteria | 2945924605 | 2945926542 | 278 |
| 63 | iso_pu_bacteria | 2585427687 | 2586210286 | 279 |
| 64 | iso_pu_bacteria | 2738541302 | 2738853315 | 279 |
| 65 | iso_pu_bacteria | 2739367651 | 2739588733 | 279 |
| 66 | iso_pu_bacteria | 2739367663 | 2739645411 | 279 |
| 67 | iso_pu_bacteria | 2818991437 | 2819548066 | 279 |
| 68 | iso_pu_bacteria | 2842722452 | 2842726133 | 279 |
| 69 | iso_pu_bacteria | 2842909656 | 2842910406 | 279 |
| 70 | iso_pu_bacteria | 2849281842 | 2849282303 | 279 |
| 71 | iso_pu_bacteria | 2857627736 | 2857628461 | 279 |
| 72 | iso_pu_bacteria | 2904445276 | 2904445631 | 279 |
| 73 | iso_pu_bacteria | 2929921140 | 2929923429 | 279 |
| 74 | iso_pu_bacteria | 2945997725 | 2946000746 | 279 |
| 75 | iso_pu_bacteria | 2954016120 | 2954017629 | 279 |
| 76 | iso_pu_bacteria | 8003151029 | 8003152833 | 279 |
| 77 | 3300013104 | Ga0157370_10015356 | Ga0157370_100153562 | 280 |
| 78 | 3300046558 | Ga0495633_0000090 | Ga0495633_0000090_10898_11740 | 280 |
| 79 | iso_pu_bacteria | 2929154850 | 2929155301 | 280 |
| 80 | iso_pu_bacteria | 2977232053 | 2977232607 | 280 |
| 81 | 3300005356 | Ga0070674_100035124 | Ga0070674_1000351244 | 281 |
| 82 | 3300005563 | Ga0068855_100000360 | Ga0068855_10000036041 | 281 |
| 83 | 3300005563 | Ga0068855_100532704 | Ga0068855_1005327042 | 281 |
| 84 | 3300005578 | Ga0068854_100402360 | Ga0068854_1004023601 | 281 |
| 85 | 3300005614 | Ga0068856_100116075 | Ga0068856_1001160752 | 281 |
| 86 | 3300009093 | Ga0105240_10010765 | Ga0105240_100107653 | 281 |
| 87 | 3300009093 | Ga0105240_10280398 | Ga0105240_102803982 | 281 |
| 88 | 3300009545 | Ga0105237_10026706 | Ga0105237_100267064 | 281 |
| 89 | 3300009551 | Ga0105238_10428263 | Ga0105238_104282632 | 281 |
| 90 | 3300010375 | Ga0105239_10000280 | Ga0105239_1000028071 | 281 |
| 91 | 3300010375 | Ga0105239_10002087 | Ga0105239_1000208715 | 281 |
| 92 | 3300013104 | Ga0157370_10329469 | Ga0157370_103294692 | 281 |
| 93 | 3300013306 | Ga0163162_10267243 | Ga0163162_102672432 | 281 |
| 94 | 3300017792 | Ga0163161_10404531 | Ga0163161_104045312 | 281 |
| 95 | 3300025233 | Ga0209437_100089 | Ga0209437_10008944 | 281 |
| 96 | 3300025913 | Ga0207695_10051070 | Ga0207695_100510704 | 281 |
| 97 | 3300025913 | Ga0207695_10155415 | Ga0207695_101554152 | 281 |
| 98 | 3300025914 | Ga0207671_10006269 | Ga0207671_100062692 | 281 |
| 99 | 3300025937 | Ga0207669_10114871 | Ga0207669_101148712 | 281 |
| 100 | 3300025949 | Ga0207667_10000430 | Ga0207667_1000043041 | 281 |
| 101 | 3300025949 | Ga0207667_10060771 | Ga0207667_100607715 | 281 |
| 102 | 3300025981 | Ga0207640_10380274 | Ga0207640_103802742 | 281 |
| 103 | 3300026078 | Ga0207702_10195720 | Ga0207702_101957202 | 281 |
| 104 | 3300046462 | Ga0495651_0032175 | Ga0495651_0032175_389_1234 | 281 |
| 105 | 3300046558 | Ga0495633_0000562 | Ga0495633_0000562_29525_30481 | 281 |
| 106 | 3300049571 | Ga0501034_0152355 | Ga0501034_0152355_99_947 | 281 |
| 107 | 3300049572 | Ga0501036_0334741 | Ga0501036_0334741_122_970 | 281 |
| 108 | 3300049575 | Ga0501039_0125619 | Ga0501039_0125619_772_1620 | 281 |
| 109 | 3300049579 | Ga0501043_0038937 | Ga0501043_0038937_775_1623 | 281 |
| 110 | 3300049580 | Ga0501046_0038773 | Ga0501046_0038773_647_1495 | 281 |
| 111 | 3300049582 | Ga0501048_0043101 | Ga0501048_0043101_2091_2939 | 281 |
| 112 | 3300049589 | Ga0501073_0223255 | Ga0501073_0223255_422_1270 | 281 |
| 113 | 3300049590 | Ga0501074_0012038 | Ga0501074_0012038_4342_5190 | 281 |
| 114 | 3300049742 | Ga0501080_0450076 | Ga0501080_0450076_208_1056 | 281 |
| 115 | 3300049744 | Ga0501083_0194844 | Ga0501083_0194844_248_1096 | 281 |
| 116 | 3300049822 | Ga0501035_0007882 | Ga0501035_0007882_2484_3332 | 281 |
| 117 | 3300049823 | Ga0501044_0253206 | Ga0501044_0253206_13_861 | 281 |
| 118 | 3300053122 | Ga0500608_001724 | Ga0500608_001724_2459_3304 | 281 |
| 119 | 3300053138 | Ga0500564_148426 | Ga0500564_148426_128_973 | 281 |
| 120 | 3300053157 | Ga0500624_000829 | Ga0500624_000829_3080_3925 | 281 |
| 121 | iso_pu_bacteria | 8055588893 | 8055589237 | 281 |
| 122 | 3300002774 | JGI25150J39212_1000057 | JGI25150J39212_100005719 | 282 |
| 123 | 3300003187 | JGI25151J46595_10000229 | JGI25151J46595_1000022919 | 282 |
| 124 | 3300003215 | JGI25153J46596_10000164 | JGI25153J46596_1000016427 | 282 |
| 125 | 3300005329 | Ga0070683_100000662 | Ga0070683_1000006627 | 282 |
| 126 | 3300005337 | Ga0070682_100057376 | Ga0070682_1000573762 | 282 |
| 127 | 3300005339 | Ga0070660_100001082 | Ga0070660_1000010826 | 282 |
| 128 | 3300005339 | Ga0070660_100016725 | Ga0070660_1000167252 | 282 |
| 129 | 3300005339 | Ga0070660_100145900 | Ga0070660_1001459002 | 282 |
| 130 | 3300005340 | Ga0070689_100008285 | Ga0070689_1000082854 | 282 |
| 131 | 3300005345 | Ga0070692_10290318 | Ga0070692_102903181 | 282 |
| 132 | 3300005353 | Ga0070669_100042261 | Ga0070669_1000422612 | 282 |
| 133 | 3300005354 | Ga0070675_100065316 | Ga0070675_1000653163 | 282 |
| 134 | 3300005355 | Ga0070671_100065207 | Ga0070671_1000652072 | 282 |
| 135 | 3300005355 | Ga0070671_100311668 | Ga0070671_1003116682 | 282 |
| 136 | 3300005364 | Ga0070673_100010330 | Ga0070673_1000103304 | 282 |
| 137 | 3300005366 | Ga0070659_100002774 | Ga0070659_1000027744 | 282 |
| 138 | 3300005366 | Ga0070659_100062646 | Ga0070659_1000626463 | 282 |
| 139 | 3300005367 | Ga0070667_100143922 | Ga0070667_1001439222 | 282 |
| 140 | 3300005455 | Ga0070663_100436919 | Ga0070663_1004369191 | 282 |
| 141 | 3300005458 | Ga0070681_10172250 | Ga0070681_101722502 | 282 |
| 142 | 3300005535 | Ga0070684_100005368 | Ga0070684_1000053689 | 282 |
| 143 | 3300005539 | Ga0068853_100042478 | Ga0068853_1000424783 | 282 |
| 144 | 3300005546 | Ga0070696_100257466 | Ga0070696_1002574661 | 282 |
| 145 | 3300005563 | Ga0068855_100027207 | Ga0068855_1000272076 | 282 |
| 146 | 3300005564 | Ga0070664_100007587 | Ga0070664_1000075874 | 282 |
| 147 | 3300005564 | Ga0070664_100221358 | Ga0070664_1002213582 | 282 |
| 148 | 3300005564 | Ga0070664_100374352 | Ga0070664_1003743522 | 282 |
| 149 | 3300005577 | Ga0068857_100078124 | Ga0068857_1000781244 | 282 |
| 150 | 3300005614 | Ga0068856_100004342 | Ga0068856_1000043429 | 282 |
| 151 | 3300005617 | Ga0068859_100078812 | Ga0068859_1000788122 | 282 |
| 152 | 3300005618 | Ga0068864_100327623 | Ga0068864_1003276232 | 282 |
| 153 | 3300005834 | Ga0068851_10025221 | Ga0068851_100252214 | 282 |
| 154 | 3300006237 | Ga0097621_100432602 | Ga0097621_1004326022 | 282 |
| 155 | 3300006358 | Ga0068871_100028668 | Ga0068871_1000286684 | 282 |
| 156 | 3300006931 | Ga0097620_100078812 | Ga0097620_1000788123 | 282 |
| 157 | 3300013100 | Ga0157373_10000005 | Ga0157373_10000005215 | 282 |
| 158 | 3300013100 | Ga0157373_10002699 | Ga0157373_1000269913 | 282 |
| 159 | 3300013100 | Ga0157373_10043695 | Ga0157373_100436952 | 282 |
| 160 | 3300013102 | Ga0157371_10029255 | Ga0157371_100292555 | 282 |
| 161 | 3300013102 | Ga0157371_10205796 | Ga0157371_102057962 | 282 |
| 162 | 3300013105 | Ga0157369_10054509 | Ga0157369_100545095 | 282 |
| 163 | 3300013105 | Ga0157369_10062149 | Ga0157369_100621495 | 282 |
| 164 | 3300013105 | Ga0157369_10303814 | Ga0157369_103038142 | 282 |
| 165 | 3300013296 | Ga0157374_10465558 | Ga0157374_104655582 | 282 |
| 166 | 3300013307 | Ga0157372_10156261 | Ga0157372_101562612 | 282 |
| 167 | 3300013308 | Ga0157375_10002645 | Ga0157375_1000264514 | 282 |
| 168 | 3300013308 | Ga0157375_10046150 | Ga0157375_100461502 | 282 |
| 169 | 3300014497 | Ga0182008_10000037 | Ga0182008_10000037101 | 282 |
| 170 | 3300014968 | Ga0157379_10143813 | Ga0157379_101438132 | 282 |
| 171 | 3300025245 | Ga0207425_1000007 | Ga0207425_1000007195 | 282 |
| 172 | 3300025258 | Ga0209129_1000006 | Ga0209129_1000006195 | 282 |
| 173 | 3300025294 | Ga0209025_1000025 | Ga0209025_100002525 | 282 |
| 174 | 3300025297 | Ga0209758_1000016 | Ga0209758_1000016195 | 282 |
| 175 | 3300025315 | Ga0207697_10023220 | Ga0207697_100232203 | 282 |
| 176 | 3300025907 | Ga0207645_10058288 | Ga0207645_100582883 | 282 |
| 177 | 3300025908 | Ga0207643_10008915 | Ga0207643_100089154 | 282 |
| 178 | 3300025909 | Ga0207705_10007832 | Ga0207705_100078322 | 282 |
| 179 | 3300025917 | Ga0207660_10040992 | Ga0207660_100409922 | 282 |
| 180 | 3300025918 | Ga0207662_10121353 | Ga0207662_101213532 | 282 |
| 181 | 3300025919 | Ga0207657_10001634 | Ga0207657_1000163421 | 282 |
| 182 | 3300025919 | Ga0207657_10060013 | Ga0207657_100600132 | 282 |
| 183 | 3300025919 | Ga0207657_10078237 | Ga0207657_100782372 | 282 |
| 184 | 3300025921 | Ga0207652_10021792 | Ga0207652_100217923 | 282 |
| 185 | 3300025927 | Ga0207687_10407093 | Ga0207687_104070932 | 282 |
| 186 | 3300025931 | Ga0207644_10151696 | Ga0207644_101516962 | 282 |
| 187 | 3300025932 | Ga0207690_10028013 | Ga0207690_100280131 | 282 |
| 188 | 3300025932 | Ga0207690_10124049 | Ga0207690_101240492 | 282 |
| 189 | 3300025932 | Ga0207690_10211158 | Ga0207690_102111582 | 282 |
| 190 | 3300025940 | Ga0207691_10010366 | Ga0207691_100103666 | 282 |
| 191 | 3300025941 | Ga0207711_10127656 | Ga0207711_101276562 | 282 |
| 192 | 3300025944 | Ga0207661_10116829 | Ga0207661_101168292 | 282 |
| 193 | 3300025945 | Ga0207679_10155819 | Ga0207679_101558192 | 282 |
| 194 | 3300025945 | Ga0207679_10495832 | Ga0207679_104958322 | 282 |
| 195 | 3300025949 | Ga0207667_10015868 | Ga0207667_100158687 | 282 |
| 196 | 3300025986 | Ga0207658_10029060 | Ga0207658_100290603 | 282 |
| 197 | 3300026041 | Ga0207639_10140044 | Ga0207639_101400443 | 282 |
| 198 | 3300026078 | Ga0207702_10000165 | Ga0207702_1000016555 | 282 |
| 199 | 3300026116 | Ga0207674_10094772 | Ga0207674_100947724 | 282 |
| 200 | 3300026116 | Ga0207674_10099393 | Ga0207674_100993934 | 282 |
| 201 | 3300028794 | Ga0307515_10000036 | Ga0307515_10000036212 | 282 |
| 202 | 3300031911 | Ga0307412_10000283 | Ga0307412_1000028329 | 282 |
| 203 | 3300032004 | Ga0307414_10000046 | Ga0307414_1000004653 | 282 |
| 204 | 3300032133 | Ga0316583_10000120 | Ga0316583_100001206 | 282 |
| 205 | 3300037312 | Ga0395899_0133325 | Ga0395899_0133325_496_1344 | 282 |
| 206 | 3300037418 | Ga0395900_0418873 | Ga0395900_0418873_439_1287 | 282 |
| 207 | 3300037418 | Ga0395900_0629260 | Ga0395900_0629260_12_860 | 282 |
| 208 | 3300037466 | Ga0395898_0070268 | Ga0395898_0070268_2117_2965 | 282 |
| 209 | 3300037471 | Ga0395905_0204367 | Ga0395905_0204367_489_1343 | 282 |
| 210 | 3300041411 | Ga0439466_0018491 | Ga0439466_0018491_554_1405 | 282 |
| 211 | 3300041413 | Ga0439465_0000153 | Ga0439465_0000153_5929_6780 | 282 |
| 212 | 3300042004 | Ga0439445_0000001 | Ga0439445_0000001_1535_2386 | 282 |
| 213 | 3300042006 | Ga0439432_017643 | Ga0439432_017643_378_1229 | 282 |
| 214 | 3300046453 | Ga0495627_000002 | Ga0495627_000002_392043_392894 | 282 |
| 215 | 3300046453 | Ga0495627_015607 | Ga0495627_015607_897_1853 | 282 |
| 216 | 3300046507 | Ga0495606_0010400 | Ga0495606_0010400_593_1444 | 282 |
| 217 | 3300046522 | Ga0495643_0024420 | Ga0495643_0024420_1083_2039 | 282 |
| 218 | 3300046530 | Ga0495654_0000056 | Ga0495654_0000056_28127_29020 | 282 |
| 219 | 3300046538 | Ga0495609_0000025 | Ga0495609_0000025_118969_119895 | 282 |
| 220 | 3300046616 | Ga0495668_0002782 | Ga0495668_0002782_8496_9350 | 282 |
| 221 | 3300046660 | Ga0495625_0002377 | Ga0495625_0002377_13027_13986 | 282 |
| 222 | 3300047444 | Ga0495675_0051412 | Ga0495675_0051412_1028_1882 | 282 |
| 223 | 3300047472 | Ga0495686_0000386 | Ga0495686_0000386_32210_33061 | 282 |
| 224 | 3300047472 | Ga0495686_0011573 | Ga0495686_0011573_330_1181 | 282 |
| 225 | 3300048903 | Ga0496100_0216020 | Ga0496100_0216020_284_1138 | 282 |
| 226 | 3300048904 | Ga0496101_0197404 | Ga0496101_0197404_86_940 | 282 |
| 227 | 3300048912 | Ga0496109_0532900 | Ga0496109_0532900_189_1043 | 282 |
| 228 | 3300048916 | Ga0496113_0008058 | Ga0496113_0008058_429_1283 | 282 |
| 229 | 3300048928 | Ga0496125_0018749 | Ga0496125_0018749_3634_4485 | 282 |
| 230 | 3300049681 | Ga0501251_001570 | Ga0501251_001570_1218_2069 | 282 |
| 231 | 3300049758 | Ga0501241_000020 | Ga0501241_000020_52831_53682 | 282 |
| 232 | 3300049766 | Ga0501269_000181 | Ga0501269_000181_14931_15782 | 282 |
| 233 | 3300053151 | Ga0500604_0030522 | Ga0500604_0030522_110_964 | 282 |
| 234 | 3300001979 | JGI24740J21852_10007571 | JGI24740J21852_100075715 | 283 |
| 235 | 3300002738 | JGI25154J39366_1000007 | JGI25154J39366_100000797 | 283 |
| 236 | 3300003215 | JGI25153J46596_10010292 | JGI25153J46596_100102923 | 283 |
| 237 | 3300003323 | rootH1_10140347 | rootH1_101403473 | 283 |
| 238 | 3300003354 | JGI25160J50197_1011861 | JGI25160J50197_10118612 | 283 |
| 239 | 3300003781 | Ga0055536_1000011 | Ga0055536_10000118 | 283 |
| 240 | 3300003791 | Ga0055530_10009676 | Ga0055530_100096763 | 283 |
| 241 | 3300003794 | Ga0055531_10000020 | Ga0055531_10000020108 | 283 |
| 242 | 3300005262 | Ga0065165_1011718 | Ga0065165_10117182 | 283 |
| 243 | 3300005288 | Ga0065714_10064816 | Ga0065714_100648161 | 283 |
| 244 | 3300005327 | Ga0070658_10146353 | Ga0070658_101463534 | 283 |
| 245 | 3300005334 | Ga0068869_100398916 | Ga0068869_1003989162 | 283 |
| 246 | 3300005364 | Ga0070673_100140388 | Ga0070673_1001403882 | 283 |
| 247 | 3300005445 | Ga0070708_100211966 | Ga0070708_1002119662 | 283 |
| 248 | 3300005530 | Ga0070679_100000484 | Ga0070679_10000048419 | 283 |
| 249 | 3300005539 | Ga0068853_100184681 | Ga0068853_1001846811 | 283 |
| 250 | 3300005548 | Ga0070665_100000010 | Ga0070665_100000010141 | 283 |
| 251 | 3300005617 | Ga0068859_100032535 | Ga0068859_1000325352 | 283 |
| 252 | 3300005617 | Ga0068859_100048570 | Ga0068859_1000485704 | 283 |
| 253 | 3300005617 | Ga0068859_100066384 | Ga0068859_1000663844 | 283 |
| 254 | 3300005841 | Ga0068863_100010153 | Ga0068863_1000101539 | 283 |
| 255 | 3300005843 | Ga0068860_100026962 | Ga0068860_1000269626 | 283 |
| 256 | 3300005843 | Ga0068860_100036841 | Ga0068860_1000368415 | 283 |
| 257 | 3300005844 | Ga0068862_100019860 | Ga0068862_1000198604 | 283 |
| 258 | 3300005844 | Ga0068862_100024670 | Ga0068862_1000246705 | 283 |
| 259 | 3300006358 | Ga0068871_100141162 | Ga0068871_1001411622 | 283 |
| 260 | 3300006931 | Ga0097620_100032535 | Ga0097620_1000325357 | 283 |
| 261 | 3300006931 | Ga0097620_100048565 | Ga0097620_1000485654 | 283 |
| 262 | 3300006931 | Ga0097620_100066384 | Ga0097620_1000663842 | 283 |
| 263 | 3300009094 | Ga0111539_10058661 | Ga0111539_100586614 | 283 |
| 264 | 3300009147 | Ga0114129_10316847 | Ga0114129_103168472 | 283 |
| 265 | 3300009176 | Ga0105242_10094888 | Ga0105242_100948883 | 283 |
| 266 | 3300009553 | Ga0105249_10268600 | Ga0105249_102686002 | 283 |
| 267 | 3300010375 | Ga0105239_10476226 | Ga0105239_104762262 | 283 |
| 268 | 3300011119 | Ga0105246_10016410 | Ga0105246_100164104 | 283 |
| 269 | 3300013102 | Ga0157371_10000124 | Ga0157371_1000012452 | 283 |
| 270 | 3300013104 | Ga0157370_10044831 | Ga0157370_100448314 | 283 |
| 271 | 3300013104 | Ga0157370_10081676 | Ga0157370_100816762 | 283 |
| 272 | 3300013104 | Ga0157370_10230144 | Ga0157370_102301441 | 283 |
| 273 | 3300013105 | Ga0157369_10000002 | Ga0157369_10000002334 | 283 |
| 274 | 3300013306 | Ga0163162_10006780 | Ga0163162_100067803 | 283 |
| 275 | 3300014497 | Ga0182008_10000319 | Ga0182008_1000031915 | 283 |
| 276 | 3300014968 | Ga0157379_10161936 | Ga0157379_101619362 | 283 |
| 277 | 3300015261 | Ga0182006_1000597 | Ga0182006_100059712 | 283 |
| 278 | 3300015261 | Ga0182006_1001812 | Ga0182006_10018124 | 283 |
| 279 | 3300015262 | Ga0182007_10000001 | Ga0182007_10000001448 | 283 |
| 280 | 3300015682 | Ga0183373_1010 | Ga0183373_101065 | 283 |
| 281 | 3300017792 | Ga0163161_10000930 | Ga0163161_100009306 | 283 |
| 282 | 3300017792 | Ga0163161_10001917 | Ga0163161_1000191713 | 283 |
| 283 | 3300025208 | Ga0209436_100330 | Ga0209436_10033018 | 283 |
| 284 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002701 | 283 |
| 285 | 3300025250 | Ga0209026_1000698 | Ga0209026_10006987 | 283 |
| 286 | 3300025284 | Ga0209130_1002521 | Ga0209130_100252110 | 283 |
| 287 | 3300025292 | Ga0209676_1000001 | Ga0209676_1000001946 | 283 |
| 288 | 3300025297 | Ga0209758_1004196 | Ga0209758_10041962 | 283 |
| 289 | 3300025298 | Ga0209050_1000016 | Ga0209050_1000016612 | 283 |
| 290 | 3300025302 | Ga0207426_1001505 | Ga0207426_10015054 | 283 |
| 291 | 3300025302 | Ga0207426_1001587 | Ga0207426_100158714 | 283 |
| 292 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011276 | 283 |
| 293 | 3300025728 | Ga0207655_1099966 | Ga0207655_10999661 | 283 |
| 294 | 3300025921 | Ga0207652_10000011 | Ga0207652_1000001161 | 283 |
| 295 | 3300025923 | Ga0207681_10015596 | Ga0207681_100155963 | 283 |
| 296 | 3300025940 | Ga0207691_10135874 | Ga0207691_101358743 | 283 |
| 297 | 3300025942 | Ga0207689_10205433 | Ga0207689_102054332 | 283 |
| 298 | 3300025942 | Ga0207689_10405942 | Ga0207689_104059421 | 283 |
| 299 | 3300026023 | Ga0207677_10014146 | Ga0207677_100141464 | 283 |
| 300 | 3300026041 | Ga0207639_10310770 | Ga0207639_103107701 | 283 |
| 301 | 3300026088 | Ga0207641_10028898 | Ga0207641_100288982 | 283 |
| 302 | 3300026089 | Ga0207648_10112157 | Ga0207648_101121572 | 283 |
| 303 | 3300028379 | Ga0268266_10000094 | Ga0268266_10000094141 | 283 |
| 304 | 3300028380 | Ga0268265_10052470 | Ga0268265_100524703 | 283 |
| 305 | 3300028380 | Ga0268265_10063821 | Ga0268265_100638213 | 283 |
| 306 | 3300028381 | Ga0268264_10009666 | Ga0268264_100096662 | 283 |
| 307 | 3300028381 | Ga0268264_10019657 | Ga0268264_100196572 | 283 |
| 308 | 3300028381 | Ga0268264_10133939 | Ga0268264_101339391 | 283 |
| 309 | 3300028786 | Ga0307517_10174366 | Ga0307517_101743662 | 283 |
| 310 | 3300031731 | Ga0307405_10000019 | Ga0307405_10000019103 | 283 |
| 311 | 3300031903 | Ga0307407_10000078 | Ga0307407_100000789 | 283 |
| 312 | 3300032002 | Ga0307416_100000375 | Ga0307416_1000003759 | 283 |
| 313 | 3300032004 | Ga0307414_10012740 | Ga0307414_100127405 | 283 |
| 314 | 3300033180 | Ga0307510_10039466 | Ga0307510_100394665 | 283 |
| 315 | 3300046512 | Ga0495610_0000035 | Ga0495610_0000035_155534_156388 | 283 |
| 316 | 3300046512 | Ga0495610_0003002 | Ga0495610_0003002_8032_8886 | 283 |
| 317 | 3300046513 | Ga0495616_0014695 | Ga0495616_0014695_2946_3800 | 283 |
| 318 | 3300046522 | Ga0495643_0001223 | Ga0495643_0001223_8825_9679 | 283 |
| 319 | 3300046558 | Ga0495633_0049577 | Ga0495633_0049577_896_1750 | 283 |
| 320 | 3300047472 | Ga0495686_0000034 | Ga0495686_0000034_260345_261196 | 283 |
| 321 | 3300048929 | Ga0496126_0015826 | Ga0496126_0015826_535_1386 | 283 |
| 322 | 3300049679 | Ga0501249_024132 | Ga0501249_024132_341_1195 | 283 |
| 323 | 3300049758 | Ga0501241_011219 | Ga0501241_011219_525_1376 | 283 |
| 324 | 3300050511 | nmdc:mga08y16_53864_c1 | nmdc:mga08y16_53864_c1_665_1522 | 283 |
| 325 | 3300053122 | Ga0500608_000365 | Ga0500608_000365_16371_17222 | 283 |
| 326 | 3300053139 | Ga0500568_0035235 | Ga0500568_0035235_644_1495 | 283 |
| 327 | 3300053153 | Ga0500616_0011999 | Ga0500616_0011999_3027_3878 | 283 |
| 328 | 3300005329 | Ga0070683_100017331 | Ga0070683_1000173315 | 284 |
| 329 | 3300005334 | Ga0068869_100189904 | Ga0068869_1001899042 | 284 |
| 330 | 3300005334 | Ga0068869_100273248 | Ga0068869_1002732482 | 284 |
| 331 | 3300005340 | Ga0070689_100006896 | Ga0070689_1000068966 | 284 |
| 332 | 3300005344 | Ga0070661_100086262 | Ga0070661_1000862622 | 284 |
| 333 | 3300005354 | Ga0070675_100260944 | Ga0070675_1002609442 | 284 |
| 334 | 3300005355 | Ga0070671_100031889 | Ga0070671_1000318893 | 284 |
| 335 | 3300005364 | Ga0070673_100043172 | Ga0070673_1000431723 | 284 |
| 336 | 3300005364 | Ga0070673_100178364 | Ga0070673_1001783642 | 284 |
| 337 | 3300005366 | Ga0070659_100261221 | Ga0070659_1002612212 | 284 |
| 338 | 3300005444 | Ga0070694_100009375 | Ga0070694_1000093752 | 284 |
| 339 | 3300005455 | Ga0070663_100168612 | Ga0070663_1001686121 | 284 |
| 340 | 3300005456 | Ga0070678_100294265 | Ga0070678_1002942652 | 284 |
| 341 | 3300005457 | Ga0070662_100007507 | Ga0070662_1000075077 | 284 |
| 342 | 3300005457 | Ga0070662_100018322 | Ga0070662_1000183222 | 284 |
| 343 | 3300005468 | Ga0070707_100366821 | Ga0070707_1003668212 | 284 |
| 344 | 3300005545 | Ga0070695_100003070 | Ga0070695_1000030705 | 284 |
| 345 | 3300005548 | Ga0070665_100456546 | Ga0070665_1004565461 | 284 |
| 346 | 3300005549 | Ga0070704_100004154 | Ga0070704_1000041546 | 284 |
| 347 | 3300005563 | Ga0068855_100048426 | Ga0068855_1000484262 | 284 |
| 348 | 3300005564 | Ga0070664_100012371 | Ga0070664_1000123716 | 284 |
| 349 | 3300005614 | Ga0068856_100018340 | Ga0068856_1000183406 | 284 |
| 350 | 3300005618 | Ga0068864_100087836 | Ga0068864_1000878362 | 284 |
| 351 | 3300005842 | Ga0068858_100096731 | Ga0068858_1000967313 | 284 |
| 352 | 3300006358 | Ga0068871_100138233 | Ga0068871_1001382332 | 284 |
| 353 | 3300006852 | Ga0075433_10171645 | Ga0075433_101716451 | 284 |
| 354 | 3300006871 | Ga0075434_100465277 | Ga0075434_1004652772 | 284 |
| 355 | 3300009011 | Ga0105251_10124678 | Ga0105251_101246782 | 284 |
| 356 | 3300009147 | Ga0114129_10007108 | Ga0114129_100071085 | 284 |
| 357 | 3300011119 | Ga0105246_10042710 | Ga0105246_100427102 | 284 |
| 358 | 3300013296 | Ga0157374_10006776 | Ga0157374_100067765 | 284 |
| 359 | 3300013296 | Ga0157374_10057220 | Ga0157374_100572203 | 284 |
| 360 | 3300013296 | Ga0157374_10327246 | Ga0157374_103272462 | 284 |
| 361 | 3300013307 | Ga0157372_10334227 | Ga0157372_103342272 | 284 |
| 362 | 3300013307 | Ga0157372_10601494 | Ga0157372_106014942 | 284 |
| 363 | 3300014325 | Ga0163163_10246818 | Ga0163163_102468181 | 284 |
| 364 | 3300014968 | Ga0157379_10172100 | Ga0157379_101721001 | 284 |
| 365 | 3300014969 | Ga0157376_10058283 | Ga0157376_100582832 | 284 |
| 366 | 3300021384 | Ga0213876_10084459 | Ga0213876_100844592 | 284 |
| 367 | 3300025250 | Ga0209026_1004091 | Ga0209026_10040915 | 284 |
| 368 | 3300025315 | Ga0207697_10080861 | Ga0207697_100808611 | 284 |
| 369 | 3300025904 | Ga0207647_10019002 | Ga0207647_100190024 | 284 |
| 370 | 3300025920 | Ga0207649_10017024 | Ga0207649_100170241 | 284 |
| 371 | 3300025931 | Ga0207644_10317946 | Ga0207644_103179461 | 284 |
| 372 | 3300025933 | Ga0207706_10006057 | Ga0207706_100060572 | 284 |
| 373 | 3300025933 | Ga0207706_10017808 | Ga0207706_100178082 | 284 |
| 374 | 3300025936 | Ga0207670_10009679 | Ga0207670_100096792 | 284 |
| 375 | 3300025940 | Ga0207691_10024494 | Ga0207691_100244943 | 284 |
| 376 | 3300025942 | Ga0207689_10003219 | Ga0207689_100032198 | 284 |
| 377 | 3300025942 | Ga0207689_10055565 | Ga0207689_100555651 | 284 |
| 378 | 3300025942 | Ga0207689_10064649 | Ga0207689_100646492 | 284 |
| 379 | 3300025944 | Ga0207661_10088997 | Ga0207661_100889972 | 284 |
| 380 | 3300025945 | Ga0207679_10379106 | Ga0207679_103791062 | 284 |
| 381 | 3300025949 | Ga0207667_10004619 | Ga0207667_1000461914 | 284 |
| 382 | 3300025960 | Ga0207651_10295440 | Ga0207651_102954401 | 284 |
| 383 | 3300025961 | Ga0207712_10401773 | Ga0207712_104017731 | 284 |
| 384 | 3300026067 | Ga0207678_10024389 | Ga0207678_100243895 | 284 |
| 385 | 3300026089 | Ga0207648_10626776 | Ga0207648_106267761 | 284 |
| 386 | 3300026095 | Ga0207676_10012612 | Ga0207676_100126126 | 284 |
| 387 | 3300026121 | Ga0207683_10059307 | Ga0207683_100593072 | 284 |
| 388 | 3300028379 | Ga0268266_10051486 | Ga0268266_100514863 | 284 |
| 389 | 3300028381 | Ga0268264_10086691 | Ga0268264_100866912 | 284 |
| 390 | 3300035725 | Ga0373947_0328959 | Ga0373947_0328959_46_900 | 284 |
| 391 | 3300039437 | Ga0436365_0999976 | Ga0436365_0999976_789_1643 | 284 |
| 392 | 3300047320 | Ga0495672_0018865 | Ga0495672_0018865_2355_3209 | 284 |
| 393 | 3300053088 | Ga0500644_0008114 | Ga0500644_0008114_195_1049 | 284 |
| 394 | 3300053108 | Ga0500562_000047 | Ga0500562_000047_34754_35608 | 284 |
| 395 | 3300053730 | Ga0500645_031185 | Ga0500645_031185_346_1200 | 284 |
| 396 | 2162886007 | SwRhRL2b_contig_1583141 | SwRhRL2b_0345.00001730 | 285 |
| 397 | 3300002741 | JGI25157J39369_1007547 | JGI25157J39369_10075472 | 285 |
| 398 | 3300003322 | rootL2_10215410 | rootL2_102154102 | 285 |
| 399 | 3300003323 | rootH1_10029353 | rootH1_100293534 | 285 |
| 400 | 3300003323 | rootH1_10118678 | rootH1_101186782 | 285 |
| 401 | 3300005288 | Ga0065714_10001191 | Ga0065714_100011912 | 285 |
| 402 | 3300005288 | Ga0065714_10101906 | Ga0065714_101019062 | 285 |
| 403 | 3300005289 | Ga0065704_10072354 | Ga0065704_100723542 | 285 |
| 404 | 3300005327 | Ga0070658_10002567 | Ga0070658_100025676 | 285 |
| 405 | 3300005329 | Ga0070683_100001724 | Ga0070683_1000017249 | 285 |
| 406 | 3300005334 | Ga0068869_100001942 | Ga0068869_1000019422 | 285 |
| 407 | 3300005334 | Ga0068869_100136677 | Ga0068869_1001366772 | 285 |
| 408 | 3300005335 | Ga0070666_10200457 | Ga0070666_102004571 | 285 |
| 409 | 3300005337 | Ga0070682_100221821 | Ga0070682_1002218211 | 285 |
| 410 | 3300005338 | Ga0068868_100008319 | Ga0068868_1000083196 | 285 |
| 411 | 3300005354 | Ga0070675_100516621 | Ga0070675_1005166212 | 285 |
| 412 | 3300005365 | Ga0070688_100209991 | Ga0070688_1002099912 | 285 |
| 413 | 3300005366 | Ga0070659_100005067 | Ga0070659_1000050672 | 285 |
| 414 | 3300005366 | Ga0070659_100356393 | Ga0070659_1003563932 | 285 |
| 415 | 3300005367 | Ga0070667_100022919 | Ga0070667_1000229193 | 285 |
| 416 | 3300005457 | Ga0070662_100214274 | Ga0070662_1002142742 | 285 |
| 417 | 3300005458 | Ga0070681_10347823 | Ga0070681_103478232 | 285 |
| 418 | 3300005466 | Ga0070685_10291492 | Ga0070685_102914921 | 285 |
| 419 | 3300005530 | Ga0070679_100004268 | Ga0070679_1000042687 | 285 |
| 420 | 3300005535 | Ga0070684_100000417 | Ga0070684_10000041723 | 285 |
| 421 | 3300005535 | Ga0070684_100269577 | Ga0070684_1002695772 | 285 |
| 422 | 3300005539 | Ga0068853_100014103 | Ga0068853_1000141035 | 285 |
| 423 | 3300005544 | Ga0070686_100116719 | Ga0070686_1001167192 | 285 |
| 424 | 3300005563 | Ga0068855_100044591 | Ga0068855_1000445914 | 285 |
| 425 | 3300005563 | Ga0068855_100148926 | Ga0068855_1001489262 | 285 |
| 426 | 3300005563 | Ga0068855_100150462 | Ga0068855_1001504622 | 285 |
| 427 | 3300005564 | Ga0070664_100000360 | Ga0070664_10000036022 | 285 |
| 428 | 3300005564 | Ga0070664_100132763 | Ga0070664_1001327632 | 285 |
| 429 | 3300005577 | Ga0068857_100000323 | Ga0068857_1000003235 | 285 |
| 430 | 3300005578 | Ga0068854_100054505 | Ga0068854_1000545052 | 285 |
| 431 | 3300005614 | Ga0068856_100094214 | Ga0068856_1000942144 | 285 |
| 432 | 3300005616 | Ga0068852_100039083 | Ga0068852_1000390832 | 285 |
| 433 | 3300005617 | Ga0068859_100028162 | Ga0068859_1000281624 | 285 |
| 434 | 3300005617 | Ga0068859_100037950 | Ga0068859_1000379505 | 285 |
| 435 | 3300005843 | Ga0068860_100052154 | Ga0068860_1000521544 | 285 |
| 436 | 3300005844 | Ga0068862_100078764 | Ga0068862_1000787643 | 285 |
| 437 | 3300006237 | Ga0097621_100157334 | Ga0097621_1001573342 | 285 |
| 438 | 3300006358 | Ga0068871_100561494 | Ga0068871_1005614941 | 285 |
| 439 | 3300006931 | Ga0097620_100028161 | Ga0097620_1000281615 | 285 |
| 440 | 3300006931 | Ga0097620_100037950 | Ga0097620_1000379505 | 285 |
| 441 | 3300009093 | Ga0105240_10213603 | Ga0105240_102136032 | 285 |
| 442 | 3300009177 | Ga0105248_10269510 | Ga0105248_102695102 | 285 |
| 443 | 3300009545 | Ga0105237_10032188 | Ga0105237_100321882 | 285 |
| 444 | 3300010375 | Ga0105239_10040348 | Ga0105239_100403486 | 285 |
| 445 | 3300010375 | Ga0105239_10412246 | Ga0105239_104122462 | 285 |
| 446 | 3300013100 | Ga0157373_10003444 | Ga0157373_100034442 | 285 |
| 447 | 3300013100 | Ga0157373_10008374 | Ga0157373_100083744 | 285 |
| 448 | 3300013100 | Ga0157373_10019198 | Ga0157373_100191984 | 285 |
| 449 | 3300013102 | Ga0157371_10003262 | Ga0157371_100032626 | 285 |
| 450 | 3300013102 | Ga0157371_10006892 | Ga0157371_100068927 | 285 |
| 451 | 3300013104 | Ga0157370_10149638 | Ga0157370_101496381 | 285 |
| 452 | 3300013104 | Ga0157370_10182328 | Ga0157370_101823282 | 285 |
| 453 | 3300013104 | Ga0157370_10351156 | Ga0157370_103511562 | 285 |
| 454 | 3300013104 | Ga0157370_10537853 | Ga0157370_105378532 | 285 |
| 455 | 3300013105 | Ga0157369_10018091 | Ga0157369_100180917 | 285 |
| 456 | 3300013296 | Ga0157374_10007311 | Ga0157374_100073116 | 285 |
| 457 | 3300013296 | Ga0157374_10023239 | Ga0157374_100232395 | 285 |
| 458 | 3300013297 | Ga0157378_10163877 | Ga0157378_101638773 | 285 |
| 459 | 3300013306 | Ga0163162_10024117 | Ga0163162_100241172 | 285 |
| 460 | 3300013306 | Ga0163162_10038703 | Ga0163162_100387035 | 285 |
| 461 | 3300013306 | Ga0163162_10039322 | Ga0163162_100393224 | 285 |
| 462 | 3300013307 | Ga0157372_10000449 | Ga0157372_1000044921 | 285 |
| 463 | 3300013307 | Ga0157372_10093998 | Ga0157372_100939983 | 285 |
| 464 | 3300013308 | Ga0157375_10839582 | Ga0157375_108395821 | 285 |
| 465 | 3300014745 | Ga0157377_10083345 | Ga0157377_100833452 | 285 |
| 466 | 3300014968 | Ga0157379_10015571 | Ga0157379_100155712 | 285 |
| 467 | 3300015261 | Ga0182006_1009706 | Ga0182006_10097065 | 285 |
| 468 | 3300017792 | Ga0163161_10001712 | Ga0163161_100017124 | 285 |
| 469 | 3300017792 | Ga0163161_10096314 | Ga0163161_100963142 | 285 |
| 470 | 3300025250 | Ga0209026_1001164 | Ga0209026_10011643 | 285 |
| 471 | 3300025907 | Ga0207645_10027321 | Ga0207645_100273212 | 285 |
| 472 | 3300025909 | Ga0207705_10000494 | Ga0207705_100004946 | 285 |
| 473 | 3300025912 | Ga0207707_10185507 | Ga0207707_101855072 | 285 |
| 474 | 3300025913 | Ga0207695_10064702 | Ga0207695_100647022 | 285 |
| 475 | 3300025921 | Ga0207652_10000043 | Ga0207652_100000437 | 285 |
| 476 | 3300025932 | Ga0207690_10003665 | Ga0207690_100036657 | 285 |
| 477 | 3300025932 | Ga0207690_10316368 | Ga0207690_103163682 | 285 |
| 478 | 3300025940 | Ga0207691_10260600 | Ga0207691_102606002 | 285 |
| 479 | 3300025942 | Ga0207689_10004134 | Ga0207689_1000413412 | 285 |
| 480 | 3300025944 | Ga0207661_10005273 | Ga0207661_100052738 | 285 |
| 481 | 3300025944 | Ga0207661_10206807 | Ga0207661_102068072 | 285 |
| 482 | 3300025945 | Ga0207679_10019908 | Ga0207679_100199083 | 285 |
| 483 | 3300025949 | Ga0207667_10139458 | Ga0207667_101394583 | 285 |
| 484 | 3300025949 | Ga0207667_10235988 | Ga0207667_102359882 | 285 |
| 485 | 3300025960 | Ga0207651_10048170 | Ga0207651_100481702 | 285 |
| 486 | 3300025981 | Ga0207640_10251369 | Ga0207640_102513691 | 285 |
| 487 | 3300025986 | Ga0207658_10067215 | Ga0207658_100672152 | 285 |
| 488 | 3300026023 | Ga0207677_10131974 | Ga0207677_101319742 | 285 |
| 489 | 3300026041 | Ga0207639_10006556 | Ga0207639_100065566 | 285 |
| 490 | 3300026078 | Ga0207702_10070362 | Ga0207702_100703622 | 285 |
| 491 | 3300026116 | Ga0207674_10001817 | Ga0207674_100018175 | 285 |
| 492 | 3300026142 | Ga0207698_10073993 | Ga0207698_100739932 | 285 |
| 493 | 3300026142 | Ga0207698_10076461 | Ga0207698_100764612 | 285 |
| 494 | 3300028380 | Ga0268265_10116274 | Ga0268265_101162742 | 285 |
| 495 | 3300028381 | Ga0268264_10039743 | Ga0268264_100397434 | 285 |
| 496 | 3300031616 | Ga0307508_10000439 | Ga0307508_1000043920 | 285 |
| 497 | 3300031616 | Ga0307508_10051566 | Ga0307508_100515663 | 285 |
| 498 | 3300031731 | Ga0307405_10199491 | Ga0307405_101994912 | 285 |
| 499 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001222 | 285 |
| 500 | 3300032002 | Ga0307416_100057440 | Ga0307416_1000574403 | 285 |
| 501 | 3300032004 | Ga0307414_10000947 | Ga0307414_100009472 | 285 |
| 502 | 3300037418 | Ga0395900_0373455 | Ga0395900_0373455_408_1265 | 285 |
| 503 | 3300037466 | Ga0395898_0209418 | Ga0395898_0209418_310_1170 | 285 |
| 504 | 3300041997 | Ga0439431_0034372 | Ga0439431_0034372_370_1230 | 285 |
| 505 | 3300042133 | Ga0450896_003380 | Ga0450896_003380_656_1516 | 285 |
| 506 | 3300044658 | Ga0466972_0000004 | Ga0466972_0000004_59280_60137 | 285 |
| 507 | 3300044683 | Ga0466965_0107621 | Ga0466965_0107621_86_943 | 285 |
| 508 | 3300044765 | Ga0466970_0000038 | Ga0466970_0000038_11411_12268 | 285 |
| 509 | 3300046511 | Ga0495608_0076625 | Ga0495608_0076625_416_1285 | 285 |
| 510 | 3300046517 | Ga0495630_0045235 | Ga0495630_0045235_1072_1941 | 285 |
| 511 | 3300046616 | Ga0495668_0000918 | Ga0495668_0000918_9298_10155 | 285 |
| 512 | 3300047321 | Ga0495676_0125571 | Ga0495676_0125571_740_1609 | 285 |
| 513 | 3300048913 | Ga0496110_0212204 | Ga0496110_0212204_274_1143 | 285 |
| 514 | 3300049744 | Ga0501083_0239525 | Ga0501083_0239525_231_1088 | 285 |
| 515 | 3300049766 | Ga0501269_001120 | Ga0501269_001120_691_1548 | 285 |
| 516 | 3300053092 | Ga0500583_0045760 | Ga0500583_0045760_1116_1973 | 285 |
| 517 | 3300053093 | Ga0500651_0000357 | Ga0500651_0000357_10211_11068 | 285 |
| 518 | 3300053147 | Ga0500589_091128 | Ga0500589_091128_286_1143 | 285 |
| 519 | 3300053153 | Ga0500616_0000853 | Ga0500616_0000853_19893_20750 | 285 |
| 520 | 3300053158 | Ga0500627_0007087 | Ga0500627_0007087_1690_2547 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gst-assembly2.cif.gz_D | crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) | 0.9581 | 1 | 283 |
| 6fog-assembly4.cif.gz_D | x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. | 0.9356 | 74 | 283 |
| 1nr9-assembly2.cif.gz_C | crystal structure of escherichia coli 1262 (apc5008), putative isomerase | 0.9218 | 72 | 279 |
| 8sut-assembly1.cif.gz_B | crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid | 0.9208 | 1 | 280 |
| 3s52-assembly1.cif.gz_D | crystal structure of a putative fumarylacetoacetate hydrolase family protein from yersinia pestis co92 | 0.9207 | 69 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VU50_128_337_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9811 | 72 | 281 | 3.90.850.10 |
| af_A0A1D8PI10_75_291_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9693 | 74 | 280 | 3.90.850.10 |
| af_A0A0R4IWE1_56_289_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9667 | 49 | 279 | 3.90.850.10 |
| af_Q9VU50_128_337_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9535 | 72 | 281 | 3.90.850.10 |
| af_Q2FZT4_90_300_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9508 | 70 | 280 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P0CI04-F1-model_v4 | Ureidoglycolate lyase | 0.9943 | 1 | 285 |
GO:0016829
GO:0044281 |
| AF-A0A2W5EY73-F1-model_v4 | Ureidoglycolate lyase | 0.9923 | 1 | 283 |
GO:0016829
GO:0044281 |
| AF-A0A1N6KGN7-F1-model_v4 | 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) | 0.9917 | 1 | 284 |
GO:0003824
GO:0044281 |
| AF-A0A7V1SP07-F1-model_v4 | FAA hydrolase family protein | 0.9912 | 78 | 284 |
GO:0016787
GO:0044281 |
| AF-A0A1V9EYH6-F1-model_v4 | Ureidoglycolate lyase | 0.99 | 1 | 283 |
GO:0016829
GO:0044281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar