F458503

General Info

Members Datasets Scaffolds Average Seq Length
520 274 493 284

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100221821|Ga0070682_1002218211
Length 302
Sequence MTLIPSYKYNKIVNFLLMKLIRFGKNGEEKPGIIIDDVYYDVSGIGEDYNETFFETGGLKRLEKFVKENKNTLPKIRSDIRLGSPVGRPSKIVCIGLNYADHAKETNAAVPSEPVIFLKASSSLCGPFDDIIIPKNSEKTDWEVELAVVIEKKASYVDEADAMNYVAGYCLHNDVSERNFQLERNGTWDKGKGCDTFAPIGPWLVTKDEIKDVNNLRLWLTVNGRTMQDGTTSNLIFKIPFLVSYVSQFMSLLPGDLISTGTPAGVGLGMKPNVYLRDGDVVELGIDGLGKAKQNVRAYQYG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
4 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
5 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
6 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
7 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
10 2739367651 Pedobacter sp. OK291 Isolate Unclassified
11 2739367656 Pedobacter sp. CF523 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
14 2818991437 Pedobacter terrae 518 Isolate Unclassified
15 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
19 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
20 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
21 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
22 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
23 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
24 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
25 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
26 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
206 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
207 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
248 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
252 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
265 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
268 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
271 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
274 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0
Isolates 5.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 0
Rhizoplane 0.96
Rhizosphere 84.23
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1583141 2162886007 Bacteria 3127
2 JGI24740J21852_10007571 3300001979 Bacteria 4399
3 JGI25154J39366_1000007 3300002738 Bacteria 335932
4 JGI25157J39369_1007547 3300002741 Bacteria 1564
5 JGI25150J39212_1000057 3300002774 Bacteria 66456
6 JGI25151J46595_10000229 3300003187 Bacteria 66456
7 JGI25153J46596_10000164 3300003215 Bacteria 66576
8 JGI25153J46596_10010292 3300003215 Bacteria 4246
9 rootL2_10005675 3300003322 Bacteria 5197
10 rootL2_10037414 3300003322 Bacteria 5002
11 rootL2_10215410 3300003322 Bacteria 2458
12 rootL2_10275501 3300003322 Unclassified 2253
13 rootH1_10029353 3300003323 Unclassified 3862
14 rootH1_10114266 3300003323 Bacteria 6762
15 rootH1_10118678 3300003323 Bacteria 9644
16 rootH1_10140347 3300003323 Bacteria 4176
17 JGI25160J50197_1011861 3300003354 Bacteria 3058
18 Ga0055536_1000011 3300003781 Bacteria 275969
19 Ga0055530_10009676 3300003791 Bacteria 3670
20 Ga0055531_10000020 3300003794 Bacteria 170186
21 Ga0065165_1011718 3300005262 Bacteria 3624
22 Ga0065714_10001191 3300005288 Bacteria 2235
23 Ga0065714_10064816 3300005288 Bacteria 18060
24 Ga0065714_10101906 3300005288 Bacteria 1633
25 Ga0065704_10072354 3300005289 Bacteria 8680
26 Ga0070658_10002567 3300005327 Bacteria 15136
27 Ga0070658_10146353 3300005327 Bacteria 1976
28 Ga0070683_100000662 3300005329 Bacteria 24891
29 Ga0070683_100001724 3300005329 Bacteria 17005
30 Ga0070683_100017331 3300005329 Bacteria 6366
31 Ga0070683_100025005 3300005329 Bacteria 5356
32 Ga0068869_100001942 3300005334 Bacteria 12403
33 Ga0068869_100136677 3300005334 Unclassified 1889
34 Ga0068869_100189904 3300005334 Bacteria 1615
35 Ga0068869_100273248 3300005334 Bacteria 1357
36 Ga0068869_100398916 3300005334 Bacteria 1131
37 Ga0070666_10200457 3300005335 Unclassified 1404
38 Ga0070682_100020469 3300005337 Bacteria 3892
39 Ga0070682_100057376 3300005337 Bacteria 2453
40 Ga0070682_100221821 3300005337 Bacteria 1346
41 Ga0068868_100008319 3300005338 Bacteria 7425
42 Ga0068868_100019295 3300005338 Bacteria 5108
43 Ga0070660_100001082 3300005339 Bacteria 18309
44 Ga0070660_100016725 3300005339 Bacteria 5332
45 Ga0070660_100018715 3300005339 Bacteria 5066
46 Ga0070660_100145900 3300005339 Bacteria 1901
47 Ga0070689_100006896 3300005340 Bacteria 7905
48 Ga0070689_100008285 3300005340 Bacteria 7315
49 Ga0070661_100038728 3300005344 Bacteria 3471
50 Ga0070661_100086262 3300005344 Bacteria 2321
51 Ga0070692_10290318 3300005345 Bacteria 995
52 Ga0070669_100042261 3300005353 Bacteria 3317
53 Ga0070675_100051747 3300005354 Bacteria 3376
54 Ga0070675_100065316 3300005354 Bacteria 3008
55 Ga0070675_100260944 3300005354 Bacteria 1518
56 Ga0070675_100516621 3300005354 Unclassified 1077
57 Ga0070671_100031889 3300005355 Bacteria 4356
58 Ga0070671_100065207 3300005355 Bacteria 3033
59 Ga0070671_100311668 3300005355 Bacteria 1340
60 Ga0070674_100035124 3300005356 Bacteria 3355
61 Ga0070673_100010330 3300005364 Bacteria 6315
62 Ga0070673_100043172 3300005364 Bacteria 3482
63 Ga0070673_100140388 3300005364 Bacteria 2037
64 Ga0070673_100178364 3300005364 Unclassified 1817
65 Ga0070688_100209991 3300005365 Unclassified 1366
66 Ga0070659_100002774 3300005366 Bacteria 12470
67 Ga0070659_100005067 3300005366 Bacteria 9446
68 Ga0070659_100028075 3300005366 Bacteria 4342
69 Ga0070659_100062646 3300005366 Bacteria 2940
70 Ga0070659_100261221 3300005366 Bacteria 1437
71 Ga0070659_100356393 3300005366 Unclassified 1228
72 Ga0070667_100022919 3300005367 Bacteria 5177
73 Ga0070667_100143922 3300005367 Bacteria 2090
74 Ga0070694_100009375 3300005444 Bacteria 6009
75 Ga0070708_100211966 3300005445 Bacteria 1815
76 Ga0070663_100168612 3300005455 Unclassified 1691
77 Ga0070663_100436919 3300005455 Bacteria 1076
78 Ga0070678_100151871 3300005456 Bacteria 1866
79 Ga0070678_100294265 3300005456 Unclassified 1377
80 Ga0070662_100007507 3300005457 Bacteria 7071
81 Ga0070662_100018322 3300005457 Bacteria 4735
82 Ga0070662_100021170 3300005457 Bacteria 4438
83 Ga0070662_100214274 3300005457 Unclassified 1534
84 Ga0070681_10172250 3300005458 Bacteria 2086
85 Ga0070681_10347823 3300005458 Bacteria 1393
86 Ga0070685_10291492 3300005466 Bacteria 1096
87 Ga0070707_100366821 3300005468 Bacteria 1399
88 Ga0070679_100000484 3300005530 Bacteria 34148
89 Ga0070679_100004268 3300005530 Bacteria 13186
90 Ga0070679_100242189 3300005530 Unclassified 1761
91 Ga0070684_100000417 3300005535 Bacteria 29183
92 Ga0070684_100005368 3300005535 Bacteria 9819
93 Ga0070684_100115144 3300005535 Bacteria 2414
94 Ga0070684_100269577 3300005535 Bacteria 1558
95 Ga0068853_100014103 3300005539 Bacteria 6543
96 Ga0068853_100042478 3300005539 Bacteria 3887
97 Ga0068853_100053696 3300005539 Bacteria 3470
98 Ga0068853_100184681 3300005539 Bacteria 1892
99 Ga0070686_100116719 3300005544 Unclassified 1827
100 Ga0070695_100003070 3300005545 Bacteria 9714
101 Ga0070696_100257466 3300005546 Bacteria 1322
102 Ga0070693_100177956 3300005547 Unclassified 1367
103 Ga0070665_100000010 3300005548 Bacteria 529545
104 Ga0070665_100456546 3300005548 Bacteria 1288
105 Ga0070704_100004154 3300005549 Bacteria 8357
106 Ga0068855_100000360 3300005563 Bacteria 56448
107 Ga0068855_100027207 3300005563 Bacteria 6842
108 Ga0068855_100044591 3300005563 Bacteria 5248
109 Ga0068855_100048426 3300005563 Bacteria 5016
110 Ga0068855_100148926 3300005563 Bacteria 2662
111 Ga0068855_100150462 3300005563 Unclassified 2647
112 Ga0068855_100532704 3300005563 Bacteria 1273
113 Ga0070664_100000360 3300005564 Bacteria 33570
114 Ga0070664_100007587 3300005564 Bacteria 8758
115 Ga0070664_100012371 3300005564 Bacteria 6935
116 Ga0070664_100132763 3300005564 Unclassified 2188
117 Ga0070664_100221358 3300005564 Bacteria 1693
118 Ga0070664_100374352 3300005564 Bacteria 1299
119 Ga0068857_100000323 3300005577 Bacteria 32881
120 Ga0068857_100042788 3300005577 Bacteria 4019
121 Ga0068857_100078124 3300005577 Bacteria 2954
122 Ga0068854_100054505 3300005578 Bacteria 2876
123 Ga0068854_100101274 3300005578 Bacteria 2160
124 Ga0068854_100402360 3300005578 Bacteria 1133
125 Ga0068856_100004342 3300005614 Bacteria 14127
126 Ga0068856_100018340 3300005614 Bacteria 6784
127 Ga0068856_100094214 3300005614 Bacteria 2981
128 Ga0068856_100116075 3300005614 Bacteria 2677
129 Ga0068856_100188479 3300005614 Bacteria 2076
130 Ga0068852_100039083 3300005616 Bacteria 3993
131 Ga0068852_100041718 3300005616 Bacteria 3880
132 Ga0068859_100028162 3300005617 Bacteria 5633
133 Ga0068859_100032535 3300005617 Bacteria 5238
134 Ga0068859_100037950 3300005617 Bacteria 4834
135 Ga0068859_100048570 3300005617 Bacteria 4263
136 Ga0068859_100066384 3300005617 Bacteria 3643
137 Ga0068859_100078812 3300005617 Bacteria 3334
138 Ga0068864_100087836 3300005618 Bacteria 2738
139 Ga0068864_100327623 3300005618 Bacteria 1440
140 Ga0068851_10025221 3300005834 Bacteria 2916
141 Ga0068863_100010153 3300005841 Bacteria 9156
142 Ga0068863_100261126 3300005841 Bacteria 1674
143 Ga0068858_100096731 3300005842 Bacteria 2752
144 Ga0068860_100026962 3300005843 Bacteria 5537
145 Ga0068860_100036841 3300005843 Bacteria 4684
146 Ga0068860_100052154 3300005843 Bacteria 3891
147 Ga0068862_100019860 3300005844 Bacteria 5610
148 Ga0068862_100024670 3300005844 Bacteria 5046
149 Ga0068862_100078764 3300005844 Bacteria 2856
150 Ga0081455_10014354 3300005937 Bacteria 7772
151 Ga0097621_100157334 3300006237 Bacteria 1951
152 Ga0097621_100432602 3300006237 Bacteria 1183
153 Ga0068871_100028668 3300006358 Bacteria 4367
154 Ga0068871_100060592 3300006358 Bacteria 3087
155 Ga0068871_100138233 3300006358 Unclassified 2070
156 Ga0068871_100141162 3300006358 Bacteria 2048
157 Ga0068871_100561494 3300006358 Unclassified 1035
158 Ga0075433_10171645 3300006852 Bacteria 1930
159 Ga0075434_100465277 3300006871 Bacteria 1286
160 Ga0097620_100028161 3300006931 Bacteria 5633
161 Ga0097620_100032535 3300006931 Bacteria 5238
162 Ga0097620_100037950 3300006931 Bacteria 4834
163 Ga0097620_100048565 3300006931 Bacteria 4263
164 Ga0097620_100066384 3300006931 Bacteria 3643
165 Ga0097620_100078812 3300006931 Bacteria 3334
166 Ga0075435_100084027 3300007076 Bacteria 2618
167 Ga0105251_10124678 3300009011 Bacteria 1169
168 Ga0105240_10010765 3300009093 Bacteria 12824
169 Ga0105240_10213603 3300009093 Bacteria 2252
170 Ga0105240_10280398 3300009093 Bacteria 1914
171 Ga0111539_10058661 3300009094 Bacteria 4566
172 Ga0114129_10007108 3300009147 Bacteria 15926
173 Ga0114129_10316847 3300009147 Bacteria 2074
174 Ga0105242_10094888 3300009176 Bacteria 2517
175 Ga0105248_10125559 3300009177 Bacteria 2895
176 Ga0105248_10269510 3300009177 Unclassified 1917
177 Ga0105237_10001536 3300009545 Bacteria 30198
178 Ga0105237_10026706 3300009545 Bacteria 5901
179 Ga0105237_10032188 3300009545 Bacteria 5311
180 Ga0105238_10428263 3300009551 Bacteria 1319
181 Ga0105249_10268600 3300009553 Bacteria 1698
182 Ga0105239_10000280 3300010375 Bacteria 75222
183 Ga0105239_10002087 3300010375 Bacteria 25905
184 Ga0105239_10040348 3300010375 Bacteria 5115
185 Ga0105239_10076122 3300010375 Bacteria 3691
186 Ga0105239_10412246 3300010375 Unclassified 1530
187 Ga0105239_10476226 3300010375 Bacteria 1418
188 Ga0105246_10016410 3300011119 Bacteria 4690
189 Ga0105246_10042710 3300011119 Unclassified 3071
190 Ga0157373_10000005 3300013100 Bacteria 262158
191 Ga0157373_10002699 3300013100 Bacteria 13449
192 Ga0157373_10003444 3300013100 Bacteria 11972
193 Ga0157373_10008374 3300013100 Bacteria 7681
194 Ga0157373_10019198 3300013100 Bacteria 4977
195 Ga0157373_10043695 3300013100 Bacteria 3200
196 Ga0157371_10000124 3300013102 Bacteria 117860
197 Ga0157371_10003262 3300013102 Bacteria 14878
198 Ga0157371_10006892 3300013102 Bacteria 9275
199 Ga0157371_10029255 3300013102 Bacteria 3987
200 Ga0157371_10205796 3300013102 Unclassified 1411
201 Ga0157370_10015356 3300013104 Bacteria 7784
202 Ga0157370_10044831 3300013104 Bacteria 4247
203 Ga0157370_10081676 3300013104 Bacteria 3041
204 Ga0157370_10149638 3300013104 Bacteria 2173
205 Ga0157370_10182328 3300013104 Bacteria 1951
206 Ga0157370_10230144 3300013104 Bacteria 1716
207 Ga0157370_10329469 3300013104 Bacteria 1408
208 Ga0157370_10351156 3300013104 Bacteria 1359
209 Ga0157370_10537853 3300013104 Bacteria 1071
210 Ga0157369_10000002 3300013105 Bacteria 524510
211 Ga0157369_10018091 3300013105 Bacteria 7904
212 Ga0157369_10054509 3300013105 Bacteria 4318
213 Ga0157369_10062149 3300013105 Bacteria 4025
214 Ga0157369_10303814 3300013105 Bacteria 1659
215 Ga0157374_10006776 3300013296 Bacteria 9739
216 Ga0157374_10007311 3300013296 Bacteria 9415
217 Ga0157374_10023239 3300013296 Bacteria 5542
218 Ga0157374_10057220 3300013296 Bacteria 3641
219 Ga0157374_10327246 3300013296 Unclassified 1520
220 Ga0157374_10465558 3300013296 Bacteria 1266
221 Ga0157378_10163877 3300013297 Bacteria 2081
222 Ga0163162_10006780 3300013306 Bacteria 11112
223 Ga0163162_10007403 3300013306 Bacteria 10676
224 Ga0163162_10024117 3300013306 Bacteria 6003
225 Ga0163162_10038703 3300013306 Bacteria 4760
226 Ga0163162_10039322 3300013306 Bacteria 4726
227 Ga0163162_10267243 3300013306 Bacteria 1842
228 Ga0157372_10000449 3300013307 Bacteria 45309
229 Ga0157372_10093998 3300013307 Bacteria 3413
230 Ga0157372_10156261 3300013307 Bacteria 2635
231 Ga0157372_10334227 3300013307 Bacteria 1765
232 Ga0157372_10601494 3300013307 Bacteria 1282
233 Ga0157375_10002645 3300013308 Bacteria 15517
234 Ga0157375_10046150 3300013308 Bacteria 4246
235 Ga0157375_10839582 3300013308 Unclassified 1066
236 Ga0163163_10246818 3300014325 Bacteria 1835
237 Ga0182008_10000037 3300014497 Bacteria 129884
238 Ga0182008_10000319 3300014497 Bacteria 37848
239 Ga0157377_10083345 3300014745 Bacteria 1873
240 Ga0157379_10015571 3300014968 Bacteria 6676
241 Ga0157379_10143813 3300014968 Bacteria 2150
242 Ga0157379_10161936 3300014968 Bacteria 2019
243 Ga0157379_10172100 3300014968 Unclassified 1955
244 Ga0157376_10034240 3300014969 Unclassified 4100
245 Ga0157376_10058283 3300014969 Bacteria 3234
246 Ga0182006_1000597 3300015261 Bacteria 26372
247 Ga0182006_1001812 3300015261 Bacteria 12304
248 Ga0182006_1009706 3300015261 Bacteria 4305
249 Ga0182007_10000001 3300015262 Bacteria 1127301
250 Ga0183373_1010 3300015682 Bacteria 196982
251 Ga0163161_10000930 3300017792 Bacteria 22600
252 Ga0163161_10001712 3300017792 Bacteria 16070
253 Ga0163161_10001917 3300017792 Bacteria 15190
254 Ga0163161_10096314 3300017792 Unclassified 2196
255 Ga0163161_10404531 3300017792 Bacteria 1095
256 Ga0213876_10084459 3300021384 Unclassified 1680
257 Ga0209436_100330 3300025208 Bacteria 21518
258 Ga0209437_100089 3300025233 Bacteria 250476
259 Ga0207425_1000007 3300025245 Bacteria 777411
260 Ga0209646_1000002 3300025246 Bacteria 1425781
261 Ga0209026_1000698 3300025250 Bacteria 19945
262 Ga0209026_1001164 3300025250 Bacteria 12249
263 Ga0209026_1004091 3300025250 Bacteria 4496
264 Ga0209129_1000006 3300025258 Bacteria 777761
265 Ga0209130_1002521 3300025284 Bacteria 8997
266 Ga0209676_1000001 3300025292 Bacteria 1852142
267 Ga0209025_1000025 3300025294 Bacteria 524454
268 Ga0209758_1000016 3300025297 Bacteria 778557
269 Ga0209758_1004196 3300025297 Bacteria 12227
270 Ga0209050_1000016 3300025298 Bacteria 729149
271 Ga0207426_1001505 3300025302 Bacteria 19050
272 Ga0207426_1001587 3300025302 Bacteria 18222
273 Ga0209257_1000001 3300025304 Bacteria 2274655
274 Ga0207697_10023220 3300025315 Bacteria 2539
275 Ga0207697_10080861 3300025315 Bacteria 1369
276 Ga0207655_1099966 3300025728 Bacteria 1001
277 Ga0207647_10019002 3300025904 Bacteria 4629
278 Ga0207645_10027321 3300025907 Bacteria 3686
279 Ga0207645_10058288 3300025907 Bacteria 2465
280 Ga0207643_10008915 3300025908 Bacteria 5387
281 Ga0207705_10000494 3300025909 Bacteria 33635
282 Ga0207705_10007832 3300025909 Bacteria 7845
283 Ga0207707_10185507 3300025912 Bacteria 1815
284 Ga0207695_10051070 3300025913 Bacteria 4344
285 Ga0207695_10064702 3300025913 Bacteria 3763
286 Ga0207695_10155415 3300025913 Bacteria 2222
287 Ga0207671_10000983 3300025914 Bacteria 35275
288 Ga0207671_10006269 3300025914 Bacteria 10641
289 Ga0207660_10040992 3300025917 Bacteria 3243
290 Ga0207662_10121353 3300025918 Bacteria 1640
291 Ga0207657_10001634 3300025919 Bacteria 24147
292 Ga0207657_10003056 3300025919 Bacteria 17905
293 Ga0207657_10060013 3300025919 Bacteria 3265
294 Ga0207657_10078237 3300025919 Bacteria 2785
295 Ga0207649_10017024 3300025920 Bacteria 4114
296 Ga0207649_10031708 3300025920 Unclassified 3144
297 Ga0207652_10000011 3300025921 Bacteria 246742
298 Ga0207652_10000043 3300025921 Bacteria 128581
299 Ga0207652_10021792 3300025921 Bacteria 5292
300 Ga0207681_10015596 3300025923 Bacteria 4741
301 Ga0207650_10031374 3300025925 Bacteria 3837
302 Ga0207687_10407093 3300025927 Bacteria 1120
303 Ga0207644_10151696 3300025931 Bacteria 1794
304 Ga0207644_10317946 3300025931 Bacteria 1258
305 Ga0207690_10003665 3300025932 Bacteria 9145
306 Ga0207690_10028013 3300025932 Bacteria 3566
307 Ga0207690_10124049 3300025932 Bacteria 1880
308 Ga0207690_10211158 3300025932 Bacteria 1480
309 Ga0207690_10316368 3300025932 Unclassified 1226
310 Ga0207706_10002652 3300025933 Bacteria 17429
311 Ga0207706_10006057 3300025933 Bacteria 11244
312 Ga0207706_10017808 3300025933 Bacteria 6400
313 Ga0207670_10009679 3300025936 Bacteria 5512
314 Ga0207669_10114871 3300025937 Bacteria 1813
315 Ga0207691_10010366 3300025940 Bacteria 8939
316 Ga0207691_10024494 3300025940 Bacteria 5676
317 Ga0207691_10135874 3300025940 Bacteria 2168
318 Ga0207691_10260600 3300025940 Unclassified 1495
319 Ga0207711_10127656 3300025941 Bacteria 2277
320 Ga0207711_10272027 3300025941 Bacteria 1559
321 Ga0207689_10003219 3300025942 Bacteria 14956
322 Ga0207689_10004134 3300025942 Bacteria 13188
323 Ga0207689_10055565 3300025942 Bacteria 3258
324 Ga0207689_10064649 3300025942 Bacteria 3009
325 Ga0207689_10205433 3300025942 Bacteria 1627
326 Ga0207689_10405942 3300025942 Bacteria 1136
327 Ga0207661_10005273 3300025944 Bacteria 9099
328 Ga0207661_10088997 3300025944 Bacteria 2567
329 Ga0207661_10116829 3300025944 Bacteria 2265
330 Ga0207661_10206807 3300025944 Bacteria 1728
331 Ga0207679_10019908 3300025945 Bacteria 4520
332 Ga0207679_10117060 3300025945 Bacteria 2114
333 Ga0207679_10155819 3300025945 Bacteria 1865
334 Ga0207679_10379106 3300025945 Bacteria 1239
335 Ga0207679_10495832 3300025945 Bacteria 1089
336 Ga0207667_10000430 3300025949 Bacteria 56466
337 Ga0207667_10004619 3300025949 Bacteria 16896
338 Ga0207667_10015868 3300025949 Bacteria 8533
339 Ga0207667_10060771 3300025949 Bacteria 3955
340 Ga0207667_10139458 3300025949 Bacteria 2496
341 Ga0207667_10235988 3300025949 Bacteria 1872
342 Ga0207651_10048170 3300025960 Bacteria 2879
343 Ga0207651_10295440 3300025960 Unclassified 1345
344 Ga0207712_10401773 3300025961 Bacteria 1152
345 Ga0207640_10251369 3300025981 Bacteria 1372
346 Ga0207640_10380274 3300025981 Bacteria 1144
347 Ga0207658_10029060 3300025986 Bacteria 3899
348 Ga0207658_10067215 3300025986 Unclassified 2699
349 Ga0207677_10013772 3300026023 Bacteria 4697
350 Ga0207677_10014146 3300026023 Bacteria 4649
351 Ga0207677_10131974 3300026023 Bacteria 1898
352 Ga0207639_10006556 3300026041 Bacteria 7914
353 Ga0207639_10062669 3300026041 Bacteria 2877
354 Ga0207639_10140044 3300026041 Bacteria 2014
355 Ga0207639_10310770 3300026041 Bacteria 1396
356 Ga0207678_10024389 3300026067 Bacteria 5281
357 Ga0207702_10000165 3300026078 Bacteria 79066
358 Ga0207702_10070362 3300026078 Bacteria 3009
359 Ga0207702_10195720 3300026078 Bacteria 1871
360 Ga0207641_10014633 3300026088 Bacteria 6432
361 Ga0207641_10028898 3300026088 Bacteria 4583
362 Ga0207648_10112157 3300026089 Unclassified 2394
363 Ga0207648_10626776 3300026089 Unclassified 993
364 Ga0207676_10012612 3300026095 Bacteria 6062
365 Ga0207674_10001817 3300026116 Bacteria 27232
366 Ga0207674_10065198 3300026116 Bacteria 3672
367 Ga0207674_10094772 3300026116 Unclassified 2971
368 Ga0207674_10099393 3300026116 Bacteria 2892
369 Ga0207683_10059307 3300026121 Bacteria 3362
370 Ga0207698_10073993 3300026142 Bacteria 2715
371 Ga0207698_10076461 3300026142 Unclassified 2680
372 Ga0268266_10000094 3300028379 Bacteria 190917
373 Ga0268266_10051486 3300028379 Bacteria 3535
374 Ga0268265_10052470 3300028380 Bacteria 3084
375 Ga0268265_10063821 3300028380 Bacteria 2835
376 Ga0268265_10116274 3300028380 Unclassified 2194
377 Ga0268264_10009666 3300028381 Bacteria 7989
378 Ga0268264_10019657 3300028381 Bacteria 5517
379 Ga0268264_10039743 3300028381 Bacteria 3887
380 Ga0268264_10086691 3300028381 Bacteria 2690
381 Ga0268264_10133939 3300028381 Bacteria 2201
382 Ga0307517_10001745 3300028786 Bacteria 35870
383 Ga0307517_10174366 3300028786 Bacteria 1405
384 Ga0307515_10000036 3300028794 Bacteria 332188
385 Ga0307515_10138380 3300028794 Bacteria 2629
386 Ga0307508_10000439 3300031616 Bacteria 49671
387 Ga0307508_10051566 3300031616 Bacteria 3657
388 Ga0307405_10000019 3300031731 Bacteria 167960
389 Ga0307405_10199491 3300031731 Bacteria 1452
390 Ga0307407_10000078 3300031903 Bacteria 34709
391 Ga0307412_10000001 3300031911 Bacteria 822691
392 Ga0307412_10000283 3300031911 Bacteria 32305
393 Ga0307416_100000375 3300032002 Bacteria 23156
394 Ga0307416_100057440 3300032002 Bacteria 3148
395 Ga0307414_10000046 3300032004 Bacteria 133496
396 Ga0307414_10000947 3300032004 Bacteria 14835
397 Ga0307414_10012740 3300032004 Bacteria 4986
398 Ga0316583_10000120 3300032133 Bacteria 18362
399 Ga0307510_10039466 3300033180 Bacteria 5200
400 Ga0373949_0037098 3300035090 Bacteria 1184
401 Ga0373947_0328959 3300035725 Bacteria 1023
402 Ga0395899_0133325 3300037312 Bacteria 1772
403 Ga0395900_0373455 3300037418 Bacteria 1395
404 Ga0395900_0418873 3300037418 Bacteria 1300
405 Ga0395900_0629260 3300037418 Bacteria 1011
406 Ga0395898_0070268 3300037466 Bacteria 3385
407 Ga0395898_0209418 3300037466 Bacteria 1860
408 Ga0395905_0204367 3300037471 Bacteria 1852
409 Ga0436365_0999976 3300039437 Bacteria 2389
410 Ga0439466_0018491 3300041411 Bacteria 2500
411 Ga0439465_0000153 3300041413 Bacteria 17071
412 Ga0439431_0034372 3300041997 Bacteria 1271
413 Ga0439445_0000001 3300042004 Bacteria 97032
414 Ga0439432_017643 3300042006 Bacteria 2394
415 Ga0450896_003380 3300042133 Unclassified 2117
416 Ga0451577_0100543 3300042876 Bacteria 2583
417 Ga0466972_0000004 3300044658 Bacteria 314413
418 Ga0453683_0161323 3300044673 Bacteria 1418
419 Ga0466965_0107621 3300044683 Bacteria 1431
420 Ga0466970_0000038 3300044765 Bacteria 47830
421 Ga0451576_0032071 3300045051 Bacteria 5599
422 Ga0495627_000002 3300046453 Bacteria 903861
423 Ga0495627_015607 3300046453 Bacteria 2618
424 Ga0495651_0032175 3300046462 Bacteria 4092
425 Ga0495606_0010400 3300046507 Bacteria 7727
426 Ga0495608_0076625 3300046511 Bacteria 2178
427 Ga0495610_0000035 3300046512 Bacteria 189683
428 Ga0495610_0003002 3300046512 Bacteria 13569
429 Ga0495616_0014695 3300046513 Bacteria 4375
430 Ga0495630_0045235 3300046517 Bacteria 3289
431 Ga0495632_0005245 3300046519 Bacteria 8619
432 Ga0495643_0001223 3300046522 Bacteria 24830
433 Ga0495643_0024420 3300046522 Bacteria 3429
434 Ga0495654_0000056 3300046530 Bacteria 140658
435 Ga0495609_0000025 3300046538 Bacteria 256898
436 Ga0495633_0000090 3300046558 Bacteria 122693
437 Ga0495633_0000562 3300046558 Bacteria 36317
438 Ga0495633_0049577 3300046558 Bacteria 1981
439 Ga0495668_0000918 3300046616 Bacteria 32911
440 Ga0495668_0002782 3300046616 Bacteria 13931
441 Ga0495625_0002377 3300046660 Bacteria 20476
442 Ga0495672_0018865 3300047320 Bacteria 4569
443 Ga0495676_0125571 3300047321 Bacteria 1860
444 Ga0495675_0051412 3300047444 Bacteria 2617
445 Ga0495686_0000034 3300047472 Bacteria 325038
446 Ga0495686_0000386 3300047472 Bacteria 70225
447 Ga0495686_0011573 3300047472 Bacteria 6211
448 Ga0496100_0216020 3300048903 Bacteria 1405
449 Ga0496101_0197404 3300048904 Bacteria 1555
450 Ga0496109_0532900 3300048912 Bacteria 1108
451 Ga0496110_0212204 3300048913 Unclassified 1760
452 Ga0496113_0008058 3300048916 Bacteria 6837
453 Ga0496125_0018749 3300048928 Bacteria 6558
454 Ga0496126_0015826 3300048929 Bacteria 7574
455 Ga0501034_0152355 3300049571 Bacteria 2287
456 Ga0501036_0334741 3300049572 Bacteria 1264
457 Ga0501039_0125619 3300049575 Bacteria 2012
458 Ga0501043_0038937 3300049579 Bacteria 3737
459 Ga0501046_0038773 3300049580 Bacteria 3821
460 Ga0501048_0043101 3300049582 Bacteria 3230
461 Ga0501073_0223255 3300049589 Bacteria 1301
462 Ga0501074_0012038 3300049590 Bacteria 6283
463 Ga0501249_024132 3300049679 Bacteria 1339
464 Ga0501251_001570 3300049681 Bacteria 2151
465 Ga0501080_0450076 3300049742 Unclassified 1154
466 Ga0501083_0194844 3300049744 Unclassified 1322
467 Ga0501083_0239525 3300049744 Bacteria 1181
468 Ga0501241_000020 3300049758 Bacteria 83005
469 Ga0501241_011219 3300049758 Bacteria 1628
470 Ga0501269_000181 3300049766 Bacteria 19450
471 Ga0501269_001120 3300049766 Bacteria 3716
472 Ga0501035_0007882 3300049822 Bacteria 9950
473 Ga0501044_0253206 3300049823 Bacteria 1701
474 nmdc:mga05p37_88161_c1 3300050507 Bacteria 3825
475 nmdc:mga08y16_53864_c1 3300050511 Bacteria 4205
476 nmdc:mga0n895_46339_c1 3300050512 Bacteria 4247
477 nmdc:mga0rr50_182091_c1 3300050513 Bacteria 1718
478 nmdc:mga0a205_77832_c1 3300050515 Bacteria 3204
479 Ga0500644_0008114 3300053088 Bacteria 2762
480 Ga0500583_0045760 3300053092 Bacteria 2011
481 Ga0500651_0000357 3300053093 Bacteria 25575
482 Ga0500562_000047 3300053108 Bacteria 62430
483 Ga0500608_000365 3300053122 Bacteria 17523
484 Ga0500608_001724 3300053122 Bacteria 7810
485 Ga0500564_148426 3300053138 Bacteria 1001
486 Ga0500568_0035235 3300053139 Bacteria 2043
487 Ga0500589_091128 3300053147 Bacteria 1343
488 Ga0500604_0030522 3300053151 Bacteria 1577
489 Ga0500616_0000853 3300053153 Bacteria 33843
490 Ga0500616_0011999 3300053153 Bacteria 5088
491 Ga0500624_000829 3300053157 Bacteria 7053
492 Ga0500627_0007087 3300053158 Bacteria 3874
493 Ga0500645_031185 3300053730 Bacteria 1602

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10005675 rootL2_100056755 265
2 3300046519 Ga0495632_0005245 Ga0495632_0005245_4775_5734 266
3 3300005329 Ga0070683_100025005 Ga0070683_1000250053 270
4 3300005337 Ga0070682_100020469 Ga0070682_1000204693 270
5 3300005338 Ga0068868_100019295 Ga0068868_1000192953 270
6 3300005339 Ga0070660_100018715 Ga0070660_1000187153 270
7 3300005344 Ga0070661_100038728 Ga0070661_1000387283 270
8 3300005354 Ga0070675_100051747 Ga0070675_1000517473 270
9 3300005366 Ga0070659_100028075 Ga0070659_1000280752 270
10 3300005456 Ga0070678_100151871 Ga0070678_1001518712 270
11 3300005457 Ga0070662_100021170 Ga0070662_1000211706 270
12 3300005530 Ga0070679_100242189 Ga0070679_1002421892 270
13 3300005535 Ga0070684_100115144 Ga0070684_1001151442 270
14 3300005539 Ga0068853_100053696 Ga0068853_1000536966 270
15 3300005547 Ga0070693_100177956 Ga0070693_1001779561 270
16 3300005577 Ga0068857_100042788 Ga0068857_1000427884 270
17 3300005578 Ga0068854_100101274 Ga0068854_1001012744 270
18 3300005614 Ga0068856_100188479 Ga0068856_1001884793 270
19 3300005616 Ga0068852_100041718 Ga0068852_1000417183 270
20 3300006358 Ga0068871_100060592 Ga0068871_1000605921 270
21 3300009177 Ga0105248_10125559 Ga0105248_101255593 270
22 3300013306 Ga0163162_10007403 Ga0163162_100074031 270
23 3300025919 Ga0207657_10003056 Ga0207657_100030563 270
24 3300025920 Ga0207649_10031708 Ga0207649_100317082 270
25 3300025933 Ga0207706_10002652 Ga0207706_1000265211 270
26 3300025941 Ga0207711_10272027 Ga0207711_102720272 270
27 3300025945 Ga0207679_10117060 Ga0207679_101170603 270
28 3300026023 Ga0207677_10013772 Ga0207677_100137725 270
29 3300026041 Ga0207639_10062669 Ga0207639_100626694 270
30 3300026116 Ga0207674_10065198 Ga0207674_100651984 270
31 3300010375 Ga0105239_10076122 Ga0105239_100761226 273
32 3300025925 Ga0207650_10031374 Ga0207650_100313743 276
33 3300003322 rootL2_10037414 rootL2_100374142 277
34 3300003322 rootL2_10275501 rootL2_102755013 277
35 3300003323 rootH1_10114266 rootH1_101142668 277
36 3300005841 Ga0068863_100261126 Ga0068863_1002611262 277
37 3300005937 Ga0081455_10014354 Ga0081455_100143544 277
38 3300007076 Ga0075435_100084027 Ga0075435_1000840272 277
39 3300014969 Ga0157376_10034240 Ga0157376_100342402 277
40 3300026088 Ga0207641_10014633 Ga0207641_100146336 277
41 3300028794 Ga0307515_10138380 Ga0307515_101383803 277
42 3300035090 Ga0373949_0037098 Ga0373949_0037098_19_876 277
43 3300050507 nmdc:mga05p37_88161_c1 nmdc:mga05p37_88161_c1_2897_3754 277
44 3300050512 nmdc:mga0n895_46339_c1 nmdc:mga0n895_46339_c1_555_1412 277
45 3300050513 nmdc:mga0rr50_182091_c1 nmdc:mga0rr50_182091_c1_495_1352 277
46 3300050515 nmdc:mga0a205_77832_c1 nmdc:mga0a205_77832_c1_1934_2791 277
47 iso_pu_bacteria 2738541273 2738698313 277
48 iso_pu_bacteria 2738543014 2739252639 277
49 3300009545 Ga0105237_10001536 Ga0105237_1000153627 278
50 3300025914 Ga0207671_10000983 Ga0207671_1000098327 278
51 3300028786 Ga0307517_10001745 Ga0307517_1000174511 278
52 3300042876 Ga0451577_0100543 Ga0451577_0100543_619_1470 278
53 3300044673 Ga0453683_0161323 Ga0453683_0161323_56_907 278
54 3300045051 Ga0451576_0032071 Ga0451576_0032071_4007_4858 278
55 iso_pu_bacteria 2585428061 2587751790 278
56 iso_pu_bacteria 2585428095 2587865784 278
57 iso_pu_bacteria 2585428115 2587943943 278
58 iso_pu_bacteria 2585428187 2588231822 278
59 iso_pu_bacteria 2739367656 2739615776 278
60 iso_pu_bacteria 2775506739 2775672155 278
61 iso_pu_bacteria 2919097161 2919099238 278
62 iso_pu_bacteria 2945924605 2945926542 278
63 iso_pu_bacteria 2585427687 2586210286 279
64 iso_pu_bacteria 2738541302 2738853315 279
65 iso_pu_bacteria 2739367651 2739588733 279
66 iso_pu_bacteria 2739367663 2739645411 279
67 iso_pu_bacteria 2818991437 2819548066 279
68 iso_pu_bacteria 2842722452 2842726133 279
69 iso_pu_bacteria 2842909656 2842910406 279
70 iso_pu_bacteria 2849281842 2849282303 279
71 iso_pu_bacteria 2857627736 2857628461 279
72 iso_pu_bacteria 2904445276 2904445631 279
73 iso_pu_bacteria 2929921140 2929923429 279
74 iso_pu_bacteria 2945997725 2946000746 279
75 iso_pu_bacteria 2954016120 2954017629 279
76 iso_pu_bacteria 8003151029 8003152833 279
77 3300013104 Ga0157370_10015356 Ga0157370_100153562 280
78 3300046558 Ga0495633_0000090 Ga0495633_0000090_10898_11740 280
79 iso_pu_bacteria 2929154850 2929155301 280
80 iso_pu_bacteria 2977232053 2977232607 280
81 3300005356 Ga0070674_100035124 Ga0070674_1000351244 281
82 3300005563 Ga0068855_100000360 Ga0068855_10000036041 281
83 3300005563 Ga0068855_100532704 Ga0068855_1005327042 281
84 3300005578 Ga0068854_100402360 Ga0068854_1004023601 281
85 3300005614 Ga0068856_100116075 Ga0068856_1001160752 281
86 3300009093 Ga0105240_10010765 Ga0105240_100107653 281
87 3300009093 Ga0105240_10280398 Ga0105240_102803982 281
88 3300009545 Ga0105237_10026706 Ga0105237_100267064 281
89 3300009551 Ga0105238_10428263 Ga0105238_104282632 281
90 3300010375 Ga0105239_10000280 Ga0105239_1000028071 281
91 3300010375 Ga0105239_10002087 Ga0105239_1000208715 281
92 3300013104 Ga0157370_10329469 Ga0157370_103294692 281
93 3300013306 Ga0163162_10267243 Ga0163162_102672432 281
94 3300017792 Ga0163161_10404531 Ga0163161_104045312 281
95 3300025233 Ga0209437_100089 Ga0209437_10008944 281
96 3300025913 Ga0207695_10051070 Ga0207695_100510704 281
97 3300025913 Ga0207695_10155415 Ga0207695_101554152 281
98 3300025914 Ga0207671_10006269 Ga0207671_100062692 281
99 3300025937 Ga0207669_10114871 Ga0207669_101148712 281
100 3300025949 Ga0207667_10000430 Ga0207667_1000043041 281
101 3300025949 Ga0207667_10060771 Ga0207667_100607715 281
102 3300025981 Ga0207640_10380274 Ga0207640_103802742 281
103 3300026078 Ga0207702_10195720 Ga0207702_101957202 281
104 3300046462 Ga0495651_0032175 Ga0495651_0032175_389_1234 281
105 3300046558 Ga0495633_0000562 Ga0495633_0000562_29525_30481 281
106 3300049571 Ga0501034_0152355 Ga0501034_0152355_99_947 281
107 3300049572 Ga0501036_0334741 Ga0501036_0334741_122_970 281
108 3300049575 Ga0501039_0125619 Ga0501039_0125619_772_1620 281
109 3300049579 Ga0501043_0038937 Ga0501043_0038937_775_1623 281
110 3300049580 Ga0501046_0038773 Ga0501046_0038773_647_1495 281
111 3300049582 Ga0501048_0043101 Ga0501048_0043101_2091_2939 281
112 3300049589 Ga0501073_0223255 Ga0501073_0223255_422_1270 281
113 3300049590 Ga0501074_0012038 Ga0501074_0012038_4342_5190 281
114 3300049742 Ga0501080_0450076 Ga0501080_0450076_208_1056 281
115 3300049744 Ga0501083_0194844 Ga0501083_0194844_248_1096 281
116 3300049822 Ga0501035_0007882 Ga0501035_0007882_2484_3332 281
117 3300049823 Ga0501044_0253206 Ga0501044_0253206_13_861 281
118 3300053122 Ga0500608_001724 Ga0500608_001724_2459_3304 281
119 3300053138 Ga0500564_148426 Ga0500564_148426_128_973 281
120 3300053157 Ga0500624_000829 Ga0500624_000829_3080_3925 281
121 iso_pu_bacteria 8055588893 8055589237 281
122 3300002774 JGI25150J39212_1000057 JGI25150J39212_100005719 282
123 3300003187 JGI25151J46595_10000229 JGI25151J46595_1000022919 282
124 3300003215 JGI25153J46596_10000164 JGI25153J46596_1000016427 282
125 3300005329 Ga0070683_100000662 Ga0070683_1000006627 282
126 3300005337 Ga0070682_100057376 Ga0070682_1000573762 282
127 3300005339 Ga0070660_100001082 Ga0070660_1000010826 282
128 3300005339 Ga0070660_100016725 Ga0070660_1000167252 282
129 3300005339 Ga0070660_100145900 Ga0070660_1001459002 282
130 3300005340 Ga0070689_100008285 Ga0070689_1000082854 282
131 3300005345 Ga0070692_10290318 Ga0070692_102903181 282
132 3300005353 Ga0070669_100042261 Ga0070669_1000422612 282
133 3300005354 Ga0070675_100065316 Ga0070675_1000653163 282
134 3300005355 Ga0070671_100065207 Ga0070671_1000652072 282
135 3300005355 Ga0070671_100311668 Ga0070671_1003116682 282
136 3300005364 Ga0070673_100010330 Ga0070673_1000103304 282
137 3300005366 Ga0070659_100002774 Ga0070659_1000027744 282
138 3300005366 Ga0070659_100062646 Ga0070659_1000626463 282
139 3300005367 Ga0070667_100143922 Ga0070667_1001439222 282
140 3300005455 Ga0070663_100436919 Ga0070663_1004369191 282
141 3300005458 Ga0070681_10172250 Ga0070681_101722502 282
142 3300005535 Ga0070684_100005368 Ga0070684_1000053689 282
143 3300005539 Ga0068853_100042478 Ga0068853_1000424783 282
144 3300005546 Ga0070696_100257466 Ga0070696_1002574661 282
145 3300005563 Ga0068855_100027207 Ga0068855_1000272076 282
146 3300005564 Ga0070664_100007587 Ga0070664_1000075874 282
147 3300005564 Ga0070664_100221358 Ga0070664_1002213582 282
148 3300005564 Ga0070664_100374352 Ga0070664_1003743522 282
149 3300005577 Ga0068857_100078124 Ga0068857_1000781244 282
150 3300005614 Ga0068856_100004342 Ga0068856_1000043429 282
151 3300005617 Ga0068859_100078812 Ga0068859_1000788122 282
152 3300005618 Ga0068864_100327623 Ga0068864_1003276232 282
153 3300005834 Ga0068851_10025221 Ga0068851_100252214 282
154 3300006237 Ga0097621_100432602 Ga0097621_1004326022 282
155 3300006358 Ga0068871_100028668 Ga0068871_1000286684 282
156 3300006931 Ga0097620_100078812 Ga0097620_1000788123 282
157 3300013100 Ga0157373_10000005 Ga0157373_10000005215 282
158 3300013100 Ga0157373_10002699 Ga0157373_1000269913 282
159 3300013100 Ga0157373_10043695 Ga0157373_100436952 282
160 3300013102 Ga0157371_10029255 Ga0157371_100292555 282
161 3300013102 Ga0157371_10205796 Ga0157371_102057962 282
162 3300013105 Ga0157369_10054509 Ga0157369_100545095 282
163 3300013105 Ga0157369_10062149 Ga0157369_100621495 282
164 3300013105 Ga0157369_10303814 Ga0157369_103038142 282
165 3300013296 Ga0157374_10465558 Ga0157374_104655582 282
166 3300013307 Ga0157372_10156261 Ga0157372_101562612 282
167 3300013308 Ga0157375_10002645 Ga0157375_1000264514 282
168 3300013308 Ga0157375_10046150 Ga0157375_100461502 282
169 3300014497 Ga0182008_10000037 Ga0182008_10000037101 282
170 3300014968 Ga0157379_10143813 Ga0157379_101438132 282
171 3300025245 Ga0207425_1000007 Ga0207425_1000007195 282
172 3300025258 Ga0209129_1000006 Ga0209129_1000006195 282
173 3300025294 Ga0209025_1000025 Ga0209025_100002525 282
174 3300025297 Ga0209758_1000016 Ga0209758_1000016195 282
175 3300025315 Ga0207697_10023220 Ga0207697_100232203 282
176 3300025907 Ga0207645_10058288 Ga0207645_100582883 282
177 3300025908 Ga0207643_10008915 Ga0207643_100089154 282
178 3300025909 Ga0207705_10007832 Ga0207705_100078322 282
179 3300025917 Ga0207660_10040992 Ga0207660_100409922 282
180 3300025918 Ga0207662_10121353 Ga0207662_101213532 282
181 3300025919 Ga0207657_10001634 Ga0207657_1000163421 282
182 3300025919 Ga0207657_10060013 Ga0207657_100600132 282
183 3300025919 Ga0207657_10078237 Ga0207657_100782372 282
184 3300025921 Ga0207652_10021792 Ga0207652_100217923 282
185 3300025927 Ga0207687_10407093 Ga0207687_104070932 282
186 3300025931 Ga0207644_10151696 Ga0207644_101516962 282
187 3300025932 Ga0207690_10028013 Ga0207690_100280131 282
188 3300025932 Ga0207690_10124049 Ga0207690_101240492 282
189 3300025932 Ga0207690_10211158 Ga0207690_102111582 282
190 3300025940 Ga0207691_10010366 Ga0207691_100103666 282
191 3300025941 Ga0207711_10127656 Ga0207711_101276562 282
192 3300025944 Ga0207661_10116829 Ga0207661_101168292 282
193 3300025945 Ga0207679_10155819 Ga0207679_101558192 282
194 3300025945 Ga0207679_10495832 Ga0207679_104958322 282
195 3300025949 Ga0207667_10015868 Ga0207667_100158687 282
196 3300025986 Ga0207658_10029060 Ga0207658_100290603 282
197 3300026041 Ga0207639_10140044 Ga0207639_101400443 282
198 3300026078 Ga0207702_10000165 Ga0207702_1000016555 282
199 3300026116 Ga0207674_10094772 Ga0207674_100947724 282
200 3300026116 Ga0207674_10099393 Ga0207674_100993934 282
201 3300028794 Ga0307515_10000036 Ga0307515_10000036212 282
202 3300031911 Ga0307412_10000283 Ga0307412_1000028329 282
203 3300032004 Ga0307414_10000046 Ga0307414_1000004653 282
204 3300032133 Ga0316583_10000120 Ga0316583_100001206 282
205 3300037312 Ga0395899_0133325 Ga0395899_0133325_496_1344 282
206 3300037418 Ga0395900_0418873 Ga0395900_0418873_439_1287 282
207 3300037418 Ga0395900_0629260 Ga0395900_0629260_12_860 282
208 3300037466 Ga0395898_0070268 Ga0395898_0070268_2117_2965 282
209 3300037471 Ga0395905_0204367 Ga0395905_0204367_489_1343 282
210 3300041411 Ga0439466_0018491 Ga0439466_0018491_554_1405 282
211 3300041413 Ga0439465_0000153 Ga0439465_0000153_5929_6780 282
212 3300042004 Ga0439445_0000001 Ga0439445_0000001_1535_2386 282
213 3300042006 Ga0439432_017643 Ga0439432_017643_378_1229 282
214 3300046453 Ga0495627_000002 Ga0495627_000002_392043_392894 282
215 3300046453 Ga0495627_015607 Ga0495627_015607_897_1853 282
216 3300046507 Ga0495606_0010400 Ga0495606_0010400_593_1444 282
217 3300046522 Ga0495643_0024420 Ga0495643_0024420_1083_2039 282
218 3300046530 Ga0495654_0000056 Ga0495654_0000056_28127_29020 282
219 3300046538 Ga0495609_0000025 Ga0495609_0000025_118969_119895 282
220 3300046616 Ga0495668_0002782 Ga0495668_0002782_8496_9350 282
221 3300046660 Ga0495625_0002377 Ga0495625_0002377_13027_13986 282
222 3300047444 Ga0495675_0051412 Ga0495675_0051412_1028_1882 282
223 3300047472 Ga0495686_0000386 Ga0495686_0000386_32210_33061 282
224 3300047472 Ga0495686_0011573 Ga0495686_0011573_330_1181 282
225 3300048903 Ga0496100_0216020 Ga0496100_0216020_284_1138 282
226 3300048904 Ga0496101_0197404 Ga0496101_0197404_86_940 282
227 3300048912 Ga0496109_0532900 Ga0496109_0532900_189_1043 282
228 3300048916 Ga0496113_0008058 Ga0496113_0008058_429_1283 282
229 3300048928 Ga0496125_0018749 Ga0496125_0018749_3634_4485 282
230 3300049681 Ga0501251_001570 Ga0501251_001570_1218_2069 282
231 3300049758 Ga0501241_000020 Ga0501241_000020_52831_53682 282
232 3300049766 Ga0501269_000181 Ga0501269_000181_14931_15782 282
233 3300053151 Ga0500604_0030522 Ga0500604_0030522_110_964 282
234 3300001979 JGI24740J21852_10007571 JGI24740J21852_100075715 283
235 3300002738 JGI25154J39366_1000007 JGI25154J39366_100000797 283
236 3300003215 JGI25153J46596_10010292 JGI25153J46596_100102923 283
237 3300003323 rootH1_10140347 rootH1_101403473 283
238 3300003354 JGI25160J50197_1011861 JGI25160J50197_10118612 283
239 3300003781 Ga0055536_1000011 Ga0055536_10000118 283
240 3300003791 Ga0055530_10009676 Ga0055530_100096763 283
241 3300003794 Ga0055531_10000020 Ga0055531_10000020108 283
242 3300005262 Ga0065165_1011718 Ga0065165_10117182 283
243 3300005288 Ga0065714_10064816 Ga0065714_100648161 283
244 3300005327 Ga0070658_10146353 Ga0070658_101463534 283
245 3300005334 Ga0068869_100398916 Ga0068869_1003989162 283
246 3300005364 Ga0070673_100140388 Ga0070673_1001403882 283
247 3300005445 Ga0070708_100211966 Ga0070708_1002119662 283
248 3300005530 Ga0070679_100000484 Ga0070679_10000048419 283
249 3300005539 Ga0068853_100184681 Ga0068853_1001846811 283
250 3300005548 Ga0070665_100000010 Ga0070665_100000010141 283
251 3300005617 Ga0068859_100032535 Ga0068859_1000325352 283
252 3300005617 Ga0068859_100048570 Ga0068859_1000485704 283
253 3300005617 Ga0068859_100066384 Ga0068859_1000663844 283
254 3300005841 Ga0068863_100010153 Ga0068863_1000101539 283
255 3300005843 Ga0068860_100026962 Ga0068860_1000269626 283
256 3300005843 Ga0068860_100036841 Ga0068860_1000368415 283
257 3300005844 Ga0068862_100019860 Ga0068862_1000198604 283
258 3300005844 Ga0068862_100024670 Ga0068862_1000246705 283
259 3300006358 Ga0068871_100141162 Ga0068871_1001411622 283
260 3300006931 Ga0097620_100032535 Ga0097620_1000325357 283
261 3300006931 Ga0097620_100048565 Ga0097620_1000485654 283
262 3300006931 Ga0097620_100066384 Ga0097620_1000663842 283
263 3300009094 Ga0111539_10058661 Ga0111539_100586614 283
264 3300009147 Ga0114129_10316847 Ga0114129_103168472 283
265 3300009176 Ga0105242_10094888 Ga0105242_100948883 283
266 3300009553 Ga0105249_10268600 Ga0105249_102686002 283
267 3300010375 Ga0105239_10476226 Ga0105239_104762262 283
268 3300011119 Ga0105246_10016410 Ga0105246_100164104 283
269 3300013102 Ga0157371_10000124 Ga0157371_1000012452 283
270 3300013104 Ga0157370_10044831 Ga0157370_100448314 283
271 3300013104 Ga0157370_10081676 Ga0157370_100816762 283
272 3300013104 Ga0157370_10230144 Ga0157370_102301441 283
273 3300013105 Ga0157369_10000002 Ga0157369_10000002334 283
274 3300013306 Ga0163162_10006780 Ga0163162_100067803 283
275 3300014497 Ga0182008_10000319 Ga0182008_1000031915 283
276 3300014968 Ga0157379_10161936 Ga0157379_101619362 283
277 3300015261 Ga0182006_1000597 Ga0182006_100059712 283
278 3300015261 Ga0182006_1001812 Ga0182006_10018124 283
279 3300015262 Ga0182007_10000001 Ga0182007_10000001448 283
280 3300015682 Ga0183373_1010 Ga0183373_101065 283
281 3300017792 Ga0163161_10000930 Ga0163161_100009306 283
282 3300017792 Ga0163161_10001917 Ga0163161_1000191713 283
283 3300025208 Ga0209436_100330 Ga0209436_10033018 283
284 3300025246 Ga0209646_1000002 Ga0209646_1000002701 283
285 3300025250 Ga0209026_1000698 Ga0209026_10006987 283
286 3300025284 Ga0209130_1002521 Ga0209130_100252110 283
287 3300025292 Ga0209676_1000001 Ga0209676_1000001946 283
288 3300025297 Ga0209758_1004196 Ga0209758_10041962 283
289 3300025298 Ga0209050_1000016 Ga0209050_1000016612 283
290 3300025302 Ga0207426_1001505 Ga0207426_10015054 283
291 3300025302 Ga0207426_1001587 Ga0207426_100158714 283
292 3300025304 Ga0209257_1000001 Ga0209257_10000011276 283
293 3300025728 Ga0207655_1099966 Ga0207655_10999661 283
294 3300025921 Ga0207652_10000011 Ga0207652_1000001161 283
295 3300025923 Ga0207681_10015596 Ga0207681_100155963 283
296 3300025940 Ga0207691_10135874 Ga0207691_101358743 283
297 3300025942 Ga0207689_10205433 Ga0207689_102054332 283
298 3300025942 Ga0207689_10405942 Ga0207689_104059421 283
299 3300026023 Ga0207677_10014146 Ga0207677_100141464 283
300 3300026041 Ga0207639_10310770 Ga0207639_103107701 283
301 3300026088 Ga0207641_10028898 Ga0207641_100288982 283
302 3300026089 Ga0207648_10112157 Ga0207648_101121572 283
303 3300028379 Ga0268266_10000094 Ga0268266_10000094141 283
304 3300028380 Ga0268265_10052470 Ga0268265_100524703 283
305 3300028380 Ga0268265_10063821 Ga0268265_100638213 283
306 3300028381 Ga0268264_10009666 Ga0268264_100096662 283
307 3300028381 Ga0268264_10019657 Ga0268264_100196572 283
308 3300028381 Ga0268264_10133939 Ga0268264_101339391 283
309 3300028786 Ga0307517_10174366 Ga0307517_101743662 283
310 3300031731 Ga0307405_10000019 Ga0307405_10000019103 283
311 3300031903 Ga0307407_10000078 Ga0307407_100000789 283
312 3300032002 Ga0307416_100000375 Ga0307416_1000003759 283
313 3300032004 Ga0307414_10012740 Ga0307414_100127405 283
314 3300033180 Ga0307510_10039466 Ga0307510_100394665 283
315 3300046512 Ga0495610_0000035 Ga0495610_0000035_155534_156388 283
316 3300046512 Ga0495610_0003002 Ga0495610_0003002_8032_8886 283
317 3300046513 Ga0495616_0014695 Ga0495616_0014695_2946_3800 283
318 3300046522 Ga0495643_0001223 Ga0495643_0001223_8825_9679 283
319 3300046558 Ga0495633_0049577 Ga0495633_0049577_896_1750 283
320 3300047472 Ga0495686_0000034 Ga0495686_0000034_260345_261196 283
321 3300048929 Ga0496126_0015826 Ga0496126_0015826_535_1386 283
322 3300049679 Ga0501249_024132 Ga0501249_024132_341_1195 283
323 3300049758 Ga0501241_011219 Ga0501241_011219_525_1376 283
324 3300050511 nmdc:mga08y16_53864_c1 nmdc:mga08y16_53864_c1_665_1522 283
325 3300053122 Ga0500608_000365 Ga0500608_000365_16371_17222 283
326 3300053139 Ga0500568_0035235 Ga0500568_0035235_644_1495 283
327 3300053153 Ga0500616_0011999 Ga0500616_0011999_3027_3878 283
328 3300005329 Ga0070683_100017331 Ga0070683_1000173315 284
329 3300005334 Ga0068869_100189904 Ga0068869_1001899042 284
330 3300005334 Ga0068869_100273248 Ga0068869_1002732482 284
331 3300005340 Ga0070689_100006896 Ga0070689_1000068966 284
332 3300005344 Ga0070661_100086262 Ga0070661_1000862622 284
333 3300005354 Ga0070675_100260944 Ga0070675_1002609442 284
334 3300005355 Ga0070671_100031889 Ga0070671_1000318893 284
335 3300005364 Ga0070673_100043172 Ga0070673_1000431723 284
336 3300005364 Ga0070673_100178364 Ga0070673_1001783642 284
337 3300005366 Ga0070659_100261221 Ga0070659_1002612212 284
338 3300005444 Ga0070694_100009375 Ga0070694_1000093752 284
339 3300005455 Ga0070663_100168612 Ga0070663_1001686121 284
340 3300005456 Ga0070678_100294265 Ga0070678_1002942652 284
341 3300005457 Ga0070662_100007507 Ga0070662_1000075077 284
342 3300005457 Ga0070662_100018322 Ga0070662_1000183222 284
343 3300005468 Ga0070707_100366821 Ga0070707_1003668212 284
344 3300005545 Ga0070695_100003070 Ga0070695_1000030705 284
345 3300005548 Ga0070665_100456546 Ga0070665_1004565461 284
346 3300005549 Ga0070704_100004154 Ga0070704_1000041546 284
347 3300005563 Ga0068855_100048426 Ga0068855_1000484262 284
348 3300005564 Ga0070664_100012371 Ga0070664_1000123716 284
349 3300005614 Ga0068856_100018340 Ga0068856_1000183406 284
350 3300005618 Ga0068864_100087836 Ga0068864_1000878362 284
351 3300005842 Ga0068858_100096731 Ga0068858_1000967313 284
352 3300006358 Ga0068871_100138233 Ga0068871_1001382332 284
353 3300006852 Ga0075433_10171645 Ga0075433_101716451 284
354 3300006871 Ga0075434_100465277 Ga0075434_1004652772 284
355 3300009011 Ga0105251_10124678 Ga0105251_101246782 284
356 3300009147 Ga0114129_10007108 Ga0114129_100071085 284
357 3300011119 Ga0105246_10042710 Ga0105246_100427102 284
358 3300013296 Ga0157374_10006776 Ga0157374_100067765 284
359 3300013296 Ga0157374_10057220 Ga0157374_100572203 284
360 3300013296 Ga0157374_10327246 Ga0157374_103272462 284
361 3300013307 Ga0157372_10334227 Ga0157372_103342272 284
362 3300013307 Ga0157372_10601494 Ga0157372_106014942 284
363 3300014325 Ga0163163_10246818 Ga0163163_102468181 284
364 3300014968 Ga0157379_10172100 Ga0157379_101721001 284
365 3300014969 Ga0157376_10058283 Ga0157376_100582832 284
366 3300021384 Ga0213876_10084459 Ga0213876_100844592 284
367 3300025250 Ga0209026_1004091 Ga0209026_10040915 284
368 3300025315 Ga0207697_10080861 Ga0207697_100808611 284
369 3300025904 Ga0207647_10019002 Ga0207647_100190024 284
370 3300025920 Ga0207649_10017024 Ga0207649_100170241 284
371 3300025931 Ga0207644_10317946 Ga0207644_103179461 284
372 3300025933 Ga0207706_10006057 Ga0207706_100060572 284
373 3300025933 Ga0207706_10017808 Ga0207706_100178082 284
374 3300025936 Ga0207670_10009679 Ga0207670_100096792 284
375 3300025940 Ga0207691_10024494 Ga0207691_100244943 284
376 3300025942 Ga0207689_10003219 Ga0207689_100032198 284
377 3300025942 Ga0207689_10055565 Ga0207689_100555651 284
378 3300025942 Ga0207689_10064649 Ga0207689_100646492 284
379 3300025944 Ga0207661_10088997 Ga0207661_100889972 284
380 3300025945 Ga0207679_10379106 Ga0207679_103791062 284
381 3300025949 Ga0207667_10004619 Ga0207667_1000461914 284
382 3300025960 Ga0207651_10295440 Ga0207651_102954401 284
383 3300025961 Ga0207712_10401773 Ga0207712_104017731 284
384 3300026067 Ga0207678_10024389 Ga0207678_100243895 284
385 3300026089 Ga0207648_10626776 Ga0207648_106267761 284
386 3300026095 Ga0207676_10012612 Ga0207676_100126126 284
387 3300026121 Ga0207683_10059307 Ga0207683_100593072 284
388 3300028379 Ga0268266_10051486 Ga0268266_100514863 284
389 3300028381 Ga0268264_10086691 Ga0268264_100866912 284
390 3300035725 Ga0373947_0328959 Ga0373947_0328959_46_900 284
391 3300039437 Ga0436365_0999976 Ga0436365_0999976_789_1643 284
392 3300047320 Ga0495672_0018865 Ga0495672_0018865_2355_3209 284
393 3300053088 Ga0500644_0008114 Ga0500644_0008114_195_1049 284
394 3300053108 Ga0500562_000047 Ga0500562_000047_34754_35608 284
395 3300053730 Ga0500645_031185 Ga0500645_031185_346_1200 284
396 2162886007 SwRhRL2b_contig_1583141 SwRhRL2b_0345.00001730 285
397 3300002741 JGI25157J39369_1007547 JGI25157J39369_10075472 285
398 3300003322 rootL2_10215410 rootL2_102154102 285
399 3300003323 rootH1_10029353 rootH1_100293534 285
400 3300003323 rootH1_10118678 rootH1_101186782 285
401 3300005288 Ga0065714_10001191 Ga0065714_100011912 285
402 3300005288 Ga0065714_10101906 Ga0065714_101019062 285
403 3300005289 Ga0065704_10072354 Ga0065704_100723542 285
404 3300005327 Ga0070658_10002567 Ga0070658_100025676 285
405 3300005329 Ga0070683_100001724 Ga0070683_1000017249 285
406 3300005334 Ga0068869_100001942 Ga0068869_1000019422 285
407 3300005334 Ga0068869_100136677 Ga0068869_1001366772 285
408 3300005335 Ga0070666_10200457 Ga0070666_102004571 285
409 3300005337 Ga0070682_100221821 Ga0070682_1002218211 285
410 3300005338 Ga0068868_100008319 Ga0068868_1000083196 285
411 3300005354 Ga0070675_100516621 Ga0070675_1005166212 285
412 3300005365 Ga0070688_100209991 Ga0070688_1002099912 285
413 3300005366 Ga0070659_100005067 Ga0070659_1000050672 285
414 3300005366 Ga0070659_100356393 Ga0070659_1003563932 285
415 3300005367 Ga0070667_100022919 Ga0070667_1000229193 285
416 3300005457 Ga0070662_100214274 Ga0070662_1002142742 285
417 3300005458 Ga0070681_10347823 Ga0070681_103478232 285
418 3300005466 Ga0070685_10291492 Ga0070685_102914921 285
419 3300005530 Ga0070679_100004268 Ga0070679_1000042687 285
420 3300005535 Ga0070684_100000417 Ga0070684_10000041723 285
421 3300005535 Ga0070684_100269577 Ga0070684_1002695772 285
422 3300005539 Ga0068853_100014103 Ga0068853_1000141035 285
423 3300005544 Ga0070686_100116719 Ga0070686_1001167192 285
424 3300005563 Ga0068855_100044591 Ga0068855_1000445914 285
425 3300005563 Ga0068855_100148926 Ga0068855_1001489262 285
426 3300005563 Ga0068855_100150462 Ga0068855_1001504622 285
427 3300005564 Ga0070664_100000360 Ga0070664_10000036022 285
428 3300005564 Ga0070664_100132763 Ga0070664_1001327632 285
429 3300005577 Ga0068857_100000323 Ga0068857_1000003235 285
430 3300005578 Ga0068854_100054505 Ga0068854_1000545052 285
431 3300005614 Ga0068856_100094214 Ga0068856_1000942144 285
432 3300005616 Ga0068852_100039083 Ga0068852_1000390832 285
433 3300005617 Ga0068859_100028162 Ga0068859_1000281624 285
434 3300005617 Ga0068859_100037950 Ga0068859_1000379505 285
435 3300005843 Ga0068860_100052154 Ga0068860_1000521544 285
436 3300005844 Ga0068862_100078764 Ga0068862_1000787643 285
437 3300006237 Ga0097621_100157334 Ga0097621_1001573342 285
438 3300006358 Ga0068871_100561494 Ga0068871_1005614941 285
439 3300006931 Ga0097620_100028161 Ga0097620_1000281615 285
440 3300006931 Ga0097620_100037950 Ga0097620_1000379505 285
441 3300009093 Ga0105240_10213603 Ga0105240_102136032 285
442 3300009177 Ga0105248_10269510 Ga0105248_102695102 285
443 3300009545 Ga0105237_10032188 Ga0105237_100321882 285
444 3300010375 Ga0105239_10040348 Ga0105239_100403486 285
445 3300010375 Ga0105239_10412246 Ga0105239_104122462 285
446 3300013100 Ga0157373_10003444 Ga0157373_100034442 285
447 3300013100 Ga0157373_10008374 Ga0157373_100083744 285
448 3300013100 Ga0157373_10019198 Ga0157373_100191984 285
449 3300013102 Ga0157371_10003262 Ga0157371_100032626 285
450 3300013102 Ga0157371_10006892 Ga0157371_100068927 285
451 3300013104 Ga0157370_10149638 Ga0157370_101496381 285
452 3300013104 Ga0157370_10182328 Ga0157370_101823282 285
453 3300013104 Ga0157370_10351156 Ga0157370_103511562 285
454 3300013104 Ga0157370_10537853 Ga0157370_105378532 285
455 3300013105 Ga0157369_10018091 Ga0157369_100180917 285
456 3300013296 Ga0157374_10007311 Ga0157374_100073116 285
457 3300013296 Ga0157374_10023239 Ga0157374_100232395 285
458 3300013297 Ga0157378_10163877 Ga0157378_101638773 285
459 3300013306 Ga0163162_10024117 Ga0163162_100241172 285
460 3300013306 Ga0163162_10038703 Ga0163162_100387035 285
461 3300013306 Ga0163162_10039322 Ga0163162_100393224 285
462 3300013307 Ga0157372_10000449 Ga0157372_1000044921 285
463 3300013307 Ga0157372_10093998 Ga0157372_100939983 285
464 3300013308 Ga0157375_10839582 Ga0157375_108395821 285
465 3300014745 Ga0157377_10083345 Ga0157377_100833452 285
466 3300014968 Ga0157379_10015571 Ga0157379_100155712 285
467 3300015261 Ga0182006_1009706 Ga0182006_10097065 285
468 3300017792 Ga0163161_10001712 Ga0163161_100017124 285
469 3300017792 Ga0163161_10096314 Ga0163161_100963142 285
470 3300025250 Ga0209026_1001164 Ga0209026_10011643 285
471 3300025907 Ga0207645_10027321 Ga0207645_100273212 285
472 3300025909 Ga0207705_10000494 Ga0207705_100004946 285
473 3300025912 Ga0207707_10185507 Ga0207707_101855072 285
474 3300025913 Ga0207695_10064702 Ga0207695_100647022 285
475 3300025921 Ga0207652_10000043 Ga0207652_100000437 285
476 3300025932 Ga0207690_10003665 Ga0207690_100036657 285
477 3300025932 Ga0207690_10316368 Ga0207690_103163682 285
478 3300025940 Ga0207691_10260600 Ga0207691_102606002 285
479 3300025942 Ga0207689_10004134 Ga0207689_1000413412 285
480 3300025944 Ga0207661_10005273 Ga0207661_100052738 285
481 3300025944 Ga0207661_10206807 Ga0207661_102068072 285
482 3300025945 Ga0207679_10019908 Ga0207679_100199083 285
483 3300025949 Ga0207667_10139458 Ga0207667_101394583 285
484 3300025949 Ga0207667_10235988 Ga0207667_102359882 285
485 3300025960 Ga0207651_10048170 Ga0207651_100481702 285
486 3300025981 Ga0207640_10251369 Ga0207640_102513691 285
487 3300025986 Ga0207658_10067215 Ga0207658_100672152 285
488 3300026023 Ga0207677_10131974 Ga0207677_101319742 285
489 3300026041 Ga0207639_10006556 Ga0207639_100065566 285
490 3300026078 Ga0207702_10070362 Ga0207702_100703622 285
491 3300026116 Ga0207674_10001817 Ga0207674_100018175 285
492 3300026142 Ga0207698_10073993 Ga0207698_100739932 285
493 3300026142 Ga0207698_10076461 Ga0207698_100764612 285
494 3300028380 Ga0268265_10116274 Ga0268265_101162742 285
495 3300028381 Ga0268264_10039743 Ga0268264_100397434 285
496 3300031616 Ga0307508_10000439 Ga0307508_1000043920 285
497 3300031616 Ga0307508_10051566 Ga0307508_100515663 285
498 3300031731 Ga0307405_10199491 Ga0307405_101994912 285
499 3300031911 Ga0307412_10000001 Ga0307412_10000001222 285
500 3300032002 Ga0307416_100057440 Ga0307416_1000574403 285
501 3300032004 Ga0307414_10000947 Ga0307414_100009472 285
502 3300037418 Ga0395900_0373455 Ga0395900_0373455_408_1265 285
503 3300037466 Ga0395898_0209418 Ga0395898_0209418_310_1170 285
504 3300041997 Ga0439431_0034372 Ga0439431_0034372_370_1230 285
505 3300042133 Ga0450896_003380 Ga0450896_003380_656_1516 285
506 3300044658 Ga0466972_0000004 Ga0466972_0000004_59280_60137 285
507 3300044683 Ga0466965_0107621 Ga0466965_0107621_86_943 285
508 3300044765 Ga0466970_0000038 Ga0466970_0000038_11411_12268 285
509 3300046511 Ga0495608_0076625 Ga0495608_0076625_416_1285 285
510 3300046517 Ga0495630_0045235 Ga0495630_0045235_1072_1941 285
511 3300046616 Ga0495668_0000918 Ga0495668_0000918_9298_10155 285
512 3300047321 Ga0495676_0125571 Ga0495676_0125571_740_1609 285
513 3300048913 Ga0496110_0212204 Ga0496110_0212204_274_1143 285
514 3300049744 Ga0501083_0239525 Ga0501083_0239525_231_1088 285
515 3300049766 Ga0501269_001120 Ga0501269_001120_691_1548 285
516 3300053092 Ga0500583_0045760 Ga0500583_0045760_1116_1973 285
517 3300053093 Ga0500651_0000357 Ga0500651_0000357_10211_11068 285
518 3300053147 Ga0500589_091128 Ga0500589_091128_286_1143 285
519 3300053153 Ga0500616_0000853 Ga0500616_0000853_19893_20750 285
520 3300053158 Ga0500627_0007087 Ga0500627_0007087_1690_2547 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

91

297

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gst-assembly2.cif.gz_D crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (pyruvate bound-form) 0.9581 1 283
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.9356 74 283
1nr9-assembly2.cif.gz_C crystal structure of escherichia coli 1262 (apc5008), putative isomerase 0.9218 72 279
8sut-assembly1.cif.gz_B crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid 0.9208 1 280
3s52-assembly1.cif.gz_D crystal structure of a putative fumarylacetoacetate hydrolase family protein from yersinia pestis co92 0.9207 69 279
ID Description Score Start End Superfamily
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9811 72 281 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9693 74 280 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9667 49 279 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9535 72 281 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9508 70 280 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A0P0CI04-F1-model_v4 Ureidoglycolate lyase 0.9943 1 285 GO:0016829
GO:0044281
AF-A0A2W5EY73-F1-model_v4 Ureidoglycolate lyase 0.9923 1 283 GO:0016829
GO:0044281
AF-A0A1N6KGN7-F1-model_v4 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) 0.9917 1 284 GO:0003824
GO:0044281
AF-A0A7V1SP07-F1-model_v4 FAA hydrolase family protein 0.9912 78 284 GO:0016787
GO:0044281
AF-A0A1V9EYH6-F1-model_v4 Ureidoglycolate lyase 0.99 1 283 GO:0016829
GO:0044281

Feature Viewer

pLDDT pTM Quality
93.93 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map