F458360

General Info

Members Datasets Scaffolds Average Seq Length
519 195 519 74

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_101669448|Ga0070682_1016694481
Length 80
Sequence VNFHLTPGRMAELAVAVVLLAAGIYFYRRPKGADSKADSYGSQGAVILFVIAVIMAVHALGGLDYHPSAAEAEFLQAHSR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 3.08
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1014758 3300001915 Bacteria 1300
2 JGI24747J21853_1042229 3300001978 Bacteria 543
3 JGI24740J21852_10145565 3300001979 Bacteria 589
4 JGI24739J22299_10067896 3300001989 Bacteria 1113
5 JGI24739J22299_10179874 3300001989 Bacteria 622
6 JGI24737J22298_10008400 3300001990 Bacteria 3458
7 JGI24737J22298_10046299 3300001990 Bacteria 1327
8 JGI24743J22301_10101983 3300001991 Bacteria 619
9 JGI24735J21928_10003989 3300002067 Bacteria 4994
10 JGI24735J21928_10107510 3300002067 Bacteria 802
11 JGI24744J21845_10006036 3300002077 Bacteria 2512
12 JGI24742J22300_10055115 3300002244 Bacteria 725
13 JGI24742J22300_10112284 3300002244 Bacteria 533
14 Ga0070658_10213241 3300005327 Bacteria 1631
15 Ga0070658_10214329 3300005327 Bacteria 1627
16 Ga0070658_10219551 3300005327 Bacteria 1607
17 Ga0070658_10418946 3300005327 Bacteria 1151
18 Ga0070658_11546352 3300005327 Unclassified 575
19 Ga0070658_11844246 3300005327 Bacteria 523
20 Ga0070676_10609062 3300005328 Bacteria 788
21 Ga0070676_10901072 3300005328 Bacteria 659
22 Ga0070676_11186650 3300005328 Bacteria 580
23 Ga0070676_11392740 3300005328 Bacteria 538
24 Ga0070683_100254949 3300005329 Bacteria 1669
25 Ga0070690_100137036 3300005330 Bacteria 1658
26 Ga0070670_100284392 3300005331 Bacteria 1444
27 Ga0070670_100365249 3300005331 Bacteria 1270
28 Ga0070677_10018714 3300005333 Bacteria 2499
29 Ga0070677_10165551 3300005333 Bacteria 1041
30 Ga0068869_100457768 3300005334 Bacteria 1058
31 Ga0068869_100869678 3300005334 Bacteria 778
32 Ga0070666_10001765 3300005335 Bacteria 13184
33 Ga0070666_10070178 3300005335 Bacteria 2383
34 Ga0070666_10245496 3300005335 Bacteria 1267
35 Ga0070666_10274863 3300005335 Bacteria 1196
36 Ga0070680_100022602 3300005336 Bacteria 5011
37 Ga0070680_100026318 3300005336 Bacteria 4652
38 Ga0070680_100060137 3300005336 Bacteria 3109
39 Ga0070680_100521248 3300005336 Bacteria 1017
40 Ga0070680_100793955 3300005336 Bacteria 816
41 Ga0070682_101669448 3300005337 Bacteria 553
42 Ga0068868_100158424 3300005338 Bacteria 1868
43 Ga0068868_100217194 3300005338 Bacteria 1599
44 Ga0068868_100278359 3300005338 Bacteria 1415
45 Ga0068868_100415641 3300005338 Bacteria 1163
46 Ga0070660_100060432 3300005339 Bacteria 2941
47 Ga0070660_100115642 3300005339 Bacteria 2138
48 Ga0070660_100212845 3300005339 Bacteria 1569
49 Ga0070660_100274511 3300005339 Bacteria 1378
50 Ga0070660_100357945 3300005339 Bacteria 1202
51 Ga0070660_100402861 3300005339 Bacteria 1131
52 Ga0070660_100724183 3300005339 Bacteria 835
53 Ga0070660_100743314 3300005339 Bacteria 823
54 Ga0070660_100779479 3300005339 Bacteria 804
55 Ga0070689_100133926 3300005340 Bacteria 1989
56 Ga0070689_100986615 3300005340 Bacteria 749
57 Ga0070691_10976385 3300005341 Bacteria 527
58 Ga0070687_100414574 3300005343 Bacteria 887
59 Ga0070661_100051603 3300005344 Bacteria 3010
60 Ga0070661_100083872 3300005344 Bacteria 2354
61 Ga0070661_100164318 3300005344 Bacteria 1683
62 Ga0070661_100250482 3300005344 Bacteria 1367
63 Ga0070661_100568719 3300005344 Bacteria 914
64 Ga0070661_100706630 3300005344 Bacteria 822
65 Ga0070661_100800058 3300005344 Bacteria 774
66 Ga0070692_10138312 3300005345 Bacteria 1376
67 Ga0070692_10282332 3300005345 Bacteria 1007
68 Ga0070668_100257062 3300005347 Bacteria 1451
69 Ga0070669_100073091 3300005353 Bacteria 2540
70 Ga0070675_100198709 3300005354 Bacteria 1740
71 Ga0070671_100108630 3300005355 Bacteria 2329
72 Ga0070671_100292433 3300005355 Bacteria 1386
73 Ga0070671_100976535 3300005355 Bacteria 741
74 Ga0070674_100036971 3300005356 Bacteria 3281
75 Ga0070674_100048009 3300005356 Bacteria 2928
76 Ga0070674_101374783 3300005356 Bacteria 631
77 Ga0070673_100200418 3300005364 Bacteria 1719
78 Ga0070673_100227651 3300005364 Bacteria 1616
79 Ga0070673_100246106 3300005364 Bacteria 1556
80 Ga0070673_100297756 3300005364 Bacteria 1419
81 Ga0070673_100342162 3300005364 Bacteria 1326
82 Ga0070688_100873154 3300005365 Bacteria 708
83 Ga0070659_100034769 3300005366 Bacteria 3921
84 Ga0070659_100151756 3300005366 Bacteria 1890
85 Ga0070659_100172090 3300005366 Bacteria 1774
86 Ga0070659_100795688 3300005366 Bacteria 822
87 Ga0070659_100828659 3300005366 Bacteria 806
88 Ga0070659_101090489 3300005366 Bacteria 703
89 Ga0070659_101159301 3300005366 Bacteria 682
90 Ga0070659_101628891 3300005366 Bacteria 576
91 Ga0070667_100177882 3300005367 Bacteria 1880
92 Ga0070667_100758708 3300005367 Bacteria 899
93 Ga0070667_100853494 3300005367 Bacteria 846
94 Ga0070667_102060350 3300005367 Bacteria 537
95 Ga0070667_102349101 3300005367 Bacteria 502
96 Ga0070709_10114050 3300005434 Bacteria 1821
97 Ga0070714_100114362 3300005435 Bacteria 2394
98 Ga0070713_100456693 3300005436 Bacteria 1201
99 Ga0070713_100786869 3300005436 Bacteria 911
100 Ga0070701_10336122 3300005438 Unclassified 939
101 Ga0070663_100056417 3300005455 Bacteria 2814
102 Ga0070663_100119340 3300005455 Bacteria 1990
103 Ga0070663_100242003 3300005455 Bacteria 1424
104 Ga0070663_100358891 3300005455 Bacteria 1182
105 Ga0070663_101457143 3300005455 Bacteria 608
106 Ga0070678_100193525 3300005456 Bacteria 1673
107 Ga0070678_100573251 3300005456 Bacteria 1004
108 Ga0070678_101145012 3300005456 Bacteria 720
109 Ga0070662_100198499 3300005457 Bacteria 1591
110 Ga0070662_100246175 3300005457 Bacteria 1435
111 Ga0070662_100270219 3300005457 Bacteria 1372
112 Ga0070662_100289988 3300005457 Bacteria 1327
113 Ga0070662_100309951 3300005457 Bacteria 1285
114 Ga0070662_100412903 3300005457 Bacteria 1115
115 Ga0070662_100527341 3300005457 Bacteria 987
116 Ga0070681_10044638 3300005458 Bacteria 4437
117 Ga0070681_10150966 3300005458 Bacteria 2249
118 Ga0070681_10201391 3300005458 Bacteria 1909
119 Ga0070681_10404447 3300005458 Bacteria 1277
120 Ga0070681_11850961 3300005458 Bacteria 531
121 Ga0068867_100157218 3300005459 Bacteria 1790
122 Ga0068867_102086335 3300005459 Bacteria 537
123 Ga0070679_100004379 3300005530 Bacteria 13048
124 Ga0070679_100158170 3300005530 Bacteria 2240
125 Ga0070679_100167485 3300005530 Bacteria 2170
126 Ga0070679_100274711 3300005530 Bacteria 1638
127 Ga0070684_100691480 3300005535 Bacteria 951
128 Ga0068853_100812904 3300005539 Bacteria 895
129 Ga0068853_101174254 3300005539 Bacteria 741
130 Ga0068853_102065440 3300005539 Bacteria 553
131 Ga0070672_100388650 3300005543 Bacteria 1194
132 Ga0070672_101105300 3300005543 Bacteria 704
133 Ga0070672_101807170 3300005543 Bacteria 549
134 Ga0070686_100098729 3300005544 Bacteria 1968
135 Ga0070686_100350769 3300005544 Bacteria 1109
136 Ga0070693_100056882 3300005547 Bacteria 2259
137 Ga0070665_100577645 3300005548 Bacteria 1137
138 Ga0070665_100825759 3300005548 Unclassified 940
139 Ga0068855_100003874 3300005563 Bacteria 18286
140 Ga0068855_100286240 3300005563 Bacteria 1828
141 Ga0068855_100951823 3300005563 Bacteria 904
142 Ga0068855_101318361 3300005563 Bacteria 747
143 Ga0068855_101506752 3300005563 Bacteria 690
144 Ga0070664_100038195 3300005564 Bacteria 4041
145 Ga0070664_100851758 3300005564 Bacteria 854
146 Ga0070664_101152257 3300005564 Bacteria 731
147 Ga0070664_101304797 3300005564 Bacteria 685
148 Ga0068857_101275640 3300005577 Bacteria 712
149 Ga0068857_101673910 3300005577 Bacteria 622
150 Ga0068854_100054269 3300005578 Bacteria 2881
151 Ga0068854_100678147 3300005578 Bacteria 887
152 Ga0068854_100815200 3300005578 Bacteria 814
153 Ga0068856_100279365 3300005614 Bacteria 1686
154 Ga0068856_101190063 3300005614 Bacteria 779
155 Ga0068856_101497100 3300005614 Bacteria 689
156 Ga0068856_101846949 3300005614 Bacteria 616
157 Ga0068856_102548756 3300005614 Unclassified 518
158 Ga0068852_100053777 3300005616 Bacteria 3467
159 Ga0068852_100124884 3300005616 Bacteria 2361
160 Ga0068852_100161813 3300005616 Bacteria 2090
161 Ga0068852_100190180 3300005616 Bacteria 1936
162 Ga0068852_100269136 3300005616 Bacteria 1639
163 Ga0068852_101601845 3300005616 Bacteria 674
164 Ga0068859_100430546 3300005617 Bacteria 1416
165 Ga0068864_100175815 3300005618 Bacteria 1954
166 Ga0068864_100431297 3300005618 Bacteria 1257
167 Ga0068864_101123778 3300005618 Bacteria 782
168 Ga0068864_101674188 3300005618 Bacteria 641
169 Ga0068866_10195919 3300005718 Bacteria 1204
170 Ga0068866_10338035 3300005718 Bacteria 953
171 Ga0068851_10087883 3300005834 Bacteria 1633
172 Ga0068851_10266510 3300005834 Bacteria 976
173 Ga0068851_10306253 3300005834 Bacteria 915
174 Ga0068851_10739842 3300005834 Bacteria 608
175 Ga0068870_10176533 3300005840 Unclassified 1279
176 Ga0068863_100073857 3300005841 Bacteria 3226
177 Ga0068863_100989169 3300005841 Bacteria 844
178 Ga0068858_100763326 3300005842 Bacteria 942
179 Ga0068858_102505285 3300005842 Bacteria 510
180 Ga0068860_102730964 3300005843 Bacteria 512
181 Ga0068862_101479473 3300005844 Bacteria 684
182 Ga0070716_100882302 3300006173 Bacteria 699
183 Ga0075366_10235968 3300006195 Bacteria 1115
184 Ga0097621_100454353 3300006237 Unclassified 1154
185 Ga0097621_100818591 3300006237 Bacteria 864
186 Ga0068871_100085729 3300006358 Bacteria 2616
187 Ga0068865_101062188 3300006881 Bacteria 712
188 Ga0068865_101103968 3300006881 Bacteria 699
189 Ga0097620_100430549 3300006931 Bacteria 1416
190 Ga0105244_10114513 3300009036 Bacteria 1310
191 Ga0105240_10668935 3300009093 Bacteria 1136
192 Ga0105245_10436611 3300009098 Bacteria 1315
193 Ga0105245_10824041 3300009098 Bacteria 967
194 Ga0105245_11162983 3300009098 Bacteria 819
195 Ga0105247_10779459 3300009101 Bacteria 727
196 Ga0105243_10769932 3300009148 Bacteria 945
197 Ga0105243_10805634 3300009148 Bacteria 926
198 Ga0105241_11340149 3300009174 Bacteria 683
199 Ga0105241_12297709 3300009174 Bacteria 537
200 Ga0105242_10275040 3300009176 Bacteria 1527
201 Ga0105248_10070097 3300009177 Bacteria 3937
202 Ga0105248_10640421 3300009177 Bacteria 1199
203 Ga0105238_10804623 3300009551 Bacteria 956
204 Ga0105238_12190544 3300009551 Bacteria 587
205 Ga0105239_11745112 3300010375 Bacteria 721
206 Ga0105246_10298388 3300011119 Bacteria 1300
207 Ga0105246_10387988 3300011119 Bacteria 1156
208 Ga0105246_10666673 3300011119 Bacteria 907
209 Ga0157373_10042771 3300013100 Bacteria 3237
210 Ga0157373_10437773 3300013100 Bacteria 940
211 Ga0157373_10470252 3300013100 Bacteria 906
212 Ga0157373_10815334 3300013100 Bacteria 689
213 Ga0157373_10830918 3300013100 Bacteria 682
214 Ga0157373_11122695 3300013100 Bacteria 590
215 Ga0157373_11316662 3300013100 Bacteria 547
216 Ga0157373_11333135 3300013100 Bacteria 544
217 Ga0157371_10114933 3300013102 Bacteria 1911
218 Ga0157371_10412699 3300013102 Bacteria 989
219 Ga0157371_10476861 3300013102 Bacteria 919
220 Ga0157371_10825121 3300013102 Bacteria 700
221 Ga0157371_11195397 3300013102 Unclassified 586
222 Ga0157370_10056869 3300013104 Bacteria 3722
223 Ga0157370_10147137 3300013104 Bacteria 2193
224 Ga0157370_10506793 3300013104 Bacteria 1108
225 Ga0157370_11443316 3300013104 Bacteria 619
226 Ga0157370_11605134 3300013104 Bacteria 584
227 Ga0157369_10004426 3300013105 Bacteria 16589
228 Ga0157369_10053763 3300013105 Bacteria 4350
229 Ga0157369_10371554 3300013105 Bacteria 1484
230 Ga0157369_10433359 3300013105 Bacteria 1362
231 Ga0157369_10893456 3300013105 Bacteria 911
232 Ga0157369_10910847 3300013105 Bacteria 902
233 Ga0157369_11428279 3300013105 Bacteria 704
234 Ga0157374_11660500 3300013296 Bacteria 663
235 Ga0157374_12130963 3300013296 Bacteria 587
236 Ga0157378_10076007 3300013297 Bacteria 3025
237 Ga0157378_10386608 3300013297 Bacteria 1375
238 Ga0157378_10810426 3300013297 Bacteria 962
239 Ga0157378_10865761 3300013297 Bacteria 933
240 Ga0163162_10643264 3300013306 Bacteria 1184
241 Ga0163162_11157476 3300013306 Bacteria 877
242 Ga0157372_10423348 3300013307 Bacteria 1552
243 Ga0157372_11150679 3300013307 Bacteria 897
244 Ga0157372_13070245 3300013307 Bacteria 533
245 Ga0157375_10140902 3300013308 Bacteria 2538
246 Ga0157375_11043482 3300013308 Bacteria 955
247 Ga0157375_11327234 3300013308 Bacteria 846
248 Ga0163163_12055098 3300014325 Unclassified 631
249 Ga0157380_10606811 3300014326 Bacteria 1084
250 Ga0182008_10256069 3300014497 Bacteria 904
251 Ga0157377_10126746 3300014745 Bacteria 1554
252 Ga0157377_10528183 3300014745 Bacteria 830
253 Ga0157379_10043228 3300014968 Bacteria 4022
254 Ga0157379_10285860 3300014968 Bacteria 1501
255 Ga0157376_10094088 3300014969 Bacteria 2603
256 Ga0157376_11652450 3300014969 Bacteria 675
257 Ga0163161_11925009 3300017792 Bacteria 526
258 Ga0197907_10752360 3300020069 Bacteria 732
259 Ga0206354_10185819 3300020081 Bacteria 833
260 Ga0206354_11280003 3300020081 Bacteria 2170
261 Ga0206353_10715817 3300020082 Bacteria 1852
262 Ga0206353_11124307 3300020082 Bacteria 711
263 Ga0207697_10058881 3300025315 Bacteria 1596
264 Ga0207656_10024781 3300025321 Bacteria 2430
265 Ga0207656_10248355 3300025321 Bacteria 871
266 Ga0207682_10040991 3300025893 Bacteria 1889
267 Ga0207642_10309688 3300025899 Bacteria 918
268 Ga0207642_10584671 3300025899 Bacteria 693
269 Ga0207688_10006153 3300025901 Bacteria 6532
270 Ga0207688_10161945 3300025901 Bacteria 1327
271 Ga0207688_10311494 3300025901 Bacteria 964
272 Ga0207680_10280633 3300025903 Bacteria 1157
273 Ga0207680_10353097 3300025903 Bacteria 1033
274 Ga0207647_10032036 3300025904 Bacteria 3381
275 Ga0207647_10036070 3300025904 Bacteria 3145
276 Ga0207647_10097512 3300025904 Bacteria 1748
277 Ga0207647_10158335 3300025904 Bacteria 1321
278 Ga0207647_10302507 3300025904 Bacteria 911
279 Ga0207699_10308318 3300025906 Bacteria 1107
280 Ga0207645_10065073 3300025907 Bacteria 2330
281 Ga0207645_10113776 3300025907 Bacteria 1753
282 Ga0207643_10740411 3300025908 Unclassified 636
283 Ga0207705_10005962 3300025909 Bacteria 9066
284 Ga0207705_10044477 3300025909 Bacteria 3191
285 Ga0207705_10074383 3300025909 Bacteria 2466
286 Ga0207705_10144077 3300025909 Bacteria 1781
287 Ga0207705_10362939 3300025909 Bacteria 1117
288 Ga0207705_10446824 3300025909 Bacteria 1002
289 Ga0207654_10464564 3300025911 Bacteria 889
290 Ga0207654_10920947 3300025911 Bacteria 634
291 Ga0207707_10678951 3300025912 Bacteria 866
292 Ga0207707_10936611 3300025912 Bacteria 714
293 Ga0207663_10806431 3300025916 Bacteria 748
294 Ga0207660_10017181 3300025917 Bacteria 4801
295 Ga0207660_10209093 3300025917 Bacteria 1527
296 Ga0207660_10227896 3300025917 Bacteria 1464
297 Ga0207660_10432753 3300025917 Bacteria 1062
298 Ga0207660_10765374 3300025917 Bacteria 788
299 Ga0207662_10057451 3300025918 Bacteria 2325
300 Ga0207657_10030143 3300025919 Bacteria 4929
301 Ga0207657_10056130 3300025919 Bacteria 3399
302 Ga0207657_10070461 3300025919 Bacteria 2963
303 Ga0207657_10080639 3300025919 Bacteria 2735
304 Ga0207657_10084451 3300025919 Bacteria 2661
305 Ga0207657_10129173 3300025919 Bacteria 2073
306 Ga0207657_10166152 3300025919 Bacteria 1790
307 Ga0207657_10189180 3300025919 Bacteria 1662
308 Ga0207657_10485810 3300025919 Bacteria 968
309 Ga0207649_10136090 3300025920 Bacteria 1675
310 Ga0207649_10147314 3300025920 Bacteria 1617
311 Ga0207649_10443153 3300025920 Bacteria 979
312 Ga0207649_10544405 3300025920 Bacteria 887
313 Ga0207649_10676438 3300025920 Bacteria 799
314 Ga0207649_10786191 3300025920 Bacteria 742
315 Ga0207652_10007793 3300025921 Bacteria 8602
316 Ga0207652_10230755 3300025921 Bacteria 1668
317 Ga0207652_10239302 3300025921 Bacteria 1636
318 Ga0207652_10289741 3300025921 Bacteria 1477
319 Ga0207652_10289983 3300025921 Bacteria 1476
320 Ga0207681_10075511 3300025923 Bacteria 2364
321 Ga0207681_11134762 3300025923 Bacteria 657
322 Ga0207681_11580800 3300025923 Bacteria 549
323 Ga0207650_10014542 3300025925 Bacteria 5468
324 Ga0207650_10228920 3300025925 Bacteria 1499
325 Ga0207650_10853850 3300025925 Bacteria 772
326 Ga0207659_10444066 3300025926 Bacteria 1091
327 Ga0207687_10273671 3300025927 Bacteria 1351
328 Ga0207687_10981314 3300025927 Bacteria 724
329 Ga0207700_11291601 3300025928 Bacteria 650
330 Ga0207664_10404080 3300025929 Bacteria 1215
331 Ga0207664_10441800 3300025929 Bacteria 1160
332 Ga0207664_11697542 3300025929 Bacteria 554
333 Ga0207644_10000495 3300025931 Bacteria 25321
334 Ga0207644_10029529 3300025931 Bacteria 3804
335 Ga0207644_10081779 3300025931 Bacteria 2388
336 Ga0207644_10121775 3300025931 Bacteria 1986
337 Ga0207644_10460682 3300025931 Bacteria 1045
338 Ga0207690_10007235 3300025932 Bacteria 6590
339 Ga0207690_10391648 3300025932 Bacteria 1106
340 Ga0207690_10454381 3300025932 Bacteria 1030
341 Ga0207690_10689377 3300025932 Bacteria 839
342 Ga0207690_10801813 3300025932 Bacteria 778
343 Ga0207690_10839836 3300025932 Bacteria 760
344 Ga0207690_11137231 3300025932 Bacteria 651
345 Ga0207690_11567995 3300025932 Unclassified 550
346 Ga0207706_10050508 3300025933 Bacteria 3675
347 Ga0207706_10173882 3300025933 Bacteria 1892
348 Ga0207706_10234190 3300025933 Bacteria 1606
349 Ga0207706_10394458 3300025933 Bacteria 1200
350 Ga0207706_10489403 3300025933 Bacteria 1062
351 Ga0207706_10696938 3300025933 Bacteria 868
352 Ga0207706_10794102 3300025933 Bacteria 804
353 Ga0207686_10912482 3300025934 Bacteria 709
354 Ga0207670_10121590 3300025936 Bacteria 1899
355 Ga0207669_10155831 3300025937 Bacteria 1606
356 Ga0207669_11035764 3300025937 Bacteria 691
357 Ga0207704_10173417 3300025938 Bacteria 1550
358 Ga0207704_11232572 3300025938 Bacteria 638
359 Ga0207665_10023178 3300025939 Bacteria 4089
360 Ga0207691_10103917 3300025940 Bacteria 2533
361 Ga0207691_10203321 3300025940 Bacteria 1723
362 Ga0207691_10320813 3300025940 Bacteria 1328
363 Ga0207711_10224695 3300025941 Bacteria 1718
364 Ga0207711_10316833 3300025941 Bacteria 1441
365 Ga0207689_10013991 3300025942 Bacteria 6832
366 Ga0207689_10864989 3300025942 Bacteria 763
367 Ga0207661_10155066 3300025944 Bacteria 1983
368 Ga0207661_11472995 3300025944 Bacteria 624
369 Ga0207679_10201341 3300025945 Bacteria 1663
370 Ga0207679_10527686 3300025945 Bacteria 1057
371 Ga0207679_10933318 3300025945 Bacteria 794
372 Ga0207679_11304380 3300025945 Bacteria 666
373 Ga0207679_11592871 3300025945 Bacteria 598
374 Ga0207667_10110153 3300025949 Bacteria 2840
375 Ga0207667_10298387 3300025949 Bacteria 1646
376 Ga0207667_10626357 3300025949 Bacteria 1083
377 Ga0207667_11492574 3300025949 Bacteria 647
378 Ga0207651_10034317 3300025960 Bacteria 3284
379 Ga0207651_10049300 3300025960 Bacteria 2852
380 Ga0207712_11732228 3300025961 Bacteria 560
381 Ga0207668_10416329 3300025972 Bacteria 1140
382 Ga0207640_10029379 3300025981 Bacteria 3374
383 Ga0207640_10195158 3300025981 Bacteria 1529
384 Ga0207640_10744886 3300025981 Bacteria 844
385 Ga0207640_10765567 3300025981 Bacteria 834
386 Ga0207640_11163014 3300025981 Bacteria 685
387 Ga0207640_11218303 3300025981 Bacteria 670
388 Ga0207640_11241813 3300025981 Bacteria 664
389 Ga0207658_10148362 3300025986 Bacteria 1907
390 Ga0207658_11325467 3300025986 Bacteria 658
391 Ga0207658_11488640 3300025986 Bacteria 619
392 Ga0207658_12058832 3300025986 Bacteria 519
393 Ga0207677_10186605 3300026023 Bacteria 1636
394 Ga0207677_10566701 3300026023 Bacteria 992
395 Ga0207677_10642998 3300026023 Bacteria 935
396 Ga0207703_10267940 3300026035 Bacteria 1546
397 Ga0207703_10433466 3300026035 Bacteria 1225
398 Ga0207703_10859546 3300026035 Bacteria 868
399 Ga0207639_10574985 3300026041 Bacteria 1037
400 Ga0207639_10606889 3300026041 Bacteria 1010
401 Ga0207639_11659566 3300026041 Bacteria 599
402 Ga0207639_11845242 3300026041 Bacteria 565
403 Ga0207678_10001078 3300026067 Bacteria 24989
404 Ga0207678_10205670 3300026067 Bacteria 1684
405 Ga0207678_10223938 3300026067 Bacteria 1610
406 Ga0207678_10260578 3300026067 Bacteria 1486
407 Ga0207678_10672427 3300026067 Bacteria 910
408 Ga0207702_10031077 3300026078 Bacteria 4451
409 Ga0207702_10115857 3300026078 Bacteria 2390
410 Ga0207702_10519725 3300026078 Bacteria 1162
411 Ga0207702_10644418 3300026078 Bacteria 1042
412 Ga0207702_12155312 3300026078 Bacteria 547
413 Ga0207641_10017108 3300026088 Bacteria 5932
414 Ga0207641_12195717 3300026088 Bacteria 552
415 Ga0207648_11469608 3300026089 Bacteria 641
416 Ga0207648_12045643 3300026089 Bacteria 534
417 Ga0207676_10056857 3300026095 Bacteria 3078
418 Ga0207676_10405420 3300026095 Bacteria 1275
419 Ga0207676_11687955 3300026095 Bacteria 632
420 Ga0207674_10000491 3300026116 Bacteria 52076
421 Ga0207674_10146818 3300026116 Bacteria 2317
422 Ga0207674_10284501 3300026116 Bacteria 1602
423 Ga0207674_10383067 3300026116 Bacteria 1360
424 Ga0207674_11522805 3300026116 Bacteria 638
425 Ga0207675_100339780 3300026118 Bacteria 1469
426 Ga0207683_10215607 3300026121 Bacteria 1748
427 Ga0207683_10277843 3300026121 Bacteria 1530
428 Ga0207683_10449446 3300026121 Bacteria 1188
429 Ga0207683_10458216 3300026121 Bacteria 1176
430 Ga0207698_10097934 3300026142 Bacteria 2422
431 Ga0207698_10147155 3300026142 Bacteria 2039
432 Ga0207698_10277959 3300026142 Bacteria 1547
433 Ga0207698_10629331 3300026142 Bacteria 1061
434 Ga0207698_10815954 3300026142 Bacteria 936
435 Ga0207698_10888953 3300026142 Bacteria 897
436 Ga0268266_10874078 3300028379 Bacteria 869
437 Ga0268266_12033702 3300028379 Bacteria 548
438 Ga0307408_100740068 3300031548 Bacteria 887
439 Ga0307405_11371458 3300031731 Bacteria 617
440 Ga0307412_10166342 3300031911 Bacteria 1644
441 Ga0307409_102553568 3300031995 Bacteria 539
442 Ga0307416_100014414 3300032002 Bacteria 5418
443 Ga0307416_102997782 3300032002 Bacteria 565
444 Ga0307415_100021170 3300032126 Bacteria 3990
445 Ga0373923_0031492 3300035111 Bacteria 2138
446 Ga0373960_0417918 3300035121 Bacteria 520
447 Ga0373935_1089325 3300035692 Bacteria 594
448 Ga0395899_0000523 3300037312 Bacteria 42229
449 Ga0395899_0101921 3300037312 Bacteria 2071
450 Ga0395899_0135389 3300037312 Bacteria 1756
451 Ga0395899_0183755 3300037312 Bacteria 1466
452 Ga0395900_0000289 3300037418 Bacteria 75525
453 Ga0395900_0038605 3300037418 Bacteria 4922
454 Ga0395900_0079277 3300037418 Bacteria 3374
455 Ga0395900_0111116 3300037418 Bacteria 2815
456 Ga0395900_0168977 3300037418 Bacteria 2227
457 Ga0395900_0321931 3300037418 Bacteria 1526
458 Ga0395900_0762916 3300037418 Bacteria 897
459 Ga0395900_0917765 3300037418 Bacteria 798
460 Ga0395898_0047427 3300037466 Bacteria 4216
461 Ga0395898_0054285 3300037466 Bacteria 3910
462 Ga0395898_0234607 3300037466 Bacteria 1749
463 Ga0395898_0343465 3300037466 Bacteria 1423
464 Ga0395898_0688401 3300037466 Bacteria 964
465 Ga0395898_0692332 3300037466 Bacteria 961
466 Ga0395905_0021513 3300037471 Bacteria 6098
467 Ga0395905_0089482 3300037471 Bacteria 2885
468 Ga0395905_0130091 3300037471 Bacteria 2367
469 Ga0395905_0222724 3300037471 Bacteria 1765
470 Ga0395905_0263987 3300037471 Bacteria 1607
471 Ga0395905_0382346 3300037471 Bacteria 1301
472 Ga0395905_0751428 3300037471 Bacteria 877
473 Ga0395905_0779353 3300037471 Bacteria 859
474 Ga0395905_0848619 3300037471 Bacteria 816
475 Ga0395905_0999575 3300037471 Bacteria 739
476 Ga0395905_1217195 3300037471 Bacteria 657
477 Ga0395905_1855613 3300037471 Unclassified 509
478 Ga0395905_1890748 3300037471 Bacteria 503
479 Ga0395901_0000957 3300038443 Bacteria 31439
480 Ga0395901_0059071 3300038443 Bacteria 3989
481 Ga0395901_0235344 3300038443 Bacteria 1911
482 Ga0395901_0579887 3300038443 Bacteria 1133
483 Ga0395901_0747262 3300038443 Bacteria 971
484 Ga0395901_0970654 3300038443 Bacteria 827
485 Ga0395901_1404518 3300038443 Bacteria 656
486 Ga0466972_0223040 3300044658 Bacteria 882
487 Ga0466972_0276075 3300044658 Bacteria 785
488 Ga0466965_0835142 3300044683 Bacteria 535
489 Ga0466966_0034268 3300044684 Bacteria 3283
490 Ga0466971_0060241 3300044719 Bacteria 1716
491 Ga0466970_0173840 3300044765 Bacteria 1194
492 Ga0466957_0258296 3300044842 Bacteria 1160
493 Ga0466960_0015236 3300044901 Bacteria 3311
494 Ga0466960_0464764 3300044901 Bacteria 737
495 Ga0466959_0232852 3300045049 Bacteria 1274
496 Ga0466958_0135762 3300045836 Bacteria 1547
497 Ga0466967_0183195 3300045976 Bacteria 1976
498 Ga0466967_0207070 3300045976 Bacteria 1859
499 Ga0466967_0478298 3300045976 Bacteria 1220
500 Ga0466967_1000876 3300045976 Bacteria 832
501 Ga0466967_2187411 3300045976 Bacteria 549
502 Ga0495687_200676 3300047443 Unclassified 634
503 Ga0496100_0053554 3300048903 Bacteria 2628
504 Ga0496102_0355638 3300048905 Bacteria 1379
505 Ga0496102_0628848 3300048905 Bacteria 997
506 Ga0496103_0326629 3300048906 Bacteria 987
507 Ga0496104_0622829 3300048907 Bacteria 989
508 Ga0496105_0474491 3300048908 Bacteria 985
509 Ga0496106_0363273 3300048909 Bacteria 1163
510 Ga0496106_0639269 3300048909 Bacteria 851
511 Ga0496107_0178523 3300048910 Bacteria 1576
512 Ga0496107_0740215 3300048910 Bacteria 722
513 Ga0496112_0219014 3300048915 Bacteria 1860
514 Ga0496112_0312089 3300048915 Bacteria 1517
515 Ga0496112_0927237 3300048915 Bacteria 792
516 Ga0496112_1690807 3300048915 Bacteria 545
517 Ga0496113_0307167 3300048916 Bacteria 1270
518 Ga0496114_0399733 3300048917 Bacteria 1217
519 nmdc:mga0k408_595094_c1 3300050493 Bacteria 652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0263987 Ga0395905_0263987_689_907 63
2 3300005327 Ga0070658_10213241 Ga0070658_102132412 64
3 3300005331 Ga0070670_100365249 Ga0070670_1003652493 64
4 3300005339 Ga0070660_100357945 Ga0070660_1003579452 64
5 3300005344 Ga0070661_100568719 Ga0070661_1005687192 64
6 3300005367 Ga0070667_102349101 Ga0070667_1023491012 64
7 3300005455 Ga0070663_100358891 Ga0070663_1003588912 64
8 3300005457 Ga0070662_100289988 Ga0070662_1002899882 64
9 3300005564 Ga0070664_100851758 Ga0070664_1008517583 64
10 3300005834 Ga0068851_10266510 Ga0068851_102665103 64
11 3300013100 Ga0157373_10437773 Ga0157373_104377731 64
12 3300013105 Ga0157369_10893456 Ga0157369_108934562 64
13 3300025321 Ga0207656_10248355 Ga0207656_102483552 64
14 3300025909 Ga0207705_10074383 Ga0207705_100743832 64
15 3300025925 Ga0207650_10853850 Ga0207650_108538502 64
16 3300025933 Ga0207706_10394458 Ga0207706_103944583 64
17 3300025986 Ga0207658_12058832 Ga0207658_120588322 64
18 3300026041 Ga0207639_11659566 Ga0207639_116595662 64
19 3300026067 Ga0207678_10672427 Ga0207678_106724272 64
20 3300031995 Ga0307409_102553568 Ga0307409_1025535681 65
21 3300013100 Ga0157373_10815334 Ga0157373_108153341 66
22 3300020081 Ga0206354_10185819 Ga0206354_101858191 66
23 3300037418 Ga0395900_0000289 Ga0395900_0000289_73327_73560 66
24 3300037466 Ga0395898_0234607 Ga0395898_0234607_1171_1404 66
25 3300037471 Ga0395905_0021513 Ga0395905_0021513_204_437 66
26 3300037471 Ga0395905_0751428 Ga0395905_0751428_272_505 66
27 3300038443 Ga0395901_0000957 Ga0395901_0000957_20400_20633 66
28 3300038443 Ga0395901_1404518 Ga0395901_1404518_336_569 66
29 3300005327 Ga0070658_10219551 Ga0070658_102195514 67
30 3300005336 Ga0070680_100022602 Ga0070680_1000226025 67
31 3300005339 Ga0070660_100060432 Ga0070660_1000604324 67
32 3300005344 Ga0070661_100706630 Ga0070661_1007066302 67
33 3300005455 Ga0070663_100056417 Ga0070663_1000564173 67
34 3300005530 Ga0070679_100004379 Ga0070679_1000043794 67
35 3300005563 Ga0068855_100003874 Ga0068855_1000038744 67
36 3300009551 Ga0105238_12190544 Ga0105238_121905442 67
37 3300013104 Ga0157370_10506793 Ga0157370_105067933 67
38 3300013105 Ga0157369_10433359 Ga0157369_104333592 67
39 3300013297 Ga0157378_10386608 Ga0157378_103866082 67
40 3300020082 Ga0206353_11124307 Ga0206353_111243072 67
41 3300025904 Ga0207647_10158335 Ga0207647_101583353 67
42 3300025909 Ga0207705_10044477 Ga0207705_100444774 67
43 3300025917 Ga0207660_10765374 Ga0207660_107653742 67
44 3300025919 Ga0207657_10070461 Ga0207657_100704613 67
45 3300025920 Ga0207649_10676438 Ga0207649_106764383 67
46 3300025921 Ga0207652_10007793 Ga0207652_100077933 67
47 3300025949 Ga0207667_10110153 Ga0207667_101101532 67
48 3300025981 Ga0207640_11163014 Ga0207640_111630142 67
49 3300026041 Ga0207639_10574985 Ga0207639_105749852 67
50 3300026067 Ga0207678_10001078 Ga0207678_1000107826 67
51 3300026078 Ga0207702_10115857 Ga0207702_101158573 67
52 3300037312 Ga0395899_0000523 Ga0395899_0000523_31295_31528 67
53 3300037312 Ga0395899_0135389 Ga0395899_0135389_1442_1675 67
54 3300037418 Ga0395900_0038605 Ga0395900_0038605_123_356 67
55 3300037466 Ga0395898_0054285 Ga0395898_0054285_3411_3644 67
56 3300037471 Ga0395905_0779353 Ga0395905_0779353_135_338 67
57 3300037471 Ga0395905_0999575 Ga0395905_0999575_204_437 67
58 3300038443 Ga0395901_0059071 Ga0395901_0059071_346_579 67
59 3300045976 Ga0466967_0183195 Ga0466967_0183195_988_1206 67
60 3300005327 Ga0070658_11546352 Ga0070658_115463522 68
61 3300005548 Ga0070665_100825759 Ga0070665_1008257592 68
62 3300028379 Ga0268266_10874078 Ga0268266_108740782 68
63 3300005336 Ga0070680_100026318 Ga0070680_1000263185 69
64 3300005341 Ga0070691_10976385 Ga0070691_109763851 69
65 3300005344 Ga0070661_100051603 Ga0070661_1000516034 69
66 3300005366 Ga0070659_101159301 Ga0070659_1011593012 69
67 3300005458 Ga0070681_10404447 Ga0070681_104044472 69
68 3300005530 Ga0070679_100158170 Ga0070679_1001581702 69
69 3300005564 Ga0070664_101152257 Ga0070664_1011522572 69
70 3300005577 Ga0068857_101673910 Ga0068857_1016739102 69
71 3300013105 Ga0157369_11428279 Ga0157369_114282792 69
72 3300025909 Ga0207705_10446824 Ga0207705_104468242 69
73 3300025912 Ga0207707_10678951 Ga0207707_106789512 69
74 3300025917 Ga0207660_10227896 Ga0207660_102278962 69
75 3300025919 Ga0207657_10056130 Ga0207657_100561304 69
76 3300025920 Ga0207649_10786191 Ga0207649_107861912 69
77 3300025921 Ga0207652_10230755 Ga0207652_102307552 69
78 3300025932 Ga0207690_10801813 Ga0207690_108018131 69
79 3300025945 Ga0207679_11592871 Ga0207679_115928712 69
80 3300026116 Ga0207674_11522805 Ga0207674_115228052 69
81 3300048915 Ga0496112_0927237 Ga0496112_0927237_240_449 69
82 3300005435 Ga0070714_100114362 Ga0070714_1001143622 71
83 3300005436 Ga0070713_100456693 Ga0070713_1004566933 71
84 3300044842 Ga0466957_0258296 Ga0466957_0258296_689_910 71
85 3300001990 JGI24737J22298_10008400 JGI24737J22298_100084005 72
86 3300001990 JGI24737J22298_10046299 JGI24737J22298_100462995 72
87 3300002067 JGI24735J21928_10107510 JGI24735J21928_101075103 72
88 3300005328 Ga0070676_10901072 Ga0070676_109010721 72
89 3300005333 Ga0070677_10018714 Ga0070677_100187143 72
90 3300005335 Ga0070666_10070178 Ga0070666_100701783 72
91 3300005336 Ga0070680_100060137 Ga0070680_1000601375 72
92 3300005339 Ga0070660_100212845 Ga0070660_1002128453 72
93 3300005339 Ga0070660_100274511 Ga0070660_1002745114 72
94 3300005339 Ga0070660_100779479 Ga0070660_1007794793 72
95 3300005345 Ga0070692_10138312 Ga0070692_101383123 72
96 3300005353 Ga0070669_100073091 Ga0070669_1000730913 72
97 3300005355 Ga0070671_100108630 Ga0070671_1001086304 72
98 3300005356 Ga0070674_100048009 Ga0070674_1000480093 72
99 3300005364 Ga0070673_100342162 Ga0070673_1003421623 72
100 3300005366 Ga0070659_100151756 Ga0070659_1001517563 72
101 3300005456 Ga0070678_100193525 Ga0070678_1001935253 72
102 3300005457 Ga0070662_100198499 Ga0070662_1001984993 72
103 3300005457 Ga0070662_100246175 Ga0070662_1002461753 72
104 3300005457 Ga0070662_100527341 Ga0070662_1005273412 72
105 3300005458 Ga0070681_10150966 Ga0070681_101509662 72
106 3300005458 Ga0070681_10201391 Ga0070681_102013913 72
107 3300005459 Ga0068867_102086335 Ga0068867_1020863353 72
108 3300005530 Ga0070679_100274711 Ga0070679_1002747112 72
109 3300005539 Ga0068853_102065440 Ga0068853_1020654403 72
110 3300005563 Ga0068855_100286240 Ga0068855_1002862402 72
111 3300005577 Ga0068857_101275640 Ga0068857_1012756402 72
112 3300005614 Ga0068856_100279365 Ga0068856_1002793652 72
113 3300005614 Ga0068856_102548756 Ga0068856_1025487562 72
114 3300005616 Ga0068852_100124884 Ga0068852_1001248842 72
115 3300005616 Ga0068852_100161813 Ga0068852_1001618133 72
116 3300005618 Ga0068864_100175815 Ga0068864_1001758152 72
117 3300005841 Ga0068863_100073857 Ga0068863_1000738577 72
118 3300006195 Ga0075366_10235968 Ga0075366_102359683 72
119 3300009093 Ga0105240_10668935 Ga0105240_106689353 72
120 3300011119 Ga0105246_10298388 Ga0105246_102983884 72
121 3300013100 Ga0157373_10042771 Ga0157373_100427715 72
122 3300013100 Ga0157373_11316662 Ga0157373_113166621 72
123 3300013102 Ga0157371_11195397 Ga0157371_111953972 72
124 3300013104 Ga0157370_10147137 Ga0157370_101471372 72
125 3300013104 Ga0157370_11605134 Ga0157370_116051342 72
126 3300013105 Ga0157369_10371554 Ga0157369_103715542 72
127 3300013306 Ga0163162_10643264 Ga0163162_106432643 72
128 3300013307 Ga0157372_10423348 Ga0157372_104233482 72
129 3300013307 Ga0157372_13070245 Ga0157372_130702453 72
130 3300017792 Ga0163161_11925009 Ga0163161_119250092 72
131 3300020069 Ga0197907_10752360 Ga0197907_107523602 72
132 3300020081 Ga0206354_11280003 Ga0206354_112800033 72
133 3300020082 Ga0206353_10715817 Ga0206353_107158174 72
134 3300025901 Ga0207688_10161945 Ga0207688_101619454 72
135 3300025903 Ga0207680_10280633 Ga0207680_102806333 72
136 3300025904 Ga0207647_10097512 Ga0207647_100975125 72
137 3300025917 Ga0207660_10017181 Ga0207660_100171814 72
138 3300025917 Ga0207660_10432753 Ga0207660_104327533 72
139 3300025919 Ga0207657_10030143 Ga0207657_100301434 72
140 3300025919 Ga0207657_10166152 Ga0207657_101661523 72
141 3300025921 Ga0207652_10289983 Ga0207652_102899832 72
142 3300025923 Ga0207681_10075511 Ga0207681_100755113 72
143 3300025925 Ga0207650_10014542 Ga0207650_100145425 72
144 3300025929 Ga0207664_10404080 Ga0207664_104040802 72
145 3300025929 Ga0207664_11697542 Ga0207664_116975422 72
146 3300025931 Ga0207644_10000495 Ga0207644_100004953 72
147 3300025932 Ga0207690_10007235 Ga0207690_100072353 72
148 3300025932 Ga0207690_10689377 Ga0207690_106893772 72
149 3300025932 Ga0207690_11567995 Ga0207690_115679953 72
150 3300025933 Ga0207706_10234190 Ga0207706_102341903 72
151 3300025933 Ga0207706_10696938 Ga0207706_106969382 72
152 3300025937 Ga0207669_10155831 Ga0207669_101558313 72
153 3300025940 Ga0207691_10320813 Ga0207691_103208133 72
154 3300025949 Ga0207667_10298387 Ga0207667_102983872 72
155 3300025961 Ga0207712_11732228 Ga0207712_117322282 72
156 3300025981 Ga0207640_10029379 Ga0207640_100293792 72
157 3300026041 Ga0207639_10606889 Ga0207639_106068892 72
158 3300026067 Ga0207678_10260578 Ga0207678_102605783 72
159 3300026078 Ga0207702_10519725 Ga0207702_105197252 72
160 3300026078 Ga0207702_10644418 Ga0207702_106444183 72
161 3300026088 Ga0207641_10017108 Ga0207641_100171083 72
162 3300026089 Ga0207648_12045643 Ga0207648_120456433 72
163 3300026095 Ga0207676_10056857 Ga0207676_100568574 72
164 3300026116 Ga0207674_10000491 Ga0207674_100004915 72
165 3300026116 Ga0207674_10284501 Ga0207674_102845015 72
166 3300026121 Ga0207683_10277843 Ga0207683_102778434 72
167 3300026121 Ga0207683_10449446 Ga0207683_104494462 72
168 3300026142 Ga0207698_10097934 Ga0207698_100979343 72
169 3300026142 Ga0207698_10147155 Ga0207698_101471556 72
170 3300037312 Ga0395899_0101921 Ga0395899_0101921_909_1127 72
171 3300037418 Ga0395900_0079277 Ga0395900_0079277_2447_2665 72
172 3300037418 Ga0395900_0762916 Ga0395900_0762916_240_458 72
173 3300037466 Ga0395898_0047427 Ga0395898_0047427_3734_3952 72
174 3300037466 Ga0395898_0343465 Ga0395898_0343465_335_565 72
175 3300037471 Ga0395905_0382346 Ga0395905_0382346_776_994 72
176 3300037471 Ga0395905_1217195 Ga0395905_1217195_127_345 72
177 3300037471 Ga0395905_1855613 Ga0395905_1855613_220_438 72
178 3300037471 Ga0395905_1890748 Ga0395905_1890748_71_289 72
179 3300038443 Ga0395901_0235344 Ga0395901_0235344_847_1065 72
180 3300038443 Ga0395901_0747262 Ga0395901_0747262_117_347 72
181 3300044684 Ga0466966_0034268 Ga0466966_0034268_2238_2456 72
182 3300044719 Ga0466971_0060241 Ga0466971_0060241_670_888 72
183 3300044765 Ga0466970_0173840 Ga0466970_0173840_323_541 72
184 3300044901 Ga0466960_0464764 Ga0466960_0464764_455_673 72
185 3300045049 Ga0466959_0232852 Ga0466959_0232852_450_668 72
186 3300045836 Ga0466958_0135762 Ga0466958_0135762_1117_1335 72
187 3300045976 Ga0466967_0207070 Ga0466967_0207070_174_395 72
188 3300045976 Ga0466967_0478298 Ga0466967_0478298_631_858 72
189 3300045976 Ga0466967_1000876 Ga0466967_1000876_339_557 72
190 3300045976 Ga0466967_2187411 Ga0466967_2187411_180_398 72
191 3300047443 Ga0495687_200676 Ga0495687_200676_277_495 72
192 3300050493 nmdc:mga0k408_595094_c1 nmdc:mga0k408_595094_c1_86_304 72
193 3300001978 JGI24747J21853_1042229 JGI24747J21853_10422292 75
194 3300001989 JGI24739J22299_10067896 JGI24739J22299_100678962 75
195 3300001991 JGI24743J22301_10101983 JGI24743J22301_101019832 75
196 3300002077 JGI24744J21845_10006036 JGI24744J21845_100060365 75
197 3300002244 JGI24742J22300_10055115 JGI24742J22300_100551152 75
198 3300002244 JGI24742J22300_10112284 JGI24742J22300_101122842 75
199 3300005327 Ga0070658_11844246 Ga0070658_118442462 75
200 3300005328 Ga0070676_10609062 Ga0070676_106090622 75
201 3300005331 Ga0070670_100284392 Ga0070670_1002843922 75
202 3300005333 Ga0070677_10165551 Ga0070677_101655512 75
203 3300005334 Ga0068869_100457768 Ga0068869_1004577682 75
204 3300005334 Ga0068869_100869678 Ga0068869_1008696782 75
205 3300005339 Ga0070660_100743314 Ga0070660_1007433143 75
206 3300005343 Ga0070687_100414574 Ga0070687_1004145743 75
207 3300005344 Ga0070661_100250482 Ga0070661_1002504823 75
208 3300005347 Ga0070668_100257062 Ga0070668_1002570623 75
209 3300005354 Ga0070675_100198709 Ga0070675_1001987092 75
210 3300005355 Ga0070671_100292433 Ga0070671_1002924333 75
211 3300005356 Ga0070674_100036971 Ga0070674_1000369712 75
212 3300005364 Ga0070673_100297756 Ga0070673_1002977562 75
213 3300005366 Ga0070659_101090489 Ga0070659_1010904892 75
214 3300005367 Ga0070667_100177882 Ga0070667_1001778822 75
215 3300005455 Ga0070663_100242003 Ga0070663_1002420032 75
216 3300005456 Ga0070678_100573251 Ga0070678_1005732512 75
217 3300005457 Ga0070662_100412903 Ga0070662_1004129032 75
218 3300005458 Ga0070681_11850961 Ga0070681_118509612 75
219 3300005459 Ga0068867_100157218 Ga0068867_1001572182 75
220 3300005543 Ga0070672_100388650 Ga0070672_1003886505 75
221 3300005543 Ga0070672_101105300 Ga0070672_1011053001 75
222 3300005547 Ga0070693_100056882 Ga0070693_1000568822 75
223 3300005563 Ga0068855_101318361 Ga0068855_1013183612 75
224 3300005564 Ga0070664_101304797 Ga0070664_1013047972 75
225 3300005578 Ga0068854_100678147 Ga0068854_1006781472 75
226 3300005614 Ga0068856_101846949 Ga0068856_1018469492 75
227 3300005618 Ga0068864_101674188 Ga0068864_1016741882 75
228 3300005718 Ga0068866_10338035 Ga0068866_103380353 75
229 3300005840 Ga0068870_10176533 Ga0068870_101765332 75
230 3300005842 Ga0068858_102505285 Ga0068858_1025052852 75
231 3300006237 Ga0097621_100818591 Ga0097621_1008185913 75
232 3300006881 Ga0068865_101062188 Ga0068865_1010621881 75
233 3300009036 Ga0105244_10114513 Ga0105244_101145134 75
234 3300009098 Ga0105245_11162983 Ga0105245_111629831 75
235 3300009148 Ga0105243_10769932 Ga0105243_107699322 75
236 3300009174 Ga0105241_11340149 Ga0105241_113401491 75
237 3300011119 Ga0105246_10387988 Ga0105246_103879882 75
238 3300013100 Ga0157373_11122695 Ga0157373_111226951 75
239 3300013102 Ga0157371_10825121 Ga0157371_108251212 75
240 3300013297 Ga0157378_10076007 Ga0157378_100760073 75
241 3300014326 Ga0157380_10606811 Ga0157380_106068112 75
242 3300014745 Ga0157377_10126746 Ga0157377_101267462 75
243 3300014969 Ga0157376_11652450 Ga0157376_116524502 75
244 3300025315 Ga0207697_10058881 Ga0207697_100588812 75
245 3300025893 Ga0207682_10040991 Ga0207682_100409913 75
246 3300025899 Ga0207642_10584671 Ga0207642_105846712 75
247 3300025901 Ga0207688_10006153 Ga0207688_100061535 75
248 3300025903 Ga0207680_10353097 Ga0207680_103530973 75
249 3300025904 Ga0207647_10302507 Ga0207647_103025072 75
250 3300025907 Ga0207645_10113776 Ga0207645_101137765 75
251 3300025908 Ga0207643_10740411 Ga0207643_107404113 75
252 3300025911 Ga0207654_10920947 Ga0207654_109209472 75
253 3300025918 Ga0207662_10057451 Ga0207662_100574511 75
254 3300025919 Ga0207657_10080639 Ga0207657_100806392 75
255 3300025920 Ga0207649_10443153 Ga0207649_104431532 75
256 3300025923 Ga0207681_11580800 Ga0207681_115808002 75
257 3300025925 Ga0207650_10228920 Ga0207650_102289202 75
258 3300025926 Ga0207659_10444066 Ga0207659_104440662 75
259 3300025927 Ga0207687_10981314 Ga0207687_109813141 75
260 3300025931 Ga0207644_10081779 Ga0207644_100817792 75
261 3300025932 Ga0207690_10839836 Ga0207690_108398361 75
262 3300025933 Ga0207706_10173882 Ga0207706_101738823 75
263 3300025938 Ga0207704_11232572 Ga0207704_112325723 75
264 3300025940 Ga0207691_10203321 Ga0207691_102033215 75
265 3300025942 Ga0207689_10013991 Ga0207689_100139917 75
266 3300025945 Ga0207679_10933318 Ga0207679_109333182 75
267 3300025972 Ga0207668_10416329 Ga0207668_104163292 75
268 3300025981 Ga0207640_10744886 Ga0207640_107448863 75
269 3300025986 Ga0207658_11325467 Ga0207658_113254672 75
270 3300026035 Ga0207703_10859546 Ga0207703_108595462 75
271 3300026041 Ga0207639_11845242 Ga0207639_118452422 75
272 3300026095 Ga0207676_10405420 Ga0207676_104054202 75
273 3300026118 Ga0207675_100339780 Ga0207675_1003397802 75
274 3300026121 Ga0207683_10215607 Ga0207683_102156072 75
275 3300026142 Ga0207698_10815954 Ga0207698_108159542 75
276 3300035111 Ga0373923_0031492 Ga0373923_0031492_1087_1323 75
277 3300037312 Ga0395899_0183755 Ga0395899_0183755_437_670 75
278 3300037418 Ga0395900_0168977 Ga0395900_0168977_394_627 75
279 3300037466 Ga0395898_0688401 Ga0395898_0688401_457_690 75
280 3300037471 Ga0395905_0089482 Ga0395905_0089482_1602_1835 75
281 3300038443 Ga0395901_0579887 Ga0395901_0579887_797_1030 75
282 3300044658 Ga0466972_0223040 Ga0466972_0223040_222_449 75
283 3300044658 Ga0466972_0276075 Ga0466972_0276075_371_598 75
284 3300044683 Ga0466965_0835142 Ga0466965_0835142_70_297 75
285 3300044901 Ga0466960_0015236 Ga0466960_0015236_588_815 75
286 3300048906 Ga0496103_0326629 Ga0496103_0326629_656_883 75
287 3300048909 Ga0496106_0639269 Ga0496106_0639269_349_576 75
288 3300001915 JGI24741J21665_1014758 JGI24741J21665_10147582 76
289 3300001979 JGI24740J21852_10145565 JGI24740J21852_101455652 76
290 3300001989 JGI24739J22299_10179874 JGI24739J22299_101798741 76
291 3300002067 JGI24735J21928_10003989 JGI24735J21928_100039897 76
292 3300005327 Ga0070658_10214329 Ga0070658_102143294 76
293 3300005327 Ga0070658_10418946 Ga0070658_104189463 76
294 3300005328 Ga0070676_11186650 Ga0070676_111866502 76
295 3300005328 Ga0070676_11392740 Ga0070676_113927401 76
296 3300005329 Ga0070683_100254949 Ga0070683_1002549492 76
297 3300005330 Ga0070690_100137036 Ga0070690_1001370363 76
298 3300005335 Ga0070666_10001765 Ga0070666_100017652 76
299 3300005335 Ga0070666_10245496 Ga0070666_102454962 76
300 3300005335 Ga0070666_10274863 Ga0070666_102748633 76
301 3300005336 Ga0070680_100521248 Ga0070680_1005212482 76
302 3300005336 Ga0070680_100793955 Ga0070680_1007939553 76
303 3300005337 Ga0070682_101669448 Ga0070682_1016694481 76
304 3300005338 Ga0068868_100158424 Ga0068868_1001584242 76
305 3300005338 Ga0068868_100217194 Ga0068868_1002171943 76
306 3300005338 Ga0068868_100278359 Ga0068868_1002783594 76
307 3300005338 Ga0068868_100415641 Ga0068868_1004156412 76
308 3300005339 Ga0070660_100115642 Ga0070660_1001156422 76
309 3300005339 Ga0070660_100402861 Ga0070660_1004028613 76
310 3300005339 Ga0070660_100724183 Ga0070660_1007241833 76
311 3300005340 Ga0070689_100133926 Ga0070689_1001339262 76
312 3300005340 Ga0070689_100986615 Ga0070689_1009866153 76
313 3300005344 Ga0070661_100083872 Ga0070661_1000838722 76
314 3300005344 Ga0070661_100164318 Ga0070661_1001643182 76
315 3300005344 Ga0070661_100800058 Ga0070661_1008000582 76
316 3300005345 Ga0070692_10282332 Ga0070692_102823321 76
317 3300005355 Ga0070671_100976535 Ga0070671_1009765352 76
318 3300005356 Ga0070674_101374783 Ga0070674_1013747832 76
319 3300005364 Ga0070673_100200418 Ga0070673_1002004182 76
320 3300005364 Ga0070673_100227651 Ga0070673_1002276513 76
321 3300005364 Ga0070673_100246106 Ga0070673_1002461063 76
322 3300005365 Ga0070688_100873154 Ga0070688_1008731542 76
323 3300005366 Ga0070659_100034769 Ga0070659_1000347692 76
324 3300005366 Ga0070659_100172090 Ga0070659_1001720903 76
325 3300005366 Ga0070659_100795688 Ga0070659_1007956882 76
326 3300005366 Ga0070659_100828659 Ga0070659_1008286593 76
327 3300005366 Ga0070659_101628891 Ga0070659_1016288911 76
328 3300005367 Ga0070667_100758708 Ga0070667_1007587083 76
329 3300005367 Ga0070667_100853494 Ga0070667_1008534943 76
330 3300005367 Ga0070667_102060350 Ga0070667_1020603502 76
331 3300005434 Ga0070709_10114050 Ga0070709_101140502 76
332 3300005436 Ga0070713_100786869 Ga0070713_1007868692 76
333 3300005438 Ga0070701_10336122 Ga0070701_103361222 76
334 3300005455 Ga0070663_100119340 Ga0070663_1001193404 76
335 3300005455 Ga0070663_101457143 Ga0070663_1014571432 76
336 3300005456 Ga0070678_101145012 Ga0070678_1011450121 76
337 3300005457 Ga0070662_100270219 Ga0070662_1002702192 76
338 3300005457 Ga0070662_100309951 Ga0070662_1003099512 76
339 3300005458 Ga0070681_10044638 Ga0070681_100446387 76
340 3300005530 Ga0070679_100167485 Ga0070679_1001674852 76
341 3300005535 Ga0070684_100691480 Ga0070684_1006914802 76
342 3300005539 Ga0068853_100812904 Ga0068853_1008129042 76
343 3300005539 Ga0068853_101174254 Ga0068853_1011742541 76
344 3300005543 Ga0070672_101807170 Ga0070672_1018071702 76
345 3300005544 Ga0070686_100098729 Ga0070686_1000987291 76
346 3300005544 Ga0070686_100350769 Ga0070686_1003507693 76
347 3300005548 Ga0070665_100577645 Ga0070665_1005776452 76
348 3300005563 Ga0068855_100951823 Ga0068855_1009518232 76
349 3300005563 Ga0068855_101506752 Ga0068855_1015067522 76
350 3300005564 Ga0070664_100038195 Ga0070664_1000381954 76
351 3300005578 Ga0068854_100054269 Ga0068854_1000542691 76
352 3300005578 Ga0068854_100815200 Ga0068854_1008152002 76
353 3300005614 Ga0068856_101190063 Ga0068856_1011900632 76
354 3300005614 Ga0068856_101497100 Ga0068856_1014971002 76
355 3300005616 Ga0068852_100053777 Ga0068852_1000537774 76
356 3300005616 Ga0068852_100190180 Ga0068852_1001901805 76
357 3300005616 Ga0068852_100269136 Ga0068852_1002691362 76
358 3300005616 Ga0068852_101601845 Ga0068852_1016018452 76
359 3300005617 Ga0068859_100430546 Ga0068859_1004305462 76
360 3300005618 Ga0068864_100431297 Ga0068864_1004312974 76
361 3300005618 Ga0068864_101123778 Ga0068864_1011237783 76
362 3300005718 Ga0068866_10195919 Ga0068866_101959192 76
363 3300005834 Ga0068851_10087883 Ga0068851_100878832 76
364 3300005834 Ga0068851_10306253 Ga0068851_103062531 76
365 3300005834 Ga0068851_10739842 Ga0068851_107398422 76
366 3300005841 Ga0068863_100989169 Ga0068863_1009891692 76
367 3300005842 Ga0068858_100763326 Ga0068858_1007633262 76
368 3300005843 Ga0068860_102730964 Ga0068860_1027309642 76
369 3300005844 Ga0068862_101479473 Ga0068862_1014794731 76
370 3300006173 Ga0070716_100882302 Ga0070716_1008823022 76
371 3300006237 Ga0097621_100454353 Ga0097621_1004543532 76
372 3300006358 Ga0068871_100085729 Ga0068871_1000857292 76
373 3300006881 Ga0068865_101103968 Ga0068865_1011039681 76
374 3300006931 Ga0097620_100430549 Ga0097620_1004305492 76
375 3300009098 Ga0105245_10436611 Ga0105245_104366112 76
376 3300009098 Ga0105245_10824041 Ga0105245_108240412 76
377 3300009101 Ga0105247_10779459 Ga0105247_107794591 76
378 3300009148 Ga0105243_10805634 Ga0105243_108056341 76
379 3300009174 Ga0105241_12297709 Ga0105241_122977092 76
380 3300009176 Ga0105242_10275040 Ga0105242_102750402 76
381 3300009177 Ga0105248_10070097 Ga0105248_100700972 76
382 3300009177 Ga0105248_10640421 Ga0105248_106404212 76
383 3300009551 Ga0105238_10804623 Ga0105238_108046232 76
384 3300010375 Ga0105239_11745112 Ga0105239_117451123 76
385 3300011119 Ga0105246_10666673 Ga0105246_106666733 76
386 3300013100 Ga0157373_10470252 Ga0157373_104702523 76
387 3300013100 Ga0157373_10830918 Ga0157373_108309182 76
388 3300013100 Ga0157373_11333135 Ga0157373_113331352 76
389 3300013102 Ga0157371_10114933 Ga0157371_101149332 76
390 3300013102 Ga0157371_10412699 Ga0157371_104126992 76
391 3300013102 Ga0157371_10476861 Ga0157371_104768612 76
392 3300013104 Ga0157370_10056869 Ga0157370_100568692 76
393 3300013104 Ga0157370_11443316 Ga0157370_114433162 76
394 3300013105 Ga0157369_10004426 Ga0157369_1000442619 76
395 3300013105 Ga0157369_10053763 Ga0157369_100537634 76
396 3300013105 Ga0157369_10910847 Ga0157369_109108472 76
397 3300013296 Ga0157374_11660500 Ga0157374_116605002 76
398 3300013296 Ga0157374_12130963 Ga0157374_121309632 76
399 3300013297 Ga0157378_10810426 Ga0157378_108104262 76
400 3300013297 Ga0157378_10865761 Ga0157378_108657613 76
401 3300013306 Ga0163162_11157476 Ga0163162_111574762 76
402 3300013307 Ga0157372_11150679 Ga0157372_111506792 76
403 3300013308 Ga0157375_10140902 Ga0157375_101409022 76
404 3300013308 Ga0157375_11043482 Ga0157375_110434822 76
405 3300013308 Ga0157375_11327234 Ga0157375_113272342 76
406 3300014325 Ga0163163_12055098 Ga0163163_120550982 76
407 3300014497 Ga0182008_10256069 Ga0182008_102560692 76
408 3300014745 Ga0157377_10528183 Ga0157377_105281832 76
409 3300014968 Ga0157379_10043228 Ga0157379_100432281 76
410 3300014968 Ga0157379_10285860 Ga0157379_102858602 76
411 3300014969 Ga0157376_10094088 Ga0157376_100940882 76
412 3300025321 Ga0207656_10024781 Ga0207656_100247812 76
413 3300025899 Ga0207642_10309688 Ga0207642_103096882 76
414 3300025901 Ga0207688_10311494 Ga0207688_103114942 76
415 3300025904 Ga0207647_10032036 Ga0207647_100320365 76
416 3300025904 Ga0207647_10036070 Ga0207647_100360703 76
417 3300025906 Ga0207699_10308318 Ga0207699_103083182 76
418 3300025907 Ga0207645_10065073 Ga0207645_100650732 76
419 3300025909 Ga0207705_10005962 Ga0207705_100059624 76
420 3300025909 Ga0207705_10144077 Ga0207705_101440772 76
421 3300025909 Ga0207705_10362939 Ga0207705_103629392 76
422 3300025911 Ga0207654_10464564 Ga0207654_104645642 76
423 3300025912 Ga0207707_10936611 Ga0207707_109366112 76
424 3300025916 Ga0207663_10806431 Ga0207663_108064311 76
425 3300025917 Ga0207660_10209093 Ga0207660_102090931 76
426 3300025919 Ga0207657_10084451 Ga0207657_100844514 76
427 3300025919 Ga0207657_10129173 Ga0207657_101291733 76
428 3300025919 Ga0207657_10189180 Ga0207657_101891803 76
429 3300025919 Ga0207657_10485810 Ga0207657_104858103 76
430 3300025920 Ga0207649_10136090 Ga0207649_101360902 76
431 3300025920 Ga0207649_10147314 Ga0207649_101473143 76
432 3300025920 Ga0207649_10544405 Ga0207649_105444052 76
433 3300025921 Ga0207652_10239302 Ga0207652_102393022 76
434 3300025921 Ga0207652_10289741 Ga0207652_102897413 76
435 3300025923 Ga0207681_11134762 Ga0207681_111347622 76
436 3300025927 Ga0207687_10273671 Ga0207687_102736712 76
437 3300025928 Ga0207700_11291601 Ga0207700_112916013 76
438 3300025929 Ga0207664_10441800 Ga0207664_104418002 76
439 3300025931 Ga0207644_10029529 Ga0207644_100295297 76
440 3300025931 Ga0207644_10121775 Ga0207644_101217754 76
441 3300025931 Ga0207644_10460682 Ga0207644_104606823 76
442 3300025932 Ga0207690_10391648 Ga0207690_103916484 76
443 3300025932 Ga0207690_10454381 Ga0207690_104543812 76
444 3300025932 Ga0207690_11137231 Ga0207690_111372313 76
445 3300025933 Ga0207706_10050508 Ga0207706_100505085 76
446 3300025933 Ga0207706_10489403 Ga0207706_104894032 76
447 3300025933 Ga0207706_10794102 Ga0207706_107941022 76
448 3300025934 Ga0207686_10912482 Ga0207686_109124822 76
449 3300025936 Ga0207670_10121590 Ga0207670_101215902 76
450 3300025937 Ga0207669_11035764 Ga0207669_110357642 76
451 3300025938 Ga0207704_10173417 Ga0207704_101734171 76
452 3300025939 Ga0207665_10023178 Ga0207665_100231782 76
453 3300025940 Ga0207691_10103917 Ga0207691_101039173 76
454 3300025941 Ga0207711_10224695 Ga0207711_102246952 76
455 3300025941 Ga0207711_10316833 Ga0207711_103168332 76
456 3300025942 Ga0207689_10864989 Ga0207689_108649893 76
457 3300025944 Ga0207661_10155066 Ga0207661_101550665 76
458 3300025944 Ga0207661_11472995 Ga0207661_114729951 76
459 3300025945 Ga0207679_10201341 Ga0207679_102013414 76
460 3300025945 Ga0207679_10527686 Ga0207679_105276862 76
461 3300025945 Ga0207679_11304380 Ga0207679_113043802 76
462 3300025949 Ga0207667_10626357 Ga0207667_106263572 76
463 3300025949 Ga0207667_11492574 Ga0207667_114925742 76
464 3300025960 Ga0207651_10034317 Ga0207651_100343173 76
465 3300025960 Ga0207651_10049300 Ga0207651_100493003 76
466 3300025981 Ga0207640_10195158 Ga0207640_101951584 76
467 3300025981 Ga0207640_10765567 Ga0207640_107655673 76
468 3300025981 Ga0207640_11218303 Ga0207640_112183032 76
469 3300025981 Ga0207640_11241813 Ga0207640_112418132 76
470 3300025986 Ga0207658_10148362 Ga0207658_101483622 76
471 3300025986 Ga0207658_11488640 Ga0207658_114886402 76
472 3300026023 Ga0207677_10186605 Ga0207677_101866053 76
473 3300026023 Ga0207677_10566701 Ga0207677_105667012 76
474 3300026023 Ga0207677_10642998 Ga0207677_106429982 76
475 3300026035 Ga0207703_10267940 Ga0207703_102679402 76
476 3300026035 Ga0207703_10433466 Ga0207703_104334662 76
477 3300026067 Ga0207678_10205670 Ga0207678_102056702 76
478 3300026067 Ga0207678_10223938 Ga0207678_102239384 76
479 3300026078 Ga0207702_10031077 Ga0207702_100310772 76
480 3300026078 Ga0207702_12155312 Ga0207702_121553122 76
481 3300026088 Ga0207641_12195717 Ga0207641_121957172 76
482 3300026089 Ga0207648_11469608 Ga0207648_114696082 76
483 3300026095 Ga0207676_11687955 Ga0207676_116879552 76
484 3300026116 Ga0207674_10146818 Ga0207674_101468182 76
485 3300026116 Ga0207674_10383067 Ga0207674_103830673 76
486 3300026121 Ga0207683_10458216 Ga0207683_104582163 76
487 3300026142 Ga0207698_10277959 Ga0207698_102779592 76
488 3300026142 Ga0207698_10629331 Ga0207698_106293312 76
489 3300026142 Ga0207698_10888953 Ga0207698_108889533 76
490 3300028379 Ga0268266_12033702 Ga0268266_120337022 76
491 3300031548 Ga0307408_100740068 Ga0307408_1007400682 76
492 3300031731 Ga0307405_11371458 Ga0307405_113714582 76
493 3300031911 Ga0307412_10166342 Ga0307412_101663421 76
494 3300032002 Ga0307416_100014414 Ga0307416_1000144144 76
495 3300032002 Ga0307416_102997782 Ga0307416_1029977822 76
496 3300032126 Ga0307415_100021170 Ga0307415_1000211704 76
497 3300035121 Ga0373960_0417918 Ga0373960_0417918_76_306 76
498 3300035692 Ga0373935_1089325 Ga0373935_1089325_303_536 76
499 3300037418 Ga0395900_0111116 Ga0395900_0111116_1761_1991 76
500 3300037418 Ga0395900_0321931 Ga0395900_0321931_1064_1294 76
501 3300037418 Ga0395900_0917765 Ga0395900_0917765_12_242 76
502 3300037466 Ga0395898_0692332 Ga0395898_0692332_526_756 76
503 3300037471 Ga0395905_0130091 Ga0395905_0130091_1109_1339 76
504 3300037471 Ga0395905_0222724 Ga0395905_0222724_1290_1520 76
505 3300037471 Ga0395905_0848619 Ga0395905_0848619_341_571 76
506 3300038443 Ga0395901_0970654 Ga0395901_0970654_270_500 76
507 3300048903 Ga0496100_0053554 Ga0496100_0053554_1744_1974 76
508 3300048905 Ga0496102_0355638 Ga0496102_0355638_558_788 76
509 3300048905 Ga0496102_0628848 Ga0496102_0628848_95_328 76
510 3300048907 Ga0496104_0622829 Ga0496104_0622829_598_828 76
511 3300048908 Ga0496105_0474491 Ga0496105_0474491_672_902 76
512 3300048909 Ga0496106_0363273 Ga0496106_0363273_822_1052 76
513 3300048910 Ga0496107_0178523 Ga0496107_0178523_531_761 76
514 3300048910 Ga0496107_0740215 Ga0496107_0740215_465_698 76
515 3300048915 Ga0496112_0219014 Ga0496112_0219014_33_263 76
516 3300048915 Ga0496112_0312089 Ga0496112_0312089_653_883 76
517 3300048915 Ga0496112_1690807 Ga0496112_1690807_55_285 76
518 3300048916 Ga0496113_0307167 Ga0496113_0307167_716_946 76
519 3300048917 Ga0496114_0399733 Ga0496114_0399733_502_732 76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f4n-assembly1.cif.gz_A c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.7875 6 60
5vo5-assembly1.cif.gz_A crystal structure of lgd-shrub complex, single chain fusion 0.7775 7 59
5j45-assembly1.cif.gz_A crystal structure of shrub, fly ortholog of snf7/chmp4b 0.7555 7 59
4j9z-assembly1.cif.gz_B-2 calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ns309 0.7402 2 58
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.7341 7 65
ID Description Score Start End Superfamily
af_Q7YWW4_1_202_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8834 8 56 1.20.1070.10
af_Q7SXT2_1_112_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.8278 7 56 1.20.5.780
af_Q2FUR7_87_170_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7902 7 59 1.10.287.3510
af_M0RAB0_1_111_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.767 8 56 1.20.5.110
1f4nA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7521 6 63 1.10.287.230
ID Description Score Start End GO Terms
AF-A0A1H3VTB0-F1-model_v4 Uncharacterized protein 0.8896 8 56 GO:0016020
AF-A0A2S8GAA1-F1-model_v4 Uncharacterized protein 0.8796 6 57 GO:0016020
AF-A0A4R1VJ34-F1-model_v4 deleted 0.8662 9 58
AF-A0A2U0ZNA6-F1-model_v4 deleted 0.8639 5 56
AF-A0A2E6MSR1-F1-model_v4 YrhK domain-containing protein 0.8437 8 59 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.73 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map