F458305

General Info

Members Datasets Scaffolds Average Seq Length
518 226 1036 154

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_1156270|Ga0495630_1156270_76_525
Length 149
Sequence MTDFELPEDLAFNRGAITDAEAFARENGAASWLFLCGDEFAAMGGLSYEQVQAAVPVSENIVSDPPVELSVEFVRRHIAALDRLPRPTLITCRTGPRSAAIAYLYAGLKTGASAEEVLARAEADDAPFAGVDAIRDFITQGLEQLAEDR

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
152 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
153 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
215 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
216 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.05
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 22.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_1156270 3300046517 Unclassified 586
2 MRS1b_contig_5257104 2162886011 Bacteria 968
3 MRS1b_contig_7842361 2162886011 Bacteria 818
4 MBSR1b_contig_9521277 2162886012 Bacteria 846
5 ARSoilOldRDRAFT_c004012 3300000044 Bacteria 1254
6 Ga0065712_10071034 3300005290 Bacteria 5529
7 Ga0065712_10157369 3300005290 Bacteria 1326
8 Ga0065712_10268993 3300005290 Bacteria 920
9 Ga0065715_10495262 3300005293 Bacteria 776
10 Ga0065715_10585734 3300005293 Unclassified 717
11 Ga0070676_10300291 3300005328 Bacteria 1088
12 Ga0070683_100061241 3300005329 Bacteria 3499
13 Ga0070683_100063386 3300005329 Bacteria 3438
14 Ga0070683_100418498 3300005329 Bacteria 1278
15 Ga0070683_100577933 3300005329 Bacteria 1075
16 Ga0070690_100292296 3300005330 Bacteria 1166
17 Ga0070690_100441266 3300005330 Unclassified 963
18 Ga0070690_100473077 3300005330 Unclassified 933
19 Ga0070690_100513927 3300005330 Bacteria 898
20 Ga0070690_100797231 3300005330 Unclassified 732
21 Ga0070670_100184638 3300005331 Bacteria 1811
22 Ga0070670_100201597 3300005331 Bacteria 1729
23 Ga0070670_100299939 3300005331 Bacteria 1405
24 Ga0070670_100910776 3300005331 Bacteria 797
25 Ga0070670_101141463 3300005331 Unclassified 711
26 Ga0068869_100067309 3300005334 Bacteria 2642
27 Ga0068869_100102378 3300005334 Bacteria 2168
28 Ga0068869_100206351 3300005334 Bacteria 1552
29 Ga0068869_100208453 3300005334 Bacteria 1544
30 Ga0068868_100001249 3300005338 Bacteria 17464
31 Ga0070689_100018927 3300005340 Bacteria 5083
32 Ga0070689_100032337 3300005340 Unclassified 3978
33 Ga0070689_100279055 3300005340 Bacteria 1385
34 Ga0070689_100307903 3300005340 Bacteria 1320
35 Ga0070689_101669068 3300005340 Unclassified 579
36 Ga0070687_100031761 3300005343 Bacteria 2593
37 Ga0070661_100001463 3300005344 Bacteria 16401
38 Ga0070661_100315012 3300005344 Bacteria 1221
39 Ga0070668_100108471 3300005347 Unclassified 2208
40 Ga0070668_100149610 3300005347 Bacteria 1887
41 Ga0070668_100653585 3300005347 Bacteria 924
42 Ga0070668_100843507 3300005347 Unclassified 816
43 Ga0070669_100005362 3300005353 Bacteria 9252
44 Ga0070669_100006938 3300005353 Bacteria 8139
45 Ga0070669_100087998 3300005353 Bacteria 2324
46 Ga0070675_100052306 3300005354 Bacteria 3358
47 Ga0070675_100162053 3300005354 Bacteria 1924
48 Ga0070675_100171097 3300005354 Bacteria 1873
49 Ga0070675_100537991 3300005354 Bacteria 1055
50 Ga0070675_100628255 3300005354 Bacteria 975
51 Ga0070671_100081738 3300005355 Bacteria 2701
52 Ga0070671_100188308 3300005355 Bacteria 1749
53 Ga0070671_101751250 3300005355 Bacteria 552
54 Ga0070674_100610017 3300005356 Bacteria 923
55 Ga0070673_100027277 3300005364 Bacteria 4232
56 Ga0070673_100027781 3300005364 Bacteria 4198
57 Ga0070673_100033385 3300005364 Bacteria 3886
58 Ga0070673_100050070 3300005364 Unclassified 3264
59 Ga0070673_100062236 3300005364 Bacteria 2964
60 Ga0070673_100144001 3300005364 Bacteria 2013
61 Ga0070673_100305539 3300005364 Unclassified 1402
62 Ga0070673_100333735 3300005364 Bacteria 1342
63 Ga0070673_101820015 3300005364 Unclassified 577
64 Ga0070688_100008410 3300005365 Bacteria 5598
65 Ga0070688_100077183 3300005365 Bacteria 2145
66 Ga0070688_101215694 3300005365 Unclassified 606
67 Ga0070659_101127937 3300005366 Bacteria 692
68 Ga0070701_10015899 3300005438 Unclassified 3486
69 Ga0070701_10121106 3300005438 Unclassified 1474
70 Ga0070701_10129497 3300005438 Bacteria 1432
71 Ga0070700_100061184 3300005441 Bacteria 2375
72 Ga0070694_100430680 3300005444 Unclassified 1038
73 Ga0070694_100865328 3300005444 Unclassified 744
74 Ga0070678_100060065 3300005456 Unclassified 2797
75 Ga0070678_100635061 3300005456 Bacteria 956
76 Ga0070678_101501973 3300005456 Bacteria 631
77 Ga0070662_100029428 3300005457 Bacteria 3833
78 Ga0070662_100116929 3300005457 Bacteria 2039
79 Ga0070662_100688967 3300005457 Bacteria 864
80 Ga0070681_10009916 3300005458 Bacteria 9388
81 Ga0068867_100038457 3300005459 Bacteria 3483
82 Ga0068867_100049779 3300005459 Bacteria 3085
83 Ga0068867_100082362 3300005459 Bacteria 2427
84 Ga0068867_100316652 3300005459 Bacteria 1291
85 Ga0068867_100761909 3300005459 Bacteria 860
86 Ga0070685_10003977 3300005466 Bacteria 7474
87 Ga0070685_10268318 3300005466 Bacteria 1138
88 Ga0070685_10478712 3300005466 Bacteria 877
89 Ga0070685_10860671 3300005466 Unclassified 672
90 Ga0070706_100342339 3300005467 Bacteria 1394
91 Ga0070699_100301307 3300005518 Bacteria 1438
92 Ga0070684_100008384 3300005535 Bacteria 8074
93 Ga0070684_100108126 3300005535 Bacteria 2492
94 Ga0070684_100174469 3300005535 Unclassified 1953
95 Ga0070684_100241698 3300005535 Bacteria 1650
96 Ga0070684_100308397 3300005535 Bacteria 1453
97 Ga0068853_100436348 3300005539 Bacteria 1230
98 Ga0070672_100039912 3300005543 Bacteria 3599
99 Ga0070672_100049560 3300005543 Bacteria 3268
100 Ga0070672_100208408 3300005543 Unclassified 1636
101 Ga0070672_100247052 3300005543 Bacteria 1502
102 Ga0070672_100559262 3300005543 Bacteria 994
103 Ga0070672_100625484 3300005543 Bacteria 939
104 Ga0070686_100144678 3300005544 Bacteria 1659
105 Ga0070686_100153297 3300005544 Bacteria 1616
106 Ga0070696_100000091 3300005546 Bacteria 44490
107 Ga0070696_100007589 3300005546 Bacteria 7251
108 Ga0070665_100003330 3300005548 Bacteria 17215
109 Ga0070665_100335321 3300005548 Bacteria 1517
110 Ga0070665_100888511 3300005548 Bacteria 904
111 Ga0070704_100450640 3300005549 Bacteria 1108
112 Ga0068855_100535589 3300005563 Bacteria 1269
113 Ga0068855_102017339 3300005563 Unclassified 582
114 Ga0070664_100100216 3300005564 Unclassified 2518
115 Ga0070664_100160508 3300005564 Unclassified 1989
116 Ga0070664_100259471 3300005564 Bacteria 1563
117 Ga0070664_100371124 3300005564 Bacteria 1304
118 Ga0070664_100581873 3300005564 Bacteria 1037
119 Ga0068857_100015293 3300005577 Bacteria 6698
120 Ga0068857_100040007 3300005577 Bacteria 4157
121 Ga0068857_100087554 3300005577 Unclassified 2786
122 Ga0068857_100322622 3300005577 Bacteria 1426
123 Ga0068857_100340371 3300005577 Bacteria 1388
124 Ga0068857_102139660 3300005577 Unclassified 549
125 Ga0068854_100405543 3300005578 Bacteria 1129
126 Ga0068856_100686077 3300005614 Bacteria 1045
127 Ga0068852_100177914 3300005616 Bacteria 1998
128 Ga0068852_100255457 3300005616 Bacteria 1680
129 Ga0068852_100329983 3300005616 Bacteria 1484
130 Ga0068852_100635609 3300005616 Bacteria 1074
131 Ga0068859_100074186 3300005617 Bacteria 3441
132 Ga0068859_100095021 3300005617 Bacteria 3033
133 Ga0068859_100126459 3300005617 Bacteria 2625
134 Ga0068859_100130581 3300005617 Bacteria 2583
135 Ga0068859_100206741 3300005617 Bacteria 2048
136 Ga0068859_100445306 3300005617 Bacteria 1391
137 Ga0068859_100524531 3300005617 Bacteria 1279
138 Ga0068859_101032601 3300005617 Bacteria 903
139 Ga0068859_101351666 3300005617 Bacteria 785
140 Ga0068864_100002953 3300005618 Bacteria 14056
141 Ga0068864_100209583 3300005618 Bacteria 1794
142 Ga0068866_10304941 3300005718 Unclassified 996
143 Ga0068866_10732080 3300005718 Bacteria 681
144 Ga0068861_100005005 3300005719 Bacteria 8931
145 Ga0068861_100015421 3300005719 Bacteria 5384
146 Ga0068851_10000166 3300005834 Bacteria 33705
147 Ga0068870_10024478 3300005840 Unclassified 2988
148 Ga0068870_10139894 3300005840 Bacteria 1415
149 Ga0068863_100172072 3300005841 Bacteria 2077
150 Ga0068863_100279540 3300005841 Bacteria 1617
151 Ga0068863_101206209 3300005841 Bacteria 763
152 Ga0068858_100064131 3300005842 Bacteria 3400
153 Ga0068858_100118162 3300005842 Bacteria 2478
154 Ga0068858_101202915 3300005842 Unclassified 745
155 Ga0068860_100350952 3300005843 Bacteria 1452
156 Ga0068860_100379025 3300005843 Bacteria 1396
157 Ga0068860_100497479 3300005843 Bacteria 1217
158 Ga0068860_101569255 3300005843 Unclassified 680
159 Ga0068862_100001920 3300005844 Bacteria 18890
160 Ga0068862_101812897 3300005844 Unclassified 619
161 Ga0070712_100602548 3300006175 Unclassified 930
162 Ga0097621_100203823 3300006237 Bacteria 1718
163 Ga0097621_100290149 3300006237 Bacteria 1442
164 Ga0097621_100457756 3300006237 Bacteria 1150
165 Ga0068871_101164158 3300006358 Unclassified 722
166 Ga0075428_100229100 3300006844 Bacteria 2005
167 Ga0075434_101792915 3300006871 Bacteria 621
168 Ga0075434_101972561 3300006871 Bacteria 589
169 Ga0068865_100030565 3300006881 Unclassified 3584
170 Ga0068865_100453497 3300006881 Bacteria 1061
171 Ga0075436_100099332 3300006914 Bacteria 2026
172 Ga0097620_100074186 3300006931 Bacteria 3441
173 Ga0097620_100095030 3300006931 Bacteria 3033
174 Ga0097620_100126459 3300006931 Bacteria 2625
175 Ga0097620_100130577 3300006931 Bacteria 2583
176 Ga0097620_100206769 3300006931 Bacteria 2048
177 Ga0097620_100445316 3300006931 Bacteria 1391
178 Ga0097620_100524514 3300006931 Bacteria 1279
179 Ga0097620_101032742 3300006931 Bacteria 903
180 Ga0097620_101351617 3300006931 Bacteria 785
181 Ga0111539_10005331 3300009094 Bacteria 16644
182 Ga0111539_10053031 3300009094 Unclassified 4827
183 Ga0111539_11074714 3300009094 Bacteria 935
184 Ga0111539_11886799 3300009094 Bacteria 693
185 Ga0114129_10053470 3300009147 Bacteria 5663
186 Ga0114129_11850069 3300009147 Unclassified 733
187 Ga0105243_10103393 3300009148 Unclassified 2369
188 Ga0105241_11292768 3300009174 Bacteria 694
189 Ga0105242_10662337 3300009176 Unclassified 1017
190 Ga0105248_10292857 3300009177 Archaea 1833
191 Ga0105248_10616602 3300009177 Bacteria 1224
192 Ga0105237_12182599 3300009545 Bacteria 563
193 Ga0105249_10001006 3300009553 Bacteria 24948
194 Ga0105249_10011329 3300009553 Bacteria 7829
195 Ga0105249_10018659 3300009553 Bacteria 6177
196 Ga0105249_10021698 3300009553 Bacteria 5748
197 Ga0105249_10025159 3300009553 Bacteria 5357
198 Ga0105249_10026695 3300009553 Bacteria 5206
199 Ga0105249_10422640 3300009553 Bacteria 1367
200 Ga0105249_10749830 3300009553 Bacteria 1038
201 Ga0105249_11611677 3300009553 Bacteria 722
202 Ga0105239_10908793 3300010375 Bacteria 1011
203 Ga0105246_10593536 3300011119 Bacteria 956
204 Ga0105246_10813466 3300011119 Bacteria 830
205 Ga0157371_10039117 3300013102 Bacteria 3392
206 Ga0157371_10147554 3300013102 Bacteria 1677
207 Ga0157370_10407800 3300013104 Bacteria 1250
208 Ga0157369_10227355 3300013105 Bacteria 1951
209 Ga0157374_10001327 3300013296 Bacteria 21026
210 Ga0157374_10998795 3300013296 Bacteria 856
211 Ga0157374_11052968 3300013296 Bacteria 833
212 Ga0157374_11062216 3300013296 Unclassified 830
213 Ga0157378_10091439 3300013297 Bacteria 2767
214 Ga0157378_10188566 3300013297 Bacteria 1943
215 Ga0157378_11108724 3300013297 Bacteria 829
216 Ga0157378_11825829 3300013297 Unclassified 656
217 Ga0157378_13224407 3300013297 Unclassified 507
218 Ga0163162_10030739 3300013306 Bacteria 5322
219 Ga0163162_10041326 3300013306 Bacteria 4613
220 Ga0163162_10067256 3300013306 Bacteria 3633
221 Ga0163162_10106040 3300013306 Bacteria 2905
222 Ga0163162_10389901 3300013306 Bacteria 1526
223 Ga0163162_10657411 3300013306 Unclassified 1171
224 Ga0157372_10070182 3300013307 Bacteria 3942
225 Ga0157372_10676021 3300013307 Bacteria 1202
226 Ga0157375_10007491 3300013308 Bacteria 9546
227 Ga0157375_10013054 3300013308 Bacteria 7382
228 Ga0157375_10026685 3300013308 Bacteria 5388
229 Ga0157375_10028249 3300013308 Bacteria 5255
230 Ga0157375_10044620 3300013308 Unclassified 4309
231 Ga0157375_10047112 3300013308 Bacteria 4208
232 Ga0157375_10219862 3300013308 Bacteria 2058
233 Ga0157375_10600322 3300013308 Bacteria 1260
234 Ga0157375_10629972 3300013308 Unclassified 1230
235 Ga0157375_11148426 3300013308 Unclassified 910
236 Ga0163163_10010057 3300014325 Bacteria 8485
237 Ga0163163_10031538 3300014325 Bacteria 5116
238 Ga0163163_10217154 3300014325 Bacteria 1961
239 Ga0163163_10315757 3300014325 Bacteria 1616
240 Ga0163163_10501245 3300014325 Bacteria 1276
241 Ga0163163_10829297 3300014325 Archaea 988
242 Ga0163163_11251392 3300014325 Bacteria 804
243 Ga0163163_11652477 3300014325 Unclassified 701
244 Ga0157380_10001340 3300014326 Bacteria 16029
245 Ga0157380_10027775 3300014326 Unclassified 4306
246 Ga0157380_10301661 3300014326 Bacteria 1476
247 Ga0157380_10438399 3300014326 Bacteria 1251
248 Ga0157380_11138332 3300014326 Bacteria 821
249 Ga0157380_11325483 3300014326 Bacteria 768
250 Ga0157380_12297347 3300014326 Bacteria 604
251 Ga0157377_10162880 3300014745 Bacteria 1389
252 Ga0157377_10356824 3300014745 Bacteria 983
253 Ga0157379_10311526 3300014968 Bacteria 1436
254 Ga0157379_10329837 3300014968 Bacteria 1394
255 Ga0157376_10135171 3300014969 Unclassified 2206
256 Ga0157376_11255561 3300014969 Unclassified 770
257 Ga0163161_10182025 3300017792 Unclassified 1612
258 Ga0163161_10768733 3300017792 Bacteria 807
259 Ga0163161_11361539 3300017792 Unclassified 619
260 Ga0213876_10021205 3300021384 Bacteria 3436
261 Ga0207656_10000137 3300025321 Bacteria 27331
262 Ga0207642_10273979 3300025899 Unclassified 968
263 Ga0207645_10176933 3300025907 Bacteria 1399
264 Ga0207643_10001073 3300025908 Bacteria 16162
265 Ga0207643_10485358 3300025908 Unclassified 789
266 Ga0207684_10427011 3300025910 Bacteria 1138
267 Ga0207707_10163665 3300025912 Bacteria 1944
268 Ga0207662_10099597 3300025918 Bacteria 1799
269 Ga0207662_10263546 3300025918 Bacteria 1135
270 Ga0207657_10495382 3300025919 Bacteria 957
271 Ga0207649_10089327 3300025920 Bacteria 2014
272 Ga0207649_10885986 3300025920 Unclassified 699
273 Ga0207681_10121308 3300025923 Bacteria 1917
274 Ga0207650_10003835 3300025925 Bacteria 10277
275 Ga0207650_10045776 3300025925 Bacteria 3220
276 Ga0207650_11142739 3300025925 Unclassified 663
277 Ga0207659_10115709 3300025926 Unclassified 2046
278 Ga0207659_10304349 3300025926 Bacteria 1310
279 Ga0207659_10529408 3300025926 Bacteria 1000
280 Ga0207644_10077735 3300025931 Bacteria 2445
281 Ga0207644_10092378 3300025931 Bacteria 2258
282 Ga0207706_10052917 3300025933 Bacteria 3584
283 Ga0207706_10118609 3300025933 Bacteria 2327
284 Ga0207706_10149494 3300025933 Bacteria 2054
285 Ga0207686_10081725 3300025934 Bacteria 2110
286 Ga0207686_10714267 3300025934 Unclassified 798
287 Ga0207686_10935678 3300025934 Unclassified 701
288 Ga0207709_10159709 3300025935 Bacteria 1570
289 Ga0207670_10022535 3300025936 Bacteria 3905
290 Ga0207670_10037804 3300025936 Unclassified 3148
291 Ga0207669_11089819 3300025937 Unclassified 674
292 Ga0207704_10019008 3300025938 Bacteria 3599
293 Ga0207704_10530792 3300025938 Unclassified 953
294 Ga0207691_10099637 3300025940 Bacteria 2594
295 Ga0207691_10180576 3300025940 Bacteria 1844
296 Ga0207691_10333116 3300025940 Bacteria 1300
297 Ga0207691_10483710 3300025940 Unclassified 1052
298 Ga0207691_11485142 3300025940 Unclassified 554
299 Ga0207689_10031013 3300025942 Bacteria 4454
300 Ga0207689_10105164 3300025942 Bacteria 2319
301 Ga0207689_10196975 3300025942 Bacteria 1663
302 Ga0207661_10009265 3300025944 Bacteria 7056
303 Ga0207661_10116654 3300025944 Unclassified 2267
304 Ga0207679_10001994 3300025945 Bacteria 12670
305 Ga0207679_10215204 3300025945 Bacteria 1614
306 Ga0207679_10389309 3300025945 Bacteria 1224
307 Ga0207679_10530872 3300025945 Bacteria 1054
308 Ga0207651_10026810 3300025960 Bacteria 3608
309 Ga0207651_10074063 3300025960 Bacteria 2424
310 Ga0207651_10322417 3300025960 Unclassified 1292
311 Ga0207712_10010741 3300025961 Bacteria 5820
312 Ga0207712_10120494 3300025961 Bacteria 1984
313 Ga0207712_10342834 3300025961 Unclassified 1240
314 Ga0207712_11146461 3300025961 Unclassified 693
315 Ga0207668_10013604 3300025972 Bacteria 5018
316 Ga0207668_10544718 3300025972 Bacteria 1004
317 Ga0207668_11251979 3300025972 Bacteria 667
318 Ga0207640_11002400 3300025981 Bacteria 735
319 Ga0207658_10058958 3300025986 Bacteria 2859
320 Ga0207677_10006753 3300026023 Bacteria 6301
321 Ga0207677_10098036 3300026023 Bacteria 2149
322 Ga0207703_10116036 3300026035 Bacteria 2291
323 Ga0207703_10131324 3300026035 Bacteria 2163
324 Ga0207703_10157252 3300026035 Bacteria 1987
325 Ga0207678_10039540 3300026067 Bacteria 4094
326 Ga0207708_10038498 3300026075 Unclassified 3643
327 Ga0207708_10394700 3300026075 Bacteria 1143
328 Ga0207641_10532391 3300026088 Archaea 1144
329 Ga0207641_10667317 3300026088 Bacteria 1022
330 Ga0207641_10879466 3300026088 Bacteria 889
331 Ga0207648_10023353 3300026089 Bacteria 5542
332 Ga0207648_10059917 3300026089 Bacteria 3320
333 Ga0207648_10079786 3300026089 Unclassified 2855
334 Ga0207648_10192417 3300026089 Bacteria 1808
335 Ga0207648_10381254 3300026089 Bacteria 1275
336 Ga0207648_10698679 3300026089 Unclassified 940
337 Ga0207676_10173182 3300026095 Bacteria 1882
338 Ga0207676_10289219 3300026095 Unclassified 1491
339 Ga0207676_11932800 3300026095 Unclassified 589
340 Ga0207674_10017867 3300026116 Bacteria 7731
341 Ga0207674_10019612 3300026116 Bacteria 7322
342 Ga0207674_10037768 3300026116 Bacteria 5018
343 Ga0207674_11830320 3300026116 Bacteria 574
344 Ga0207675_100003270 3300026118 Bacteria 15866
345 Ga0207675_100003862 3300026118 Bacteria 14565
346 Ga0207675_100030208 3300026118 Bacteria 5047
347 Ga0207683_10198584 3300026121 Unclassified 1823
348 Ga0207683_10510399 3300026121 Bacteria 1111
349 Ga0207698_10028781 3300026142 Unclassified 3967
350 Ga0207698_10251699 3300026142 Bacteria 1617
351 Ga0207698_12081411 3300026142 Unclassified 581
352 Ga0207428_10015339 3300027907 Bacteria 6630
353 Ga0207428_10066115 3300027907 Bacteria 2849
354 Ga0207428_10076854 3300027907 Unclassified 2614
355 Ga0207428_10418732 3300027907 Bacteria 979
356 Ga0268266_10000912 3300028379 Bacteria 38037
357 Ga0268266_10839242 3300028379 Bacteria 888
358 Ga0268266_10898711 3300028379 Bacteria 856
359 Ga0268265_10113181 3300028380 Bacteria 2220
360 Ga0268265_10829013 3300028380 Unclassified 903
361 Ga0268265_11779040 3300028380 Unclassified 622
362 Ga0268264_10081629 3300028381 Unclassified 2764
363 Ga0268264_10866099 3300028381 Bacteria 905
364 Ga0307412_10593046 3300031911 Unclassified 937
365 Ga0307416_101672286 3300032002 Unclassified 741
366 Ga0307416_103022681 3300032002 Bacteria 563
367 Ga0373952_0169022 3300035092 Bacteria 624
368 Ga0373953_0113239 3300035117 Bacteria 1149
369 Ga0373957_0013053 3300035120 Bacteria 2811
370 Ga0373955_0014273 3300035172 Bacteria 3860
371 Ga0373955_0173275 3300035172 Bacteria 1278
372 Ga0373955_0231102 3300035172 Bacteria 1106
373 Ga0373955_0929793 3300035172 Bacteria 535
374 Ga0373924_0021013 3300035410 Bacteria 2543
375 Ga0373933_0077635 3300035724 Unclassified 2030
376 Ga0373947_0206595 3300035725 Bacteria 1287
377 Ga0373937_0014891 3300036401 Bacteria 6868
378 Ga0373937_0034391 3300036401 Unclassified 4610
379 Ga0373937_0142709 3300036401 Bacteria 2241
380 Ga0373925_0349027 3300037068 Unclassified 1201
381 Ga0373925_0778564 3300037068 Unclassified 789
382 Ga0395899_0411553 3300037312 Bacteria 893
383 Ga0395900_0028686 3300037418 Bacteria 5704
384 Ga0395900_0028729 3300037418 Bacteria 5701
385 Ga0395905_0093928 3300037471 Bacteria 2813
386 Ga0436364_0186154 3300037853 Bacteria 767
387 Ga0395901_0097756 3300038443 Bacteria 3078
388 Ga0395901_0775831 3300038443 Bacteria 949
389 Ga0436362_1260193 3300039453 Bacteria 1233
390 Ga0451800_1369159 3300041459 Bacteria 2251
391 Ga0451835_0034453 3300041492 Bacteria 792
392 Ga0451845_0838662 3300041501 Bacteria 563
393 Ga0451849_1010952 3300041505 Bacteria 929
394 Ga0451853_1610791 3300041512 Bacteria 2997
395 Ga0451853_3873674 3300041512 Bacteria 691
396 Ga0466969_0091150 3300044656 Unclassified 1444
397 Ga0466966_0004051 3300044684 Bacteria 9673
398 Ga0466961_0025024 3300044693 Bacteria 3842
399 Ga0466963_0233355 3300044694 Bacteria 1289
400 Ga0466964_0011920 3300044706 Bacteria 3286
401 Ga0466970_0163611 3300044765 Unclassified 1231
402 Ga0466959_0163231 3300045049 Bacteria 1565
403 Ga0451576_0110355 3300045051 Bacteria 2863
404 Ga0451576_0486323 3300045051 Unclassified 1296
405 Ga0451576_0502420 3300045051 Bacteria 1274
406 Ga0466958_0089754 3300045836 Bacteria 1900
407 Ga0466967_0006046 3300045976 Bacteria 8509
408 Ga0466967_0195436 3300045976 Bacteria 1914
409 Ga0495592_0090923 3300046454 Bacteria 2189
410 Ga0495603_0223984 3300046455 Bacteria 1085
411 Ga0495629_0100649 3300046459 Bacteria 2017
412 Ga0495651_0391598 3300046462 Bacteria 909
413 Ga0495651_0613950 3300046462 Unclassified 685
414 Ga0495653_0097699 3300046463 Bacteria 2133
415 Ga0495653_0361166 3300046463 Bacteria 932
416 Ga0495653_0533653 3300046463 Unclassified 728
417 Ga0495653_0555182 3300046463 Bacteria 710
418 Ga0495582_0188346 3300046473 Bacteria 1177
419 Ga0495639_0331266 3300046475 Unclassified 762
420 Ga0495664_0169815 3300046477 Unclassified 1323
421 Ga0495608_0026976 3300046511 Unclassified 3912
422 Ga0495608_0062857 3300046511 Bacteria 2438
423 Ga0495608_0370615 3300046511 Bacteria 879
424 Ga0495608_0914134 3300046511 Bacteria 513
425 Ga0495618_0013281 3300046514 Bacteria 5013
426 Ga0495618_0069151 3300046514 Bacteria 2245
427 Ga0495618_0411983 3300046514 Bacteria 825
428 Ga0495618_0595819 3300046514 Unclassified 658
429 Ga0495628_0036390 3300046516 Bacteria 3951
430 Ga0495628_0047654 3300046516 Bacteria 3399
431 Ga0495630_0010101 3300046517 Bacteria 6803
432 Ga0495630_0063775 3300046517 Unclassified 2768
433 Ga0495630_0464112 3300046517 Bacteria 970
434 Ga0495652_0669937 3300046529 Bacteria 701
435 Ga0495640_0028060 3300046533 Bacteria 4055
436 Ga0495586_0041832 3300046535 Bacteria 2468
437 Ga0495586_0136198 3300046535 Unclassified 1376
438 Ga0495586_0364117 3300046535 Bacteria 831
439 Ga0495587_0007260 3300046536 Bacteria 7186
440 Ga0495587_0295806 3300046536 Bacteria 906
441 Ga0495598_0289093 3300046537 Unclassified 617
442 Ga0495621_0104863 3300046539 Bacteria 1079
443 Ga0495645_0265437 3300046543 Bacteria 1135
444 Ga0495667_0048996 3300046559 Bacteria 2789
445 Ga0495634_0008470 3300046642 Bacteria 7651
446 Ga0495634_0071039 3300046642 Unclassified 2293
447 Ga0495634_0433190 3300046642 Bacteria 777
448 Ga0495635_0135787 3300046663 Bacteria 1677
449 Ga0495635_0457611 3300046663 Bacteria 843
450 Ga0495588_0267319 3300046674 Unclassified 901
451 Ga0495657_0083613 3300046675 Unclassified 2060
452 Ga0495657_0172709 3300046675 Bacteria 1330
453 Ga0495657_0183582 3300046675 Unclassified 1282
454 Ga0495599_0316598 3300046678 Bacteria 940
455 Ga0495646_0678730 3300046680 Unclassified 519
456 Ga0495647_0081189 3300046681 Bacteria 1315
457 Ga0495613_0002645 3300046689 Bacteria 13465
458 Ga0495613_0123283 3300046689 Bacteria 1860
459 Ga0495600_0077790 3300046809 Unclassified 2167
460 Ga0495600_0140175 3300046809 Bacteria 1569
461 Ga0495600_0321806 3300046809 Unclassified 972
462 Ga0495674_0207195 3300047319 Bacteria 1625
463 Ga0495674_0698966 3300047319 Bacteria 796
464 Ga0495674_1342154 3300047319 Bacteria 535
465 Ga0495676_0647922 3300047321 Bacteria 686
466 Ga0495680_0070879 3300047322 Bacteria 2655
467 Ga0495680_0344788 3300047322 Bacteria 1038
468 Ga0495680_0494237 3300047322 Bacteria 831
469 Ga0495675_0003762 3300047444 Bacteria 9180
470 Ga0495675_0509123 3300047444 Unclassified 690
471 Ga0495684_0019759 3300047471 Bacteria 5191
472 Ga0495602_1065471 3300048088 Bacteria 531
473 Ga0496100_0014368 3300048903 Bacteria 4595
474 Ga0496101_1177911 3300048904 Bacteria 601
475 Ga0496102_0106602 3300048905 Bacteria 2608
476 Ga0496103_0078747 3300048906 Bacteria 2070
477 Ga0496104_0001174 3300048907 Bacteria 22480
478 Ga0496104_0594711 3300048907 Bacteria 1017
479 Ga0496105_0001136 3300048908 Bacteria 18559
480 Ga0496109_0001573 3300048912 Bacteria 19040
481 Ga0496109_0066330 3300048912 Bacteria 3305
482 Ga0496109_0358928 3300048912 Unclassified 1377
483 Ga0496110_0009781 3300048913 Bacteria 7766
484 Ga0496110_0029479 3300048913 Unclassified 4724
485 Ga0496110_0136094 3300048913 Bacteria 2220
486 Ga0496110_0723367 3300048913 Bacteria 898
487 Ga0496111_0004174 3300048914 Bacteria 9091
488 Ga0496112_0009517 3300048915 Bacteria 8763
489 Ga0496113_0001324 3300048916 Bacteria 13695
490 Ga0496115_0487433 3300048918 Unclassified 992
491 Ga0496115_0621355 3300048918 Bacteria 857
492 Ga0496115_0662377 3300048918 Unclassified 824
493 Ga0501038_0279944 3300049574 Bacteria 1313
494 Ga0501047_0057294 3300049581 Bacteria 3768
495 Ga0501073_0041311 3300049589 Bacteria 3258
496 Ga0501207_068704 3300049654 Bacteria 662
497 Ga0501230_009232 3300049667 Bacteria 1513
498 Ga0501257_082473 3300049686 Bacteria 830
499 Ga0501080_0337521 3300049742 Bacteria 1362
500 Ga0501083_0186160 3300049744 Bacteria 1355
501 Ga0501044_1302924 3300049823 Unclassified 593
502 nmdc:mga05p37_1371773_c1 3300050507 Unclassified 714
503 nmdc:mga05p37_164435_c1 3300050507 Unclassified 2709
504 nmdc:mga08y16_106800_c1 3300050511 Bacteria 2914
505 nmdc:mga08y16_190920_c1 3300050511 Bacteria 2125
506 nmdc:mga08y16_19679_c1 3300050511 Bacteria 7117
507 nmdc:mga08y16_34677_c2 3300050511 Unclassified 3987
508 nmdc:mga0n895_11898_c1 3300050512 Bacteria 7785
509 nmdc:mga0n895_134382_c1 3300050512 Bacteria 2499
510 nmdc:mga08x19_282786_c1 3300050514 Bacteria 1150
511 Ga0495601_0013849 3300053077 Bacteria 4856
512 Ga0495601_0121621 3300053077 Bacteria 1696
513 Ga0495601_0557764 3300053077 Bacteria 737
514 Ga0495595_0051349 3300053084 Bacteria 1911
515 Ga0495619_0006064 3300053085 Bacteria 7655
516 Ga0495619_0026120 3300053085 Bacteria 3756
517 Ga0495619_0292048 3300053085 Bacteria 1129
518 Ga0495619_0929538 3300053085 Bacteria 584
519 Ga0495630_1156270
520 MRS1b_contig_5257104
521 MRS1b_contig_7842361
522 MBSR1b_contig_9521277
523 ARSoilOldRDRAFT_c004012
524 Ga0065712_10071034
525 Ga0065712_10157369
526 Ga0065712_10268993
527 Ga0065715_10495262
528 Ga0065715_10585734
529 Ga0070676_10300291
530 Ga0070683_100061241
531 Ga0070683_100063386
532 Ga0070683_100418498
533 Ga0070683_100577933
534 Ga0070690_100292296
535 Ga0070690_100441266
536 Ga0070690_100473077
537 Ga0070690_100513927
538 Ga0070690_100797231
539 Ga0070670_100184638
540 Ga0070670_100201597
541 Ga0070670_100299939
542 Ga0070670_100910776
543 Ga0070670_101141463
544 Ga0068869_100067309
545 Ga0068869_100102378
546 Ga0068869_100206351
547 Ga0068869_100208453
548 Ga0068868_100001249
549 Ga0070689_100018927
550 Ga0070689_100032337
551 Ga0070689_100279055
552 Ga0070689_100307903
553 Ga0070689_101669068
554 Ga0070687_100031761
555 Ga0070661_100001463
556 Ga0070661_100315012
557 Ga0070668_100108471
558 Ga0070668_100149610
559 Ga0070668_100653585
560 Ga0070668_100843507
561 Ga0070669_100005362
562 Ga0070669_100006938
563 Ga0070669_100087998
564 Ga0070675_100052306
565 Ga0070675_100162053
566 Ga0070675_100171097
567 Ga0070675_100537991
568 Ga0070675_100628255
569 Ga0070671_100081738
570 Ga0070671_100188308
571 Ga0070671_101751250
572 Ga0070674_100610017
573 Ga0070673_100027277
574 Ga0070673_100027781
575 Ga0070673_100033385
576 Ga0070673_100050070
577 Ga0070673_100062236
578 Ga0070673_100144001
579 Ga0070673_100305539
580 Ga0070673_100333735
581 Ga0070673_101820015
582 Ga0070688_100008410
583 Ga0070688_100077183
584 Ga0070688_101215694
585 Ga0070659_101127937
586 Ga0070701_10015899
587 Ga0070701_10121106
588 Ga0070701_10129497
589 Ga0070700_100061184
590 Ga0070694_100430680
591 Ga0070694_100865328
592 Ga0070678_100060065
593 Ga0070678_100635061
594 Ga0070678_101501973
595 Ga0070662_100029428
596 Ga0070662_100116929
597 Ga0070662_100688967
598 Ga0070681_10009916
599 Ga0068867_100038457
600 Ga0068867_100049779
601 Ga0068867_100082362
602 Ga0068867_100316652
603 Ga0068867_100761909
604 Ga0070685_10003977
605 Ga0070685_10268318
606 Ga0070685_10478712
607 Ga0070685_10860671
608 Ga0070706_100342339
609 Ga0070699_100301307
610 Ga0070684_100008384
611 Ga0070684_100108126
612 Ga0070684_100174469
613 Ga0070684_100241698
614 Ga0070684_100308397
615 Ga0068853_100436348
616 Ga0070672_100039912
617 Ga0070672_100049560
618 Ga0070672_100208408
619 Ga0070672_100247052
620 Ga0070672_100559262
621 Ga0070672_100625484
622 Ga0070686_100144678
623 Ga0070686_100153297
624 Ga0070696_100000091
625 Ga0070696_100007589
626 Ga0070665_100003330
627 Ga0070665_100335321
628 Ga0070665_100888511
629 Ga0070704_100450640
630 Ga0068855_100535589
631 Ga0068855_102017339
632 Ga0070664_100100216
633 Ga0070664_100160508
634 Ga0070664_100259471
635 Ga0070664_100371124
636 Ga0070664_100581873
637 Ga0068857_100015293
638 Ga0068857_100040007
639 Ga0068857_100087554
640 Ga0068857_100322622
641 Ga0068857_100340371
642 Ga0068857_102139660
643 Ga0068854_100405543
644 Ga0068856_100686077
645 Ga0068852_100177914
646 Ga0068852_100255457
647 Ga0068852_100329983
648 Ga0068852_100635609
649 Ga0068859_100074186
650 Ga0068859_100095021
651 Ga0068859_100126459
652 Ga0068859_100130581
653 Ga0068859_100206741
654 Ga0068859_100445306
655 Ga0068859_100524531
656 Ga0068859_101032601
657 Ga0068859_101351666
658 Ga0068864_100002953
659 Ga0068864_100209583
660 Ga0068866_10304941
661 Ga0068866_10732080
662 Ga0068861_100005005
663 Ga0068861_100015421
664 Ga0068851_10000166
665 Ga0068870_10024478
666 Ga0068870_10139894
667 Ga0068863_100172072
668 Ga0068863_100279540
669 Ga0068863_101206209
670 Ga0068858_100064131
671 Ga0068858_100118162
672 Ga0068858_101202915
673 Ga0068860_100350952
674 Ga0068860_100379025
675 Ga0068860_100497479
676 Ga0068860_101569255
677 Ga0068862_100001920
678 Ga0068862_101812897
679 Ga0070712_100602548
680 Ga0097621_100203823
681 Ga0097621_100290149
682 Ga0097621_100457756
683 Ga0068871_101164158
684 Ga0075428_100229100
685 Ga0075434_101792915
686 Ga0075434_101972561
687 Ga0068865_100030565
688 Ga0068865_100453497
689 Ga0075436_100099332
690 Ga0097620_100074186
691 Ga0097620_100095030
692 Ga0097620_100126459
693 Ga0097620_100130577
694 Ga0097620_100206769
695 Ga0097620_100445316
696 Ga0097620_100524514
697 Ga0097620_101032742
698 Ga0097620_101351617
699 Ga0111539_10005331
700 Ga0111539_10053031
701 Ga0111539_11074714
702 Ga0111539_11886799
703 Ga0114129_10053470
704 Ga0114129_11850069
705 Ga0105243_10103393
706 Ga0105241_11292768
707 Ga0105242_10662337
708 Ga0105248_10292857
709 Ga0105248_10616602
710 Ga0105237_12182599
711 Ga0105249_10001006
712 Ga0105249_10011329
713 Ga0105249_10018659
714 Ga0105249_10021698
715 Ga0105249_10025159
716 Ga0105249_10026695
717 Ga0105249_10422640
718 Ga0105249_10749830
719 Ga0105249_11611677
720 Ga0105239_10908793
721 Ga0105246_10593536
722 Ga0105246_10813466
723 Ga0157371_10039117
724 Ga0157371_10147554
725 Ga0157370_10407800
726 Ga0157369_10227355
727 Ga0157374_10001327
728 Ga0157374_10998795
729 Ga0157374_11052968
730 Ga0157374_11062216
731 Ga0157378_10091439
732 Ga0157378_10188566
733 Ga0157378_11108724
734 Ga0157378_11825829
735 Ga0157378_13224407
736 Ga0163162_10030739
737 Ga0163162_10041326
738 Ga0163162_10067256
739 Ga0163162_10106040
740 Ga0163162_10389901
741 Ga0163162_10657411
742 Ga0157372_10070182
743 Ga0157372_10676021
744 Ga0157375_10007491
745 Ga0157375_10013054
746 Ga0157375_10026685
747 Ga0157375_10028249
748 Ga0157375_10044620
749 Ga0157375_10047112
750 Ga0157375_10219862
751 Ga0157375_10600322
752 Ga0157375_10629972
753 Ga0157375_11148426
754 Ga0163163_10010057
755 Ga0163163_10031538
756 Ga0163163_10217154
757 Ga0163163_10315757
758 Ga0163163_10501245
759 Ga0163163_10829297
760 Ga0163163_11251392
761 Ga0163163_11652477
762 Ga0157380_10001340
763 Ga0157380_10027775
764 Ga0157380_10301661
765 Ga0157380_10438399
766 Ga0157380_11138332
767 Ga0157380_11325483
768 Ga0157380_12297347
769 Ga0157377_10162880
770 Ga0157377_10356824
771 Ga0157379_10311526
772 Ga0157379_10329837
773 Ga0157376_10135171
774 Ga0157376_11255561
775 Ga0163161_10182025
776 Ga0163161_10768733
777 Ga0163161_11361539
778 Ga0213876_10021205
779 Ga0207656_10000137
780 Ga0207642_10273979
781 Ga0207645_10176933
782 Ga0207643_10001073
783 Ga0207643_10485358
784 Ga0207684_10427011
785 Ga0207707_10163665
786 Ga0207662_10099597
787 Ga0207662_10263546
788 Ga0207657_10495382
789 Ga0207649_10089327
790 Ga0207649_10885986
791 Ga0207681_10121308
792 Ga0207650_10003835
793 Ga0207650_10045776
794 Ga0207650_11142739
795 Ga0207659_10115709
796 Ga0207659_10304349
797 Ga0207659_10529408
798 Ga0207644_10077735
799 Ga0207644_10092378
800 Ga0207706_10052917
801 Ga0207706_10118609
802 Ga0207706_10149494
803 Ga0207686_10081725
804 Ga0207686_10714267
805 Ga0207686_10935678
806 Ga0207709_10159709
807 Ga0207670_10022535
808 Ga0207670_10037804
809 Ga0207669_11089819
810 Ga0207704_10019008
811 Ga0207704_10530792
812 Ga0207691_10099637
813 Ga0207691_10180576
814 Ga0207691_10333116
815 Ga0207691_10483710
816 Ga0207691_11485142
817 Ga0207689_10031013
818 Ga0207689_10105164
819 Ga0207689_10196975
820 Ga0207661_10009265
821 Ga0207661_10116654
822 Ga0207679_10001994
823 Ga0207679_10215204
824 Ga0207679_10389309
825 Ga0207679_10530872
826 Ga0207651_10026810
827 Ga0207651_10074063
828 Ga0207651_10322417
829 Ga0207712_10010741
830 Ga0207712_10120494
831 Ga0207712_10342834
832 Ga0207712_11146461
833 Ga0207668_10013604
834 Ga0207668_10544718
835 Ga0207668_11251979
836 Ga0207640_11002400
837 Ga0207658_10058958
838 Ga0207677_10006753
839 Ga0207677_10098036
840 Ga0207703_10116036
841 Ga0207703_10131324
842 Ga0207703_10157252
843 Ga0207678_10039540
844 Ga0207708_10038498
845 Ga0207708_10394700
846 Ga0207641_10532391
847 Ga0207641_10667317
848 Ga0207641_10879466
849 Ga0207648_10023353
850 Ga0207648_10059917
851 Ga0207648_10079786
852 Ga0207648_10192417
853 Ga0207648_10381254
854 Ga0207648_10698679
855 Ga0207676_10173182
856 Ga0207676_10289219
857 Ga0207676_11932800
858 Ga0207674_10017867
859 Ga0207674_10019612
860 Ga0207674_10037768
861 Ga0207674_11830320
862 Ga0207675_100003270
863 Ga0207675_100003862
864 Ga0207675_100030208
865 Ga0207683_10198584
866 Ga0207683_10510399
867 Ga0207698_10028781
868 Ga0207698_10251699
869 Ga0207698_12081411
870 Ga0207428_10015339
871 Ga0207428_10066115
872 Ga0207428_10076854
873 Ga0207428_10418732
874 Ga0268266_10000912
875 Ga0268266_10839242
876 Ga0268266_10898711
877 Ga0268265_10113181
878 Ga0268265_10829013
879 Ga0268265_11779040
880 Ga0268264_10081629
881 Ga0268264_10866099
882 Ga0307412_10593046
883 Ga0307416_101672286
884 Ga0307416_103022681
885 Ga0373952_0169022
886 Ga0373953_0113239
887 Ga0373957_0013053
888 Ga0373955_0014273
889 Ga0373955_0173275
890 Ga0373955_0231102
891 Ga0373955_0929793
892 Ga0373924_0021013
893 Ga0373933_0077635
894 Ga0373947_0206595
895 Ga0373937_0014891
896 Ga0373937_0034391
897 Ga0373937_0142709
898 Ga0373925_0349027
899 Ga0373925_0778564
900 Ga0395899_0411553
901 Ga0395900_0028686
902 Ga0395900_0028729
903 Ga0395905_0093928
904 Ga0436364_0186154
905 Ga0395901_0097756
906 Ga0395901_0775831
907 Ga0436362_1260193
908 Ga0451800_1369159
909 Ga0451835_0034453
910 Ga0451845_0838662
911 Ga0451849_1010952
912 Ga0451853_1610791
913 Ga0451853_3873674
914 Ga0466969_0091150
915 Ga0466966_0004051
916 Ga0466961_0025024
917 Ga0466963_0233355
918 Ga0466964_0011920
919 Ga0466970_0163611
920 Ga0466959_0163231
921 Ga0451576_0110355
922 Ga0451576_0486323
923 Ga0451576_0502420
924 Ga0466958_0089754
925 Ga0466967_0006046
926 Ga0466967_0195436
927 Ga0495592_0090923
928 Ga0495603_0223984
929 Ga0495629_0100649
930 Ga0495651_0391598
931 Ga0495651_0613950
932 Ga0495653_0097699
933 Ga0495653_0361166
934 Ga0495653_0533653
935 Ga0495653_0555182
936 Ga0495582_0188346
937 Ga0495639_0331266
938 Ga0495664_0169815
939 Ga0495608_0026976
940 Ga0495608_0062857
941 Ga0495608_0370615
942 Ga0495608_0914134
943 Ga0495618_0013281
944 Ga0495618_0069151
945 Ga0495618_0411983
946 Ga0495618_0595819
947 Ga0495628_0036390
948 Ga0495628_0047654
949 Ga0495630_0010101
950 Ga0495630_0063775
951 Ga0495630_0464112
952 Ga0495652_0669937
953 Ga0495640_0028060
954 Ga0495586_0041832
955 Ga0495586_0136198
956 Ga0495586_0364117
957 Ga0495587_0007260
958 Ga0495587_0295806
959 Ga0495598_0289093
960 Ga0495621_0104863
961 Ga0495645_0265437
962 Ga0495667_0048996
963 Ga0495634_0008470
964 Ga0495634_0071039
965 Ga0495634_0433190
966 Ga0495635_0135787
967 Ga0495635_0457611
968 Ga0495588_0267319
969 Ga0495657_0083613
970 Ga0495657_0172709
971 Ga0495657_0183582
972 Ga0495599_0316598
973 Ga0495646_0678730
974 Ga0495647_0081189
975 Ga0495613_0002645
976 Ga0495613_0123283
977 Ga0495600_0077790
978 Ga0495600_0140175
979 Ga0495600_0321806
980 Ga0495674_0207195
981 Ga0495674_0698966
982 Ga0495674_1342154
983 Ga0495676_0647922
984 Ga0495680_0070879
985 Ga0495680_0344788
986 Ga0495680_0494237
987 Ga0495675_0003762
988 Ga0495675_0509123
989 Ga0495684_0019759
990 Ga0495602_1065471
991 Ga0496100_0014368
992 Ga0496101_1177911
993 Ga0496102_0106602
994 Ga0496103_0078747
995 Ga0496104_0001174
996 Ga0496104_0594711
997 Ga0496105_0001136
998 Ga0496109_0001573
999 Ga0496109_0066330
1000 Ga0496109_0358928
1001 Ga0496110_0009781
1002 Ga0496110_0029479
1003 Ga0496110_0136094
1004 Ga0496110_0723367
1005 Ga0496111_0004174
1006 Ga0496112_0009517
1007 Ga0496113_0001324
1008 Ga0496115_0487433
1009 Ga0496115_0621355
1010 Ga0496115_0662377
1011 Ga0501038_0279944
1012 Ga0501047_0057294
1013 Ga0501073_0041311
1014 Ga0501207_068704
1015 Ga0501230_009232
1016 Ga0501257_082473
1017 Ga0501080_0337521
1018 Ga0501083_0186160
1019 Ga0501044_1302924
1020 nmdc:mga05p37_1371773_c1
1021 nmdc:mga05p37_164435_c1
1022 nmdc:mga08y16_106800_c1
1023 nmdc:mga08y16_190920_c1
1024 nmdc:mga08y16_19679_c1
1025 nmdc:mga08y16_34677_c2
1026 nmdc:mga0n895_11898_c1
1027 nmdc:mga0n895_134382_c1
1028 nmdc:mga08x19_282786_c1
1029 Ga0495601_0013849
1030 Ga0495601_0121621
1031 Ga0495601_0557764
1032 Ga0495595_0051349
1033 Ga0495619_0006064
1034 Ga0495619_0026120
1035 Ga0495619_0292048
1036 Ga0495619_0929538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z5a-assembly3.cif.gz_C crystal structure of tk-ptp in the active form 0.8018 10 150
3qcj-assembly1.cif.gz_A human receptor protein tyrosine phosphatase gamma, domain 1, in complex with 5-[({3-[(3,4-dichlorobenzyl)sulfanyl]thiophen-2-yl}carbonyl)sulfamoyl]-2-methoxybenzoic acid 0.7695 65 153
2qdc-assembly1.cif.gz_A crystal structure of the heptp catalytic domain d236a mutant 0.7664 65 153
5z5a-assembly3.cif.gz_C crystal structure of tk-ptp in the active form 0.7636 10 150
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.7616 15 153
ID Description Score Start End Superfamily
af_P76093_299_430_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.758 11 149 3.90.190.10
af_A0A0G2KB18_130_293_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7553 11 152 3.90.190.10
af_O01923_737_1048_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7531 65 153 3.90.190.10
af_Q59NH8_173_336_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.751 27 153 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7469 15 153 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A537J3K7-F1-model_v4 Uncharacterized protein 0.9981 7 138
AF-A0A537J3K7-F1-model_v4 Uncharacterized protein 0.9906 7 138
AF-A0A538FN99-F1-model_v4 Uncharacterized protein 0.9889 7 152
AF-A0A538FN99-F1-model_v4 Uncharacterized protein 0.9756 7 152
AF-A0A538KYY2-F1-model_v4 Rhodanese-like domain-containing protein 0.9706 49 152

Map