F458210

General Info

Members Datasets Scaffolds Average Seq Length
518 209 1036 191

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100757464|Ga0070683_1007574642
Length 231
Sequence MRLAIGGDGLGCVAPGLADADESESQLCGIAGHWFIIICMLNREEAWNIVCEFTKSEGLRKHAMAVETCVAAYARKSGEDEQKWSLTALLHDFDWEIHPQAPDHPMKGEAILAERGVDEEIRRAILSHANYSGVPRVSALEKTLYACDELAGFITAISYVKPGRSVFEVDVQSVKKKMKDKAFARSVSRSDITEGAQELGVPLEEHIEFCIKAMQEKAEMLGLKGTTSTAG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.32
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 22.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100757464 3300005329 Bacteria 930
2 Ga0070683_100000019 3300005329 Bacteria 192076
3 Ga0070683_100408505 3300005329 Unclassified 1295
4 Ga0070683_100463722 3300005329 Bacteria 1209
5 Ga0070683_100726905 3300005329 Bacteria 951
6 Ga0070670_100114956 3300005331 Bacteria 2320
7 Ga0070670_101073343 3300005331 Unclassified 734
8 Ga0068869_100101271 3300005334 Bacteria 2179
9 Ga0070666_10004585 3300005335 Bacteria 8429
10 Ga0070666_10167838 3300005335 Bacteria 1536
11 Ga0070680_100387018 3300005336 Bacteria 1191
12 Ga0070682_100465879 3300005337 Bacteria 971
13 Ga0068868_100008457 3300005338 Bacteria 7369
14 Ga0068868_100019672 3300005338 Bacteria 5063
15 Ga0068868_100022824 3300005338 Bacteria 4729
16 Ga0068868_100797367 3300005338 Unclassified 852
17 Ga0070660_100089538 3300005339 Bacteria 2425
18 Ga0070661_100118013 3300005344 Bacteria 1985
19 Ga0070661_100446076 3300005344 Bacteria 1029
20 Ga0070675_100952687 3300005354 Bacteria 787
21 Ga0070675_100971000 3300005354 Bacteria 780
22 Ga0070671_100015718 3300005355 Bacteria 6116
23 Ga0070671_100280282 3300005355 Bacteria 1418
24 Ga0070671_100292147 3300005355 Unclassified 1387
25 Ga0070671_100529437 3300005355 Bacteria 1015
26 Ga0070673_100049194 3300005364 Bacteria 3291
27 Ga0070673_100271794 3300005364 Bacteria 1484
28 Ga0070673_100563168 3300005364 Bacteria 1036
29 Ga0070673_100663920 3300005364 Bacteria 955
30 Ga0070659_100087093 3300005366 Bacteria 2500
31 Ga0070667_100020867 3300005367 Bacteria 5441
32 Ga0070667_100729286 3300005367 Bacteria 918
33 Ga0070709_10285461 3300005434 Bacteria 1201
34 Ga0070714_100000774 3300005435 Bacteria 22670
35 Ga0070714_100153530 3300005435 Bacteria 2077
36 Ga0070714_100721332 3300005435 Bacteria 963
37 Ga0070713_100006449 3300005436 Bacteria 8137
38 Ga0070713_100021559 3300005436 Bacteria 4959
39 Ga0070713_100185901 3300005436 Bacteria 1870
40 Ga0070713_100803119 3300005436 Unclassified 902
41 Ga0070711_100095762 3300005439 Bacteria 2149
42 Ga0070711_100186212 3300005439 Bacteria 1592
43 Ga0070711_100676448 3300005439 Unclassified 867
44 Ga0070694_100139254 3300005444 Bacteria 1761
45 Ga0070694_100290744 3300005444 Bacteria 1249
46 Ga0070708_100114490 3300005445 Bacteria 2481
47 Ga0070663_100326845 3300005455 Bacteria 1235
48 Ga0070678_100392497 3300005456 Unclassified 1204
49 Ga0070681_10019477 3300005458 Bacteria 6793
50 Ga0070681_10055056 3300005458 Bacteria 3962
51 Ga0070681_10146948 3300005458 Bacteria 2286
52 Ga0070681_10194951 3300005458 Bacteria 1945
53 Ga0068867_100121724 3300005459 Unclassified 2017
54 Ga0068867_100687027 3300005459 Bacteria 902
55 Ga0070706_100064804 3300005467 Bacteria 3378
56 Ga0070706_100906694 3300005467 Unclassified 814
57 Ga0070699_100103939 3300005518 Bacteria 2491
58 Ga0070699_100501972 3300005518 Unclassified 1102
59 Ga0070679_100075891 3300005530 Bacteria 3351
60 Ga0070679_100100470 3300005530 Bacteria 2879
61 Ga0070679_100124927 3300005530 Bacteria 2556
62 Ga0070684_100000003 3300005535 Bacteria 248527
63 Ga0070684_100043226 3300005535 Bacteria 3890
64 Ga0070684_100059270 3300005535 Bacteria 3346
65 Ga0070684_100128613 3300005535 Unclassified 2284
66 Ga0070684_100139024 3300005535 Bacteria 2195
67 Ga0070684_100204460 3300005535 Bacteria 1799
68 Ga0070684_100554510 3300005535 Bacteria 1067
69 Ga0070684_100688108 3300005535 Bacteria 953
70 Ga0070697_100426135 3300005536 Bacteria 1153
71 Ga0068853_100072262 3300005539 Unclassified 3006
72 Ga0068853_100136286 3300005539 Bacteria 2201
73 Ga0068853_100318429 3300005539 Unclassified 1441
74 Ga0070695_100103499 3300005545 Bacteria 1921
75 Ga0070696_100026598 3300005546 Bacteria 3936
76 Ga0070693_100022552 3300005547 Bacteria 3350
77 Ga0070665_100043359 3300005548 Unclassified 4521
78 Ga0070665_100536575 3300005548 Bacteria 1182
79 Ga0068855_100000440 3300005563 Bacteria 51346
80 Ga0068855_100002762 3300005563 Bacteria 21617
81 Ga0068855_100062854 3300005563 Bacteria 4334
82 Ga0068855_100367731 3300005563 Unclassified 1581
83 Ga0068855_101544855 3300005563 Unclassified 680
84 Ga0070664_100039347 3300005564 Unclassified 3984
85 Ga0068857_100059778 3300005577 Bacteria 3386
86 Ga0068857_100314086 3300005577 Bacteria 1446
87 Ga0068857_100342892 3300005577 Bacteria 1382
88 Ga0068854_100006079 3300005578 Bacteria 7658
89 Ga0068856_100000314 3300005614 Bacteria 53174
90 Ga0068856_100664067 3300005614 Unclassified 1063
91 Ga0068856_100899251 3300005614 Bacteria 904
92 Ga0068852_100179739 3300005616 Unclassified 1989
93 Ga0068859_100023381 3300005617 Bacteria 6203
94 Ga0068859_100181075 3300005617 Unclassified 2190
95 Ga0068859_100238163 3300005617 Unclassified 1908
96 Ga0068859_100604514 3300005617 Unclassified 1190
97 Ga0068859_100743477 3300005617 Unclassified 1070
98 Ga0068866_10084449 3300005718 Bacteria 1713
99 Ga0068866_10612490 3300005718 Unclassified 737
100 Ga0068863_100002501 3300005841 Bacteria 18276
101 Ga0068863_100019199 3300005841 Bacteria 6544
102 Ga0068863_100060633 3300005841 Bacteria 3577
103 Ga0068863_100082956 3300005841 Bacteria 3037
104 Ga0068863_100546176 3300005841 Bacteria 1144
105 Ga0068863_100571950 3300005841 Bacteria 1117
106 Ga0068858_100008538 3300005842 Bacteria 9841
107 Ga0068858_100063649 3300005842 Bacteria 3413
108 Ga0068858_100244043 3300005842 Bacteria 1705
109 Ga0068858_100630206 3300005842 Bacteria 1041
110 Ga0068858_100715108 3300005842 Unclassified 975
111 Ga0068858_101124892 3300005842 Bacteria 771
112 Ga0068860_100011418 3300005843 Bacteria 8751
113 Ga0068860_100257080 3300005843 Bacteria 1702
114 Ga0068860_100364685 3300005843 Bacteria 1424
115 Ga0068862_100109282 3300005844 Unclassified 2426
116 Ga0070717_10062092 3300006028 Bacteria 3098
117 Ga0070717_10512534 3300006028 Bacteria 1085
118 Ga0070717_10654748 3300006028 Bacteria 954
119 Ga0070717_10725316 3300006028 Bacteria 903
120 Ga0070716_100448354 3300006173 Bacteria 940
121 Ga0070712_100111895 3300006175 Bacteria 2039
122 Ga0097621_100000088 3300006237 Bacteria 49698
123 Ga0097621_100017005 3300006237 Bacteria 5515
124 Ga0097621_100032353 3300006237 Bacteria 4156
125 Ga0097621_100040743 3300006237 Unclassified 3736
126 Ga0097621_100473867 3300006237 Bacteria 1131
127 Ga0097621_100537351 3300006237 Bacteria 1063
128 Ga0068871_100000047 3300006358 Bacteria 66864
129 Ga0068871_100003608 3300006358 Bacteria 10632
130 Ga0068871_100026585 3300006358 Bacteria 4517
131 Ga0068871_100041888 3300006358 Unclassified 3673
132 Ga0068871_100108312 3300006358 Unclassified 2335
133 Ga0068871_100462431 3300006358 Bacteria 1139
134 Ga0075430_100264511 3300006846 Unclassified 1424
135 Ga0075430_100296302 3300006846 Unclassified 1338
136 Ga0068865_100067046 3300006881 Unclassified 2534
137 Ga0075436_100002682 3300006914 Bacteria 12246
138 Ga0097620_100023380 3300006931 Bacteria 6203
139 Ga0097620_100181078 3300006931 Unclassified 2190
140 Ga0097620_100238159 3300006931 Unclassified 1908
141 Ga0097620_100604511 3300006931 Unclassified 1190
142 Ga0097620_100743608 3300006931 Unclassified 1070
143 Ga0105240_10001633 3300009093 Bacteria 38062
144 Ga0105240_10005473 3300009093 Bacteria 18926
145 Ga0105240_10120416 3300009093 Unclassified 3161
146 Ga0105240_10164524 3300009093 Bacteria 2632
147 Ga0105240_10173636 3300009093 Bacteria 2550
148 Ga0105240_10300262 3300009093 Unclassified 1837
149 Ga0111539_10294247 3300009094 Bacteria 1889
150 Ga0105245_10006147 3300009098 Bacteria 10567
151 Ga0105245_10006618 3300009098 Bacteria 10178
152 Ga0105245_10018829 3300009098 Bacteria 6041
153 Ga0105245_10051739 3300009098 Unclassified 3682
154 Ga0105245_10317236 3300009098 Bacteria 1534
155 Ga0105245_10602853 3300009098 Bacteria 1125
156 Ga0105245_10849952 3300009098 Bacteria 952
157 Ga0105247_10083015 3300009101 Bacteria 2023
158 Ga0105247_10564243 3300009101 Bacteria 839
159 Ga0114129_10110634 3300009147 Bacteria 3792
160 Ga0105243_10084952 3300009148 Unclassified 2593
161 Ga0105243_10375589 3300009148 Unclassified 1313
162 Ga0105241_10027116 3300009174 Bacteria 4264
163 Ga0105241_10041929 3300009174 Bacteria 3460
164 Ga0105241_10067808 3300009174 Unclassified 2762
165 Ga0105241_10183936 3300009174 Bacteria 1735
166 Ga0105242_10025497 3300009176 Unclassified 4679
167 Ga0105242_10658046 3300009176 Bacteria 1020
168 Ga0105242_10845365 3300009176 Unclassified 910
169 Ga0105248_10007001 3300009177 Bacteria 12352
170 Ga0105248_10024865 3300009177 Bacteria 6657
171 Ga0105248_10068846 3300009177 Bacteria 3974
172 Ga0105248_10103634 3300009177 Bacteria 3207
173 Ga0105248_10273440 3300009177 Bacteria 1902
174 Ga0105248_10382719 3300009177 Bacteria 1584
175 Ga0105248_10630738 3300009177 Bacteria 1209
176 Ga0105248_10840793 3300009177 Bacteria 1036
177 Ga0105248_11062840 3300009177 Bacteria 915
178 Ga0105248_11219875 3300009177 Unclassified 850
179 Ga0105248_11718349 3300009177 Unclassified 711
180 Ga0105237_10001870 3300009545 Bacteria 26860
181 Ga0105237_10034110 3300009545 Bacteria 5155
182 Ga0105237_10040493 3300009545 Bacteria 4698
183 Ga0105237_10261616 3300009545 Bacteria 1733
184 Ga0105237_10394564 3300009545 Bacteria 1388
185 Ga0105237_10790551 3300009545 Unclassified 956
186 Ga0105238_10064127 3300009551 Bacteria 3674
187 Ga0105238_10128119 3300009551 Bacteria 2516
188 Ga0105238_10315515 3300009551 Bacteria 1549
189 Ga0105238_10537337 3300009551 Bacteria 1173
190 Ga0105249_11089646 3300009553 Bacteria 869
191 Ga0105239_10002902 3300010375 Bacteria 21410
192 Ga0105239_10040996 3300010375 Bacteria 5074
193 Ga0105239_10103671 3300010375 Bacteria 3148
194 Ga0105239_10121843 3300010375 Bacteria 2897
195 Ga0105239_10362180 3300010375 Bacteria 1638
196 Ga0105239_10634037 3300010375 Bacteria 1220
197 Ga0105239_10700143 3300010375 Unclassified 1158
198 Ga0105239_10860395 3300010375 Unclassified 1040
199 Ga0105239_11161165 3300010375 Bacteria 889
200 Ga0105239_11768983 3300010375 Unclassified 716
201 Ga0105246_10033537 3300011119 Unclassified 3414
202 Ga0157371_10087166 3300013102 Bacteria 2211
203 Ga0157370_10069377 3300013104 Bacteria 3330
204 Ga0157370_10776316 3300013104 Bacteria 872
205 Ga0157370_11127836 3300013104 Unclassified 708
206 Ga0157369_10005695 3300013105 Bacteria 14471
207 Ga0157369_10022119 3300013105 Bacteria 7103
208 Ga0157369_10109710 3300013105 Unclassified 2934
209 Ga0157369_10170082 3300013105 Bacteria 2296
210 Ga0157369_10190915 3300013105 Unclassified 2153
211 Ga0157374_10000989 3300013296 Bacteria 24633
212 Ga0157374_10032646 3300013296 Bacteria 4742
213 Ga0157374_10439547 3300013296 Bacteria 1305
214 Ga0157374_10691591 3300013296 Unclassified 1033
215 Ga0157374_11316320 3300013296 Bacteria 745
216 Ga0157378_10000058 3300013297 Bacteria 96172
217 Ga0157378_10011666 3300013297 Bacteria 7692
218 Ga0157378_10073482 3300013297 Bacteria 3075
219 Ga0157378_10301125 3300013297 Unclassified 1552
220 Ga0157378_10382746 3300013297 Bacteria 1382
221 Ga0163162_10012773 3300013306 Bacteria 8203
222 Ga0163162_10021011 3300013306 Bacteria 6422
223 Ga0163162_10120389 3300013306 Bacteria 2729
224 Ga0163162_10729560 3300013306 Bacteria 1111
225 Ga0163162_10736096 3300013306 Bacteria 1106
226 Ga0163162_10746935 3300013306 Bacteria 1098
227 Ga0157372_10000714 3300013307 Bacteria 36499
228 Ga0157372_10006018 3300013307 Bacteria 12880
229 Ga0157372_10144851 3300013307 Bacteria 2740
230 Ga0157372_10212367 3300013307 Unclassified 2242
231 Ga0157372_10407252 3300013307 Bacteria 1585
232 Ga0157372_10421182 3300013307 Bacteria 1556
233 Ga0157372_10514965 3300013307 Bacteria 1395
234 Ga0157372_11063235 3300013307 Unclassified 937
235 Ga0157372_11813187 3300013307 Unclassified 702
236 Ga0157375_10007165 3300013308 Bacteria 9746
237 Ga0163163_10015037 3300014325 Bacteria 7137
238 Ga0163163_10020101 3300014325 Bacteria 6285
239 Ga0163163_10029719 3300014325 Bacteria 5259
240 Ga0163163_10039585 3300014325 Bacteria 4601
241 Ga0163163_10209297 3300014325 Bacteria 1999
242 Ga0163163_10315412 3300014325 Unclassified 1617
243 Ga0163163_10441311 3300014325 Bacteria 1361
244 Ga0157380_10382876 3300014326 Unclassified 1328
245 Ga0157377_10310642 3300014745 Bacteria 1044
246 Ga0157379_10056822 3300014968 Bacteria 3497
247 Ga0157379_10334379 3300014968 Unclassified 1384
248 Ga0157379_11041001 3300014968 Bacteria 782
249 Ga0157376_10003175 3300014969 Bacteria 11291
250 Ga0157376_10059585 3300014969 Bacteria 3201
251 Ga0157376_10060960 3300014969 Bacteria 3170
252 Ga0157376_10172822 3300014969 Bacteria 1969
253 Ga0157376_10317228 3300014969 Bacteria 1481
254 Ga0157376_10349834 3300014969 Bacteria 1414
255 Ga0157376_10352558 3300014969 Bacteria 1409
256 Ga0157376_10944093 3300014969 Bacteria 883
257 Ga0213876_10099624 3300021384 Bacteria 1540
258 Ga0213875_10001519 3300021388 Bacteria 14919
259 Ga0213875_10015485 3300021388 Bacteria 3710
260 Ga0213875_10044330 3300021388 Bacteria 2089
261 Ga0213875_10272065 3300021388 Unclassified 800
262 Ga0207710_10322434 3300025900 Unclassified 783
263 Ga0207680_10009451 3300025903 Bacteria 4838
264 Ga0207699_10484727 3300025906 Bacteria 891
265 Ga0207645_10407001 3300025907 Bacteria 915
266 Ga0207705_10624256 3300025909 Unclassified 838
267 Ga0207684_10379458 3300025910 Bacteria 1216
268 Ga0207654_10020737 3300025911 Unclassified 3489
269 Ga0207654_10024674 3300025911 Bacteria 3235
270 Ga0207654_10106167 3300025911 Bacteria 1739
271 Ga0207707_10010518 3300025912 Bacteria 8030
272 Ga0207707_10010607 3300025912 Bacteria 8001
273 Ga0207707_10141194 3300025912 Bacteria 2106
274 Ga0207707_10340650 3300025912 Bacteria 1293
275 Ga0207695_10003653 3300025913 Bacteria 21487
276 Ga0207695_10005758 3300025913 Bacteria 16314
277 Ga0207695_10018423 3300025913 Bacteria 8075
278 Ga0207695_10024176 3300025913 Bacteria 6844
279 Ga0207695_10031066 3300025913 Bacteria 5869
280 Ga0207695_10130177 3300025913 Unclassified 2474
281 Ga0207671_10026852 3300025914 Bacteria 4307
282 Ga0207671_10115240 3300025914 Bacteria 2049
283 Ga0207671_10516127 3300025914 Unclassified 953
284 Ga0207663_10341896 3300025916 Unclassified 1130
285 Ga0207660_10469699 3300025917 Bacteria 1019
286 Ga0207662_10706287 3300025918 Unclassified 707
287 Ga0207657_10008775 3300025919 Bacteria 10232
288 Ga0207657_10069272 3300025919 Bacteria 2994
289 Ga0207657_10136802 3300025919 Bacteria 2004
290 Ga0207657_10303127 3300025919 Bacteria 1265
291 Ga0207652_10096699 3300025921 Bacteria 2602
292 Ga0207652_10109787 3300025921 Bacteria 2446
293 Ga0207652_10229028 3300025921 Bacteria 1675
294 Ga0207694_10048994 3300025924 Bacteria 3269
295 Ga0207694_10056398 3300025924 Unclassified 3051
296 Ga0207694_10148877 3300025924 Bacteria 1885
297 Ga0207694_10210146 3300025924 Bacteria 1585
298 Ga0207687_10007444 3300025927 Bacteria 7208
299 Ga0207687_10015018 3300025927 Bacteria 5072
300 Ga0207687_10092067 3300025927 Bacteria 2213
301 Ga0207687_10371553 3300025927 Bacteria 1169
302 Ga0207687_10406217 3300025927 Bacteria 1121
303 Ga0207700_10005985 3300025928 Bacteria 7319
304 Ga0207664_10060843 3300025929 Bacteria 3011
305 Ga0207644_10050653 3300025931 Bacteria 2978
306 Ga0207644_10459479 3300025931 Bacteria 1047
307 Ga0207644_10775243 3300025931 Unclassified 802
308 Ga0207690_10304624 3300025932 Bacteria 1248
309 Ga0207686_10009263 3300025934 Bacteria 5339
310 Ga0207686_10248872 3300025934 Bacteria 1297
311 Ga0207709_10184618 3300025935 Bacteria 1476
312 Ga0207709_10203405 3300025935 Unclassified 1416
313 Ga0207704_10110144 3300025938 Unclassified 1859
314 Ga0207711_10003923 3300025941 Bacteria 12800
315 Ga0207711_10028240 3300025941 Bacteria 4720
316 Ga0207711_10959850 3300025941 Bacteria 794
317 Ga0207711_11168490 3300025941 Unclassified 711
318 Ga0207711_11320300 3300025941 Unclassified 664
319 Ga0207689_11008472 3300025942 Bacteria 702
320 Ga0207661_10000019 3300025944 Bacteria 235900
321 Ga0207661_10244276 3300025944 Bacteria 1594
322 Ga0207661_10670330 3300025944 Bacteria 953
323 Ga0207661_10900523 3300025944 Unclassified 815
324 Ga0207679_10799160 3300025945 Unclassified 860
325 Ga0207667_10006346 3300025949 Bacteria 14333
326 Ga0207667_10011938 3300025949 Bacteria 10058
327 Ga0207667_10572924 3300025949 Unclassified 1140
328 Ga0207667_10591601 3300025949 Bacteria 1119
329 Ga0207658_10035053 3300025986 Unclassified 3592
330 Ga0207658_10181686 3300025986 Bacteria 1741
331 Ga0207658_10716172 3300025986 Bacteria 905
332 Ga0207677_10003870 3300026023 Bacteria 7975
333 Ga0207677_10030951 3300026023 Unclassified 3423
334 Ga0207677_10085279 3300026023 Bacteria 2279
335 Ga0207703_10032436 3300026035 Bacteria 4135
336 Ga0207703_10128915 3300026035 Bacteria 2182
337 Ga0207703_10519635 3300026035 Bacteria 1120
338 Ga0207639_10075322 3300026041 Unclassified 2653
339 Ga0207639_10998784 3300026041 Unclassified 784
340 Ga0207702_10441072 3300026078 Bacteria 1262
341 Ga0207702_10534448 3300026078 Bacteria 1145
342 Ga0207702_10601789 3300026078 Bacteria 1079
343 Ga0207702_10725340 3300026078 Unclassified 980
344 Ga0207641_10010572 3300026088 Bacteria 7572
345 Ga0207641_10080289 3300026088 Bacteria 2829
346 Ga0207641_10323572 3300026088 Bacteria 1463
347 Ga0207641_10464513 3300026088 Bacteria 1225
348 Ga0207641_10643036 3300026088 Bacteria 1041
349 Ga0207648_10027118 3300026089 Bacteria 5088
350 Ga0207674_10004166 3300026116 Bacteria 17490
351 Ga0207674_10075141 3300026116 Unclassified 3389
352 Ga0207674_10081134 3300026116 Unclassified 3245
353 Ga0207674_10094122 3300026116 Bacteria 2983
354 Ga0207674_10409692 3300026116 Unclassified 1310
355 Ga0207674_10427033 3300026116 Bacteria 1281
356 Ga0207683_10179344 3300026121 Bacteria 1920
357 Ga0207698_10595377 3300026142 Unclassified 1089
358 Ga0268265_10229055 3300028380 Unclassified 1632
359 Ga0268264_10013523 3300028381 Bacteria 6722
360 Ga0268264_10409338 3300028381 Bacteria 1305
361 Ga0265332_10081082 3300031238 Bacteria 1376
362 Ga0265325_10019024 3300031241 Unclassified 3804
363 Ga0265331_10046842 3300031250 Unclassified 2083
364 Ga0265327_10334739 3300031251 Bacteria 663
365 Ga0265316_10002721 3300031344 Bacteria 18144
366 Ga0265316_10039028 3300031344 Bacteria 3817
367 Ga0265316_10068045 3300031344 Bacteria 2753
368 Ga0265316_10235951 3300031344 Bacteria 1346
369 Ga0265316_10776215 3300031344 Bacteria 673
370 Ga0265314_10000373 3300031711 Bacteria 61369
371 Ga0265314_10018933 3300031711 Bacteria 5343
372 Ga0265342_10264653 3300031712 Unclassified 914
373 Ga0373926_0007828 3300035083 Bacteria 3561
374 Ga0373936_0055755 3300035113 Bacteria 1605
375 Ga0373945_0030739 3300035116 Bacteria 1894
376 Ga0373953_0108042 3300035117 Bacteria 1175
377 Ga0373954_0193405 3300035118 Bacteria 999
378 Ga0373943_0016773 3300035170 Bacteria 3346
379 Ga0373955_0357670 3300035172 Bacteria 885
380 Ga0373935_0074937 3300035692 Bacteria 2189
381 Ga0373927_0002121 3300035695 Bacteria 14614
382 Ga0373927_0002895 3300035695 Bacteria 12478
383 Ga0373927_0003161 3300035695 Bacteria 11889
384 Ga0373933_0261766 3300035724 Bacteria 1115
385 Ga0373933_0385641 3300035724 Bacteria 913
386 Ga0373947_0019582 3300035725 Bacteria 3902
387 Ga0373947_0320841 3300035725 Bacteria 1036
388 Ga0373937_0042053 3300036401 Bacteria 4170
389 Ga0373937_0057849 3300036401 Bacteria 3562
390 Ga0373937_0106700 3300036401 Bacteria 2604
391 Ga0373937_0269516 3300036401 Bacteria 1607
392 Ga0373937_0367545 3300036401 Bacteria 1364
393 Ga0373937_0495764 3300036401 Bacteria 1160
394 Ga0373937_0614303 3300036401 Unclassified 1032
395 Ga0373937_0744211 3300036401 Unclassified 928
396 Ga0373925_0000103 3300037068 Bacteria 92575
397 Ga0373925_0056535 3300037068 Bacteria 2939
398 Ga0373925_0398899 3300037068 Bacteria 1122
399 Ga0373925_0487652 3300037068 Unclassified 1011
400 Ga0373925_0520377 3300037068 Unclassified 977
401 Ga0373925_0548558 3300037068 Unclassified 951
402 Ga0436364_0016212 3300037853 Bacteria 11024
403 Ga0436364_0094995 3300037853 Bacteria 5235
404 Ga0436364_0203511 3300037853 Bacteria 5328
405 Ga0436364_0623148 3300037853 Bacteria 15769
406 Ga0436364_0813613 3300037853 Bacteria 13974
407 Ga0436364_1248525 3300037853 Bacteria 923
408 Ga0436364_1474365 3300037853 Bacteria 8504
409 Ga0436365_0615466 3300039437 Bacteria 11462
410 Ga0436365_0965715 3300039437 Bacteria 1664
411 Ga0436365_1271027 3300039437 Bacteria 3216
412 Ga0436365_1835441 3300039437 Unclassified 1746
413 Ga0436363_1050061 3300039450 Unclassified 662
414 Ga0436363_1622622 3300039450 Bacteria 2478
415 Ga0466957_0435883 3300044842 Unclassified 901
416 Ga0451576_0086598 3300045051 Bacteria 3258
417 Ga0451576_1395504 3300045051 Unclassified 729
418 Ga0466967_0133997 3300045976 Unclassified 2303
419 Ga0495651_0054437 3300046462 Bacteria 3077
420 Ga0495651_0055076 3300046462 Bacteria 3057
421 Ga0495651_0168006 3300046462 Bacteria 1565
422 Ga0495651_0277402 3300046462 Bacteria 1134
423 Ga0495651_0357109 3300046462 Bacteria 964
424 Ga0495580_0000698 3300046472 Bacteria 28698
425 Ga0495580_0077910 3300046472 Bacteria 2312
426 Ga0495580_0079747 3300046472 Bacteria 2283
427 Ga0495580_0121421 3300046472 Bacteria 1814
428 Ga0495580_0132574 3300046472 Bacteria 1728
429 Ga0495580_0191177 3300046472 Bacteria 1412
430 Ga0495580_0230693 3300046472 Bacteria 1271
431 Ga0495580_0430946 3300046472 Bacteria 886
432 Ga0495662_0125267 3300046476 Bacteria 1262
433 Ga0495664_0060183 3300046477 Bacteria 2261
434 Ga0495664_0161347 3300046477 Bacteria 1360
435 Ga0495664_0558147 3300046477 Unclassified 682
436 Ga0495594_0017286 3300046499 Bacteria 3809
437 Ga0495594_0447592 3300046499 Bacteria 734
438 Ga0495608_0135065 3300046511 Unclassified 1577
439 Ga0495618_0248998 3300046514 Bacteria 1115
440 Ga0495628_0054179 3300046516 Bacteria 3162
441 Ga0495628_0099045 3300046516 Bacteria 2251
442 Ga0495628_0360756 3300046516 Bacteria 1067
443 Ga0495630_0049070 3300046517 Bacteria 3159
444 Ga0495630_0118925 3300046517 Bacteria 2004
445 Ga0495652_0200174 3300046529 Bacteria 1516
446 Ga0495652_0450828 3300046529 Unclassified 901
447 Ga0495665_0226537 3300046531 Unclassified 966
448 Ga0495640_0175650 3300046533 Bacteria 1367
449 Ga0495587_0193658 3300046536 Bacteria 1151
450 Ga0495587_0416663 3300046536 Bacteria 746
451 Ga0495645_0059535 3300046543 Bacteria 2769
452 Ga0495645_0272726 3300046543 Bacteria 1116
453 Ga0495645_0511883 3300046543 Bacteria 749
454 Ga0495667_0022778 3300046559 Bacteria 4219
455 Ga0495667_0087112 3300046559 Unclassified 2025
456 Ga0495635_0039984 3300046663 Bacteria 3242
457 Ga0495635_0246575 3300046663 Bacteria 1205
458 Ga0495588_0227280 3300046674 Bacteria 985
459 Ga0495657_0086780 3300046675 Unclassified 2015
460 Ga0495657_0422502 3300046675 Bacteria 782
461 Ga0495599_0031903 3300046678 Bacteria 3307
462 Ga0495599_0403323 3300046678 Unclassified 814
463 Ga0495623_0048820 3300046679 Bacteria 2683
464 Ga0495623_0083489 3300046679 Bacteria 1973
465 Ga0495646_0058393 3300046680 Bacteria 2307
466 Ga0495669_0180512 3300046684 Bacteria 1006
467 Ga0495581_0167772 3300047315 Unclassified 1284
468 Ga0495636_0019351 3300047318 Bacteria 2737
469 Ga0495674_0012633 3300047319 Bacteria 7957
470 Ga0495674_0092203 3300047319 Bacteria 2587
471 Ga0495674_0114155 3300047319 Bacteria 2287
472 Ga0495680_0055897 3300047322 Unclassified 3059
473 Ga0495680_0452773 3300047322 Bacteria 878
474 Ga0495675_0025475 3300047444 Bacteria 3771
475 Ga0495675_0114499 3300047444 Bacteria 1682
476 Ga0495684_0059180 3300047471 Bacteria 2918
477 Ga0495684_0101270 3300047471 Bacteria 2177
478 Ga0495684_0116867 3300047471 Bacteria 2011
479 Ga0495684_0178350 3300047471 Bacteria 1576
480 Ga0495684_0361271 3300047471 Bacteria 1028
481 Ga0495684_0366007 3300047471 Bacteria 1020
482 Ga0495602_0017660 3300048088 Bacteria 7147
483 Ga0495602_0110918 3300048088 Bacteria 2229
484 Ga0496104_0422872 3300048907 Bacteria 1244
485 Ga0496108_0325711 3300048911 Bacteria 1339
486 Ga0496109_0027925 3300048912 Bacteria 5044
487 Ga0496110_0277972 3300048913 Unclassified 1525
488 Ga0496112_0010633 3300048915 Bacteria 8358
489 Ga0496112_0985661 3300048915 Unclassified 763
490 Ga0496113_0061546 3300048916 Bacteria 2833
491 Ga0496114_0245485 3300048917 Bacteria 1575
492 Ga0496115_0012859 3300048918 Bacteria 6312
493 Ga0496115_0106706 3300048918 Bacteria 2300
494 Ga0496115_0425721 3300048918 Bacteria 1075
495 Ga0496115_0785526 3300048918 Unclassified 742
496 Ga0501031_0084472 3300049568 Bacteria 2069
497 Ga0501032_0022985 3300049569 Bacteria 4316
498 Ga0501034_0370869 3300049571 Bacteria 1357
499 Ga0501036_0002362 3300049572 Bacteria 14758
500 Ga0501037_0033961 3300049573 Bacteria 3766
501 Ga0501038_0001714 3300049574 Bacteria 20367
502 Ga0501043_0001558 3300049579 Bacteria 19956
503 Ga0501046_0084224 3300049580 Bacteria 2452
504 Ga0501067_0029191 3300049583 Bacteria 3056
505 Ga0501068_0000078 3300049584 Bacteria 39422
506 Ga0501069_0025651 3300049585 Bacteria 3223
507 Ga0501072_0011048 3300049588 Bacteria 6890
508 Ga0501072_0550965 3300049588 Bacteria 911
509 Ga0501077_0009260 3300049593 Bacteria 6115
510 Ga0501079_0004247 3300049741 Bacteria 10626
511 Ga0501080_0000442 3300049742 Bacteria 32157
512 nmdc:mga0qj67_247239_c1 3300050509 Unclassified 1447
513 nmdc:mga06r32_89699_c1 3300050510 Bacteria 3002
514 nmdc:mga08y16_267917_c1 3300050511 Bacteria 1763
515 Ga0495612_0282530 3300053078 Unclassified 742
516 Ga0501084_0011993 3300054114 Bacteria 7176
517 Ga0501082_0000439 3300060353 Bacteria 36880
518 Ga0501082_0003190 3300060353 Bacteria 14302
519 Ga0070683_100757464
520 Ga0070683_100000019
521 Ga0070683_100408505
522 Ga0070683_100463722
523 Ga0070683_100726905
524 Ga0070670_100114956
525 Ga0070670_101073343
526 Ga0068869_100101271
527 Ga0070666_10004585
528 Ga0070666_10167838
529 Ga0070680_100387018
530 Ga0070682_100465879
531 Ga0068868_100008457
532 Ga0068868_100019672
533 Ga0068868_100022824
534 Ga0068868_100797367
535 Ga0070660_100089538
536 Ga0070661_100118013
537 Ga0070661_100446076
538 Ga0070675_100952687
539 Ga0070675_100971000
540 Ga0070671_100015718
541 Ga0070671_100280282
542 Ga0070671_100292147
543 Ga0070671_100529437
544 Ga0070673_100049194
545 Ga0070673_100271794
546 Ga0070673_100563168
547 Ga0070673_100663920
548 Ga0070659_100087093
549 Ga0070667_100020867
550 Ga0070667_100729286
551 Ga0070709_10285461
552 Ga0070714_100000774
553 Ga0070714_100153530
554 Ga0070714_100721332
555 Ga0070713_100006449
556 Ga0070713_100021559
557 Ga0070713_100185901
558 Ga0070713_100803119
559 Ga0070711_100095762
560 Ga0070711_100186212
561 Ga0070711_100676448
562 Ga0070694_100139254
563 Ga0070694_100290744
564 Ga0070708_100114490
565 Ga0070663_100326845
566 Ga0070678_100392497
567 Ga0070681_10019477
568 Ga0070681_10055056
569 Ga0070681_10146948
570 Ga0070681_10194951
571 Ga0068867_100121724
572 Ga0068867_100687027
573 Ga0070706_100064804
574 Ga0070706_100906694
575 Ga0070699_100103939
576 Ga0070699_100501972
577 Ga0070679_100075891
578 Ga0070679_100100470
579 Ga0070679_100124927
580 Ga0070684_100000003
581 Ga0070684_100043226
582 Ga0070684_100059270
583 Ga0070684_100128613
584 Ga0070684_100139024
585 Ga0070684_100204460
586 Ga0070684_100554510
587 Ga0070684_100688108
588 Ga0070697_100426135
589 Ga0068853_100072262
590 Ga0068853_100136286
591 Ga0068853_100318429
592 Ga0070695_100103499
593 Ga0070696_100026598
594 Ga0070693_100022552
595 Ga0070665_100043359
596 Ga0070665_100536575
597 Ga0068855_100000440
598 Ga0068855_100002762
599 Ga0068855_100062854
600 Ga0068855_100367731
601 Ga0068855_101544855
602 Ga0070664_100039347
603 Ga0068857_100059778
604 Ga0068857_100314086
605 Ga0068857_100342892
606 Ga0068854_100006079
607 Ga0068856_100000314
608 Ga0068856_100664067
609 Ga0068856_100899251
610 Ga0068852_100179739
611 Ga0068859_100023381
612 Ga0068859_100181075
613 Ga0068859_100238163
614 Ga0068859_100604514
615 Ga0068859_100743477
616 Ga0068866_10084449
617 Ga0068866_10612490
618 Ga0068863_100002501
619 Ga0068863_100019199
620 Ga0068863_100060633
621 Ga0068863_100082956
622 Ga0068863_100546176
623 Ga0068863_100571950
624 Ga0068858_100008538
625 Ga0068858_100063649
626 Ga0068858_100244043
627 Ga0068858_100630206
628 Ga0068858_100715108
629 Ga0068858_101124892
630 Ga0068860_100011418
631 Ga0068860_100257080
632 Ga0068860_100364685
633 Ga0068862_100109282
634 Ga0070717_10062092
635 Ga0070717_10512534
636 Ga0070717_10654748
637 Ga0070717_10725316
638 Ga0070716_100448354
639 Ga0070712_100111895
640 Ga0097621_100000088
641 Ga0097621_100017005
642 Ga0097621_100032353
643 Ga0097621_100040743
644 Ga0097621_100473867
645 Ga0097621_100537351
646 Ga0068871_100000047
647 Ga0068871_100003608
648 Ga0068871_100026585
649 Ga0068871_100041888
650 Ga0068871_100108312
651 Ga0068871_100462431
652 Ga0075430_100264511
653 Ga0075430_100296302
654 Ga0068865_100067046
655 Ga0075436_100002682
656 Ga0097620_100023380
657 Ga0097620_100181078
658 Ga0097620_100238159
659 Ga0097620_100604511
660 Ga0097620_100743608
661 Ga0105240_10001633
662 Ga0105240_10005473
663 Ga0105240_10120416
664 Ga0105240_10164524
665 Ga0105240_10173636
666 Ga0105240_10300262
667 Ga0111539_10294247
668 Ga0105245_10006147
669 Ga0105245_10006618
670 Ga0105245_10018829
671 Ga0105245_10051739
672 Ga0105245_10317236
673 Ga0105245_10602853
674 Ga0105245_10849952
675 Ga0105247_10083015
676 Ga0105247_10564243
677 Ga0114129_10110634
678 Ga0105243_10084952
679 Ga0105243_10375589
680 Ga0105241_10027116
681 Ga0105241_10041929
682 Ga0105241_10067808
683 Ga0105241_10183936
684 Ga0105242_10025497
685 Ga0105242_10658046
686 Ga0105242_10845365
687 Ga0105248_10007001
688 Ga0105248_10024865
689 Ga0105248_10068846
690 Ga0105248_10103634
691 Ga0105248_10273440
692 Ga0105248_10382719
693 Ga0105248_10630738
694 Ga0105248_10840793
695 Ga0105248_11062840
696 Ga0105248_11219875
697 Ga0105248_11718349
698 Ga0105237_10001870
699 Ga0105237_10034110
700 Ga0105237_10040493
701 Ga0105237_10261616
702 Ga0105237_10394564
703 Ga0105237_10790551
704 Ga0105238_10064127
705 Ga0105238_10128119
706 Ga0105238_10315515
707 Ga0105238_10537337
708 Ga0105249_11089646
709 Ga0105239_10002902
710 Ga0105239_10040996
711 Ga0105239_10103671
712 Ga0105239_10121843
713 Ga0105239_10362180
714 Ga0105239_10634037
715 Ga0105239_10700143
716 Ga0105239_10860395
717 Ga0105239_11161165
718 Ga0105239_11768983
719 Ga0105246_10033537
720 Ga0157371_10087166
721 Ga0157370_10069377
722 Ga0157370_10776316
723 Ga0157370_11127836
724 Ga0157369_10005695
725 Ga0157369_10022119
726 Ga0157369_10109710
727 Ga0157369_10170082
728 Ga0157369_10190915
729 Ga0157374_10000989
730 Ga0157374_10032646
731 Ga0157374_10439547
732 Ga0157374_10691591
733 Ga0157374_11316320
734 Ga0157378_10000058
735 Ga0157378_10011666
736 Ga0157378_10073482
737 Ga0157378_10301125
738 Ga0157378_10382746
739 Ga0163162_10012773
740 Ga0163162_10021011
741 Ga0163162_10120389
742 Ga0163162_10729560
743 Ga0163162_10736096
744 Ga0163162_10746935
745 Ga0157372_10000714
746 Ga0157372_10006018
747 Ga0157372_10144851
748 Ga0157372_10212367
749 Ga0157372_10407252
750 Ga0157372_10421182
751 Ga0157372_10514965
752 Ga0157372_11063235
753 Ga0157372_11813187
754 Ga0157375_10007165
755 Ga0163163_10015037
756 Ga0163163_10020101
757 Ga0163163_10029719
758 Ga0163163_10039585
759 Ga0163163_10209297
760 Ga0163163_10315412
761 Ga0163163_10441311
762 Ga0157380_10382876
763 Ga0157377_10310642
764 Ga0157379_10056822
765 Ga0157379_10334379
766 Ga0157379_11041001
767 Ga0157376_10003175
768 Ga0157376_10059585
769 Ga0157376_10060960
770 Ga0157376_10172822
771 Ga0157376_10317228
772 Ga0157376_10349834
773 Ga0157376_10352558
774 Ga0157376_10944093
775 Ga0213876_10099624
776 Ga0213875_10001519
777 Ga0213875_10015485
778 Ga0213875_10044330
779 Ga0213875_10272065
780 Ga0207710_10322434
781 Ga0207680_10009451
782 Ga0207699_10484727
783 Ga0207645_10407001
784 Ga0207705_10624256
785 Ga0207684_10379458
786 Ga0207654_10020737
787 Ga0207654_10024674
788 Ga0207654_10106167
789 Ga0207707_10010518
790 Ga0207707_10010607
791 Ga0207707_10141194
792 Ga0207707_10340650
793 Ga0207695_10003653
794 Ga0207695_10005758
795 Ga0207695_10018423
796 Ga0207695_10024176
797 Ga0207695_10031066
798 Ga0207695_10130177
799 Ga0207671_10026852
800 Ga0207671_10115240
801 Ga0207671_10516127
802 Ga0207663_10341896
803 Ga0207660_10469699
804 Ga0207662_10706287
805 Ga0207657_10008775
806 Ga0207657_10069272
807 Ga0207657_10136802
808 Ga0207657_10303127
809 Ga0207652_10096699
810 Ga0207652_10109787
811 Ga0207652_10229028
812 Ga0207694_10048994
813 Ga0207694_10056398
814 Ga0207694_10148877
815 Ga0207694_10210146
816 Ga0207687_10007444
817 Ga0207687_10015018
818 Ga0207687_10092067
819 Ga0207687_10371553
820 Ga0207687_10406217
821 Ga0207700_10005985
822 Ga0207664_10060843
823 Ga0207644_10050653
824 Ga0207644_10459479
825 Ga0207644_10775243
826 Ga0207690_10304624
827 Ga0207686_10009263
828 Ga0207686_10248872
829 Ga0207709_10184618
830 Ga0207709_10203405
831 Ga0207704_10110144
832 Ga0207711_10003923
833 Ga0207711_10028240
834 Ga0207711_10959850
835 Ga0207711_11168490
836 Ga0207711_11320300
837 Ga0207689_11008472
838 Ga0207661_10000019
839 Ga0207661_10244276
840 Ga0207661_10670330
841 Ga0207661_10900523
842 Ga0207679_10799160
843 Ga0207667_10006346
844 Ga0207667_10011938
845 Ga0207667_10572924
846 Ga0207667_10591601
847 Ga0207658_10035053
848 Ga0207658_10181686
849 Ga0207658_10716172
850 Ga0207677_10003870
851 Ga0207677_10030951
852 Ga0207677_10085279
853 Ga0207703_10032436
854 Ga0207703_10128915
855 Ga0207703_10519635
856 Ga0207639_10075322
857 Ga0207639_10998784
858 Ga0207702_10441072
859 Ga0207702_10534448
860 Ga0207702_10601789
861 Ga0207702_10725340
862 Ga0207641_10010572
863 Ga0207641_10080289
864 Ga0207641_10323572
865 Ga0207641_10464513
866 Ga0207641_10643036
867 Ga0207648_10027118
868 Ga0207674_10004166
869 Ga0207674_10075141
870 Ga0207674_10081134
871 Ga0207674_10094122
872 Ga0207674_10409692
873 Ga0207674_10427033
874 Ga0207683_10179344
875 Ga0207698_10595377
876 Ga0268265_10229055
877 Ga0268264_10013523
878 Ga0268264_10409338
879 Ga0265332_10081082
880 Ga0265325_10019024
881 Ga0265331_10046842
882 Ga0265327_10334739
883 Ga0265316_10002721
884 Ga0265316_10039028
885 Ga0265316_10068045
886 Ga0265316_10235951
887 Ga0265316_10776215
888 Ga0265314_10000373
889 Ga0265314_10018933
890 Ga0265342_10264653
891 Ga0373926_0007828
892 Ga0373936_0055755
893 Ga0373945_0030739
894 Ga0373953_0108042
895 Ga0373954_0193405
896 Ga0373943_0016773
897 Ga0373955_0357670
898 Ga0373935_0074937
899 Ga0373927_0002121
900 Ga0373927_0002895
901 Ga0373927_0003161
902 Ga0373933_0261766
903 Ga0373933_0385641
904 Ga0373947_0019582
905 Ga0373947_0320841
906 Ga0373937_0042053
907 Ga0373937_0057849
908 Ga0373937_0106700
909 Ga0373937_0269516
910 Ga0373937_0367545
911 Ga0373937_0495764
912 Ga0373937_0614303
913 Ga0373937_0744211
914 Ga0373925_0000103
915 Ga0373925_0056535
916 Ga0373925_0398899
917 Ga0373925_0487652
918 Ga0373925_0520377
919 Ga0373925_0548558
920 Ga0436364_0016212
921 Ga0436364_0094995
922 Ga0436364_0203511
923 Ga0436364_0623148
924 Ga0436364_0813613
925 Ga0436364_1248525
926 Ga0436364_1474365
927 Ga0436365_0615466
928 Ga0436365_0965715
929 Ga0436365_1271027
930 Ga0436365_1835441
931 Ga0436363_1050061
932 Ga0436363_1622622
933 Ga0466957_0435883
934 Ga0451576_0086598
935 Ga0451576_1395504
936 Ga0466967_0133997
937 Ga0495651_0054437
938 Ga0495651_0055076
939 Ga0495651_0168006
940 Ga0495651_0277402
941 Ga0495651_0357109
942 Ga0495580_0000698
943 Ga0495580_0077910
944 Ga0495580_0079747
945 Ga0495580_0121421
946 Ga0495580_0132574
947 Ga0495580_0191177
948 Ga0495580_0230693
949 Ga0495580_0430946
950 Ga0495662_0125267
951 Ga0495664_0060183
952 Ga0495664_0161347
953 Ga0495664_0558147
954 Ga0495594_0017286
955 Ga0495594_0447592
956 Ga0495608_0135065
957 Ga0495618_0248998
958 Ga0495628_0054179
959 Ga0495628_0099045
960 Ga0495628_0360756
961 Ga0495630_0049070
962 Ga0495630_0118925
963 Ga0495652_0200174
964 Ga0495652_0450828
965 Ga0495665_0226537
966 Ga0495640_0175650
967 Ga0495587_0193658
968 Ga0495587_0416663
969 Ga0495645_0059535
970 Ga0495645_0272726
971 Ga0495645_0511883
972 Ga0495667_0022778
973 Ga0495667_0087112
974 Ga0495635_0039984
975 Ga0495635_0246575
976 Ga0495588_0227280
977 Ga0495657_0086780
978 Ga0495657_0422502
979 Ga0495599_0031903
980 Ga0495599_0403323
981 Ga0495623_0048820
982 Ga0495623_0083489
983 Ga0495646_0058393
984 Ga0495669_0180512
985 Ga0495581_0167772
986 Ga0495636_0019351
987 Ga0495674_0012633
988 Ga0495674_0092203
989 Ga0495674_0114155
990 Ga0495680_0055897
991 Ga0495680_0452773
992 Ga0495675_0025475
993 Ga0495675_0114499
994 Ga0495684_0059180
995 Ga0495684_0101270
996 Ga0495684_0116867
997 Ga0495684_0178350
998 Ga0495684_0361271
999 Ga0495684_0366007
1000 Ga0495602_0017660
1001 Ga0495602_0110918
1002 Ga0496104_0422872
1003 Ga0496108_0325711
1004 Ga0496109_0027925
1005 Ga0496110_0277972
1006 Ga0496112_0010633
1007 Ga0496112_0985661
1008 Ga0496113_0061546
1009 Ga0496114_0245485
1010 Ga0496115_0012859
1011 Ga0496115_0106706
1012 Ga0496115_0425721
1013 Ga0496115_0785526
1014 Ga0501031_0084472
1015 Ga0501032_0022985
1016 Ga0501034_0370869
1017 Ga0501036_0002362
1018 Ga0501037_0033961
1019 Ga0501038_0001714
1020 Ga0501043_0001558
1021 Ga0501046_0084224
1022 Ga0501067_0029191
1023 Ga0501068_0000078
1024 Ga0501069_0025651
1025 Ga0501072_0011048
1026 Ga0501072_0550965
1027 Ga0501077_0009260
1028 Ga0501079_0004247
1029 Ga0501080_0000442
1030 nmdc:mga0qj67_247239_c1
1031 nmdc:mga06r32_89699_c1
1032 nmdc:mga08y16_267917_c1
1033 Ga0495612_0282530
1034 Ga0501084_0011993
1035 Ga0501082_0000439
1036 Ga0501082_0003190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

59

152

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1c-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.6045 7 183
4s1b-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.5847 7 187
4s1c-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5807 7 183
4s1b-assembly3.cif.gz_D-2 crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.5707 7 182
4s1c-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5672 7 183
ID Description Score Start End Superfamily
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7597 7 125 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7045 5 142 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6362 5 142 1.10.3210.10
2pjqD01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6188 4 86 1.10.472.50
5xnxB01 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5602 4 176 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A7V1H481-F1-model_v4 HAD family hydrolase 1.001 109 184 GO:0016787
AF-A0A3N5RY85-F1-model_v4 HDIG domain-containing protein 0.9994 2 97
AF-A0A7W1YN25-F1-model_v4 HDIG domain-containing protein 0.9939 1 188
AF-A0A7Y8I1J9-F1-model_v4 HAD family hydrolase 0.9913 2 84 GO:0016787
AF-A0A7C2E870-F1-model_v4 HDIG domain-containing protein 0.9909 2 159

Map