F458169

General Info

Members Datasets Scaffolds Average Seq Length
517 223 1034 304

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0030028|Ga0495684_0030028_1268_2338
Length 356
Sequence VIVPLTGVQYEIEAGQYRATVTELGAGLRELAFRGQPLIAGYEADRLPPAGSGQLLAPWPNRVDGGRYVFGGTEYQLALTEPARGNAIHGLTRWAAWTAVQQDASTVRLRSAPHGQQGYPFGLEIEAEYRLDAGAGLQVTVAARNRGSHAAPYGTGSHPYLTVRTPSIDGCELTLPADSWLPLDDRGLPSGPPEPVDGTAFDFRQARVIGTTRLDHALTGLSRGDDGRAWAYLAAPGGPRAGLWAGEGYRWLQVFTGDPLGPDMRRKAVAIEPMTCPPNAFVTADDLLVLEPGEKVTHTSGVSISSGRPVSPHSTSVTSSGRACRNARAPWSPVAAAMTSGQCSRASSTGLRGLPP

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 1.55
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.93
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_0030028 3300047471 Bacteria 4173
2 Ga0070658_10025211 3300005327 Bacteria 4767
3 Ga0070683_100050641 3300005329 Bacteria 3845
4 Ga0070683_100130414 3300005329 Bacteria 2379
5 Ga0070683_100237899 3300005329 Bacteria 1732
6 Ga0070680_100033055 3300005336 Bacteria 4167
7 Ga0070682_100072702 3300005337 Bacteria 2204
8 Ga0068868_100030217 3300005338 Bacteria 4154
9 Ga0070660_100060537 3300005339 Bacteria 2938
10 Ga0070689_100084314 3300005340 Bacteria 2497
11 Ga0070691_10034533 3300005341 Bacteria 2381
12 Ga0070691_10061879 3300005341 Bacteria 1801
13 Ga0070675_100136950 3300005354 Bacteria 2090
14 Ga0070659_100062675 3300005366 Bacteria 2939
15 Ga0070709_10083072 3300005434 Bacteria 2094
16 Ga0070709_10098242 3300005434 Bacteria 1945
17 Ga0070709_10106699 3300005434 Bacteria 1876
18 Ga0070714_100004251 3300005435 Bacteria 10787
19 Ga0070714_100011026 3300005435 Bacteria 7158
20 Ga0070714_100014201 3300005435 Bacteria 6395
21 Ga0070714_100017386 3300005435 Bacteria 5825
22 Ga0070714_100021194 3300005435 Bacteria 5315
23 Ga0070714_100117575 3300005435 Bacteria 2361
24 Ga0070713_100009824 3300005436 Bacteria 6881
25 Ga0070713_100012254 3300005436 Bacteria 6281
26 Ga0070713_100056429 3300005436 Bacteria 3267
27 Ga0070713_100060448 3300005436 Bacteria 3167
28 Ga0070713_100092620 3300005436 Bacteria 2602
29 Ga0070713_100160310 3300005436 Bacteria 2007
30 Ga0070713_100379034 3300005436 Bacteria 1317
31 Ga0070710_10000341 3300005437 Bacteria 22161
32 Ga0070710_10000611 3300005437 Bacteria 17012
33 Ga0070710_10010203 3300005437 Bacteria 4609
34 Ga0070710_10013025 3300005437 Bacteria 4149
35 Ga0070710_10039467 3300005437 Bacteria 2598
36 Ga0070710_10060069 3300005437 Bacteria 2161
37 Ga0070710_10106704 3300005437 Bacteria 1676
38 Ga0070711_100012770 3300005439 Bacteria 5257
39 Ga0070711_100017564 3300005439 Bacteria 4558
40 Ga0070711_100027606 3300005439 Bacteria 3728
41 Ga0070711_100132006 3300005439 Bacteria 1861
42 Ga0070705_100082786 3300005440 Bacteria 1975
43 Ga0070705_100219253 3300005440 Bacteria 1316
44 Ga0070694_100265899 3300005444 Bacteria 1302
45 Ga0070708_100000954 3300005445 Bacteria 21925
46 Ga0070708_100011912 3300005445 Bacteria 7083
47 Ga0070708_100018541 3300005445 Bacteria 5825
48 Ga0070708_100092818 3300005445 Bacteria 2751
49 Ga0070663_100036030 3300005455 Bacteria 3436
50 Ga0070663_100054454 3300005455 Bacteria 2859
51 Ga0070678_100182194 3300005456 Bacteria 1720
52 Ga0070662_100186081 3300005457 Bacteria 1640
53 Ga0070681_10053340 3300005458 Bacteria 4029
54 Ga0070681_10553529 3300005458 Bacteria 1064
55 Ga0070685_10043212 3300005466 Bacteria 2576
56 Ga0070706_100016316 3300005467 Bacteria 6861
57 Ga0070706_100024283 3300005467 Bacteria 5579
58 Ga0070706_100041975 3300005467 Bacteria 4224
59 Ga0070706_100057710 3300005467 Bacteria 3582
60 Ga0070706_100059340 3300005467 Bacteria 3530
61 Ga0070706_100064134 3300005467 Bacteria 3395
62 Ga0070707_100013776 3300005468 Bacteria 7572
63 Ga0070707_100083601 3300005468 Bacteria 3085
64 Ga0070707_100093787 3300005468 Bacteria 2906
65 Ga0070707_100239384 3300005468 Bacteria 1766
66 Ga0070707_100308616 3300005468 Bacteria 1538
67 Ga0070698_100000223 3300005471 Bacteria 55997
68 Ga0070698_100004633 3300005471 Bacteria 15112
69 Ga0070698_100007801 3300005471 Bacteria 11582
70 Ga0070698_100068757 3300005471 Bacteria 3558
71 Ga0070698_100075963 3300005471 Bacteria 3363
72 Ga0070698_100129751 3300005471 Bacteria 2477
73 Ga0070698_100146632 3300005471 Bacteria 2309
74 Ga0070698_100455497 3300005471 Bacteria 1215
75 Ga0070699_100006399 3300005518 Bacteria 10256
76 Ga0070699_100164970 3300005518 Bacteria 1962
77 Ga0070699_100238907 3300005518 Bacteria 1621
78 Ga0070679_100017065 3300005530 Bacteria 7018
79 Ga0070679_100136739 3300005530 Bacteria 2431
80 Ga0070684_100015323 3300005535 Bacteria 6239
81 Ga0070684_100341517 3300005535 Bacteria 1376
82 Ga0070697_100007005 3300005536 Bacteria 8765
83 Ga0070697_100010436 3300005536 Bacteria 7249
84 Ga0070686_100086262 3300005544 Bacteria 2090
85 Ga0070695_100035030 3300005545 Bacteria 3151
86 Ga0068857_100159444 3300005577 Bacteria 2047
87 Ga0068854_100050883 3300005578 Bacteria 2966
88 Ga0068856_100084457 3300005614 Bacteria 3154
89 Ga0068856_100356414 3300005614 Bacteria 1481
90 Ga0068856_100568677 3300005614 Bacteria 1155
91 Ga0068859_100422307 3300005617 Bacteria 1429
92 Ga0068864_100072676 3300005618 Bacteria 2998
93 Ga0068863_100207405 3300005841 Bacteria 1886
94 Ga0068858_100181880 3300005842 Bacteria 1985
95 Ga0081540_1002480 3300005983 Bacteria 15030
96 Ga0081540_1005274 3300005983 Bacteria 9671
97 Ga0070717_10002093 3300006028 Bacteria 13991
98 Ga0070717_10004329 3300006028 Bacteria 10243
99 Ga0070717_10063045 3300006028 Bacteria 3075
100 Ga0070717_10071827 3300006028 Bacteria 2888
101 Ga0070717_10099468 3300006028 Bacteria 2468
102 Ga0070717_10105555 3300006028 Bacteria 2398
103 Ga0070717_10106094 3300006028 Bacteria 2392
104 Ga0070717_10162786 3300006028 Bacteria 1936
105 Ga0070717_10499326 3300006028 Bacteria 1099
106 Ga0070716_100039833 3300006173 Bacteria 2610
107 Ga0070716_100109094 3300006173 Bacteria 1712
108 Ga0070716_100110370 3300006173 Bacteria 1703
109 Ga0070716_100119427 3300006173 Bacteria 1648
110 Ga0070712_100003241 3300006175 Bacteria 10030
111 Ga0070712_100014923 3300006175 Bacteria 4994
112 Ga0070712_100067571 3300006175 Bacteria 2543
113 Ga0070712_100082785 3300006175 Bacteria 2328
114 Ga0070712_100091269 3300006175 Bacteria 2232
115 Ga0070712_100264707 3300006175 Bacteria 1379
116 Ga0070712_100395677 3300006175 Bacteria 1140
117 Ga0075433_10053217 3300006852 Bacteria 3528
118 Ga0075434_100007491 3300006871 Bacteria 10099
119 Ga0068865_100071795 3300006881 Bacteria 2457
120 Ga0075436_100040509 3300006914 Bacteria 3215
121 Ga0097620_100422320 3300006931 Bacteria 1429
122 Ga0075435_100055609 3300007076 Bacteria 3196
123 Ga0075435_100079300 3300007076 Bacteria 2694
124 Ga0075435_100314753 3300007076 Bacteria 1339
125 Ga0099794_10046886 3300007265 Unclassified 2071
126 Ga0105240_10098597 3300009093 Bacteria 3558
127 Ga0105240_10378861 3300009093 Bacteria 1598
128 Ga0111539_10446641 3300009094 Bacteria 1506
129 Ga0105248_10250534 3300009177 Bacteria 1993
130 Ga0105248_10726932 3300009177 Bacteria 1120
131 Ga0105238_10096449 3300009551 Bacteria 2943
132 Ga0105249_10256994 3300009553 Bacteria 1734
133 Ga0157373_10078238 3300013100 Bacteria 2332
134 Ga0157371_10056702 3300013102 Bacteria 2779
135 Ga0157370_10061292 3300013104 Bacteria 3571
136 Ga0157369_10092792 3300013105 Bacteria 3223
137 Ga0157369_10109315 3300013105 Bacteria 2940
138 Ga0157369_10225511 3300013105 Bacteria 1960
139 Ga0157378_10222166 3300013297 Bacteria 1796
140 Ga0163163_10155803 3300014325 Bacteria 2329
141 Ga0157380_10600563 3300014326 Bacteria 1089
142 Ga0157377_10040108 3300014745 Bacteria 2592
143 Ga0157379_10088002 3300014968 Bacteria 2785
144 Ga0157379_10405650 3300014968 Bacteria 1253
145 Ga0206356_11299977 3300020070 Bacteria 1417
146 Ga0206356_11331677 3300020070 Bacteria 2548
147 Ga0206354_11015892 3300020081 Bacteria 1250
148 Ga0206353_10357923 3300020082 Bacteria 1932
149 Ga0206353_11756776 3300020082 Bacteria 3372
150 Ga0213875_10000471 3300021388 Bacteria 34498
151 Ga0213875_10016530 3300021388 Bacteria 3576
152 Ga0213875_10099892 3300021388 Unclassified 1354
153 Ga0224712_10020824 3300022467 Bacteria 2234
154 Ga0224712_10071255 3300022467 Bacteria 1412
155 Ga0224712_10093936 3300022467 Bacteria 1261
156 Ga0224572_1019140 3300024225 Bacteria 1316
157 Ga0207653_10014581 3300025885 Bacteria 2466
158 Ga0207692_10001541 3300025898 Bacteria 8660
159 Ga0207692_10024429 3300025898 Bacteria 2810
160 Ga0207692_10050543 3300025898 Bacteria 2103
161 Ga0207688_10007138 3300025901 Bacteria 6075
162 Ga0207699_10000458 3300025906 Bacteria 20841
163 Ga0207699_10003675 3300025906 Bacteria 7326
164 Ga0207699_10010048 3300025906 Bacteria 4733
165 Ga0207699_10073753 3300025906 Bacteria 2094
166 Ga0207645_10114512 3300025907 Bacteria 1747
167 Ga0207705_10167166 3300025909 Bacteria 1655
168 Ga0207705_10250919 3300025909 Bacteria 1349
169 Ga0207684_10015953 3300025910 Bacteria 6456
170 Ga0207684_10023801 3300025910 Bacteria 5227
171 Ga0207684_10032434 3300025910 Bacteria 4441
172 Ga0207684_10042627 3300025910 Bacteria 3848
173 Ga0207684_10056907 3300025910 Bacteria 3318
174 Ga0207684_10075281 3300025910 Bacteria 2869
175 Ga0207684_10179493 3300025910 Unclassified 1825
176 Ga0207707_10469541 3300025912 Bacteria 1075
177 Ga0207693_10002614 3300025915 Bacteria 15647
178 Ga0207693_10006931 3300025915 Bacteria 9359
179 Ga0207693_10016679 3300025915 Bacteria 5867
180 Ga0207693_10026396 3300025915 Bacteria 4597
181 Ga0207693_10072052 3300025915 Bacteria 2705
182 Ga0207693_10092993 3300025915 Bacteria 2363
183 Ga0207693_10147168 3300025915 Bacteria 1852
184 Ga0207693_10364769 3300025915 Bacteria 1130
185 Ga0207663_10019252 3300025916 Bacteria 3841
186 Ga0207663_10042684 3300025916 Bacteria 2772
187 Ga0207663_10042951 3300025916 Bacteria 2765
188 Ga0207663_10136245 3300025916 Bacteria 1704
189 Ga0207663_10149884 3300025916 Bacteria 1635
190 Ga0207660_10170554 3300025917 Bacteria 1684
191 Ga0207657_10014627 3300025919 Bacteria 7645
192 Ga0207657_10026490 3300025919 Bacteria 5327
193 Ga0207652_10010545 3300025921 Bacteria 7438
194 Ga0207652_10130698 3300025921 Bacteria 2239
195 Ga0207646_10005502 3300025922 Bacteria 13316
196 Ga0207646_10042368 3300025922 Bacteria 4089
197 Ga0207646_10148229 3300025922 Bacteria 2115
198 Ga0207646_10247119 3300025922 Bacteria 1611
199 Ga0207694_10291642 3300025924 Bacteria 1342
200 Ga0207700_10001366 3300025928 Bacteria 13833
201 Ga0207700_10009817 3300025928 Bacteria 6002
202 Ga0207700_10012072 3300025928 Bacteria 5550
203 Ga0207700_10026138 3300025928 Bacteria 4066
204 Ga0207700_10050474 3300025928 Bacteria 3100
205 Ga0207700_10051701 3300025928 Bacteria 3068
206 Ga0207700_10131053 3300025928 Bacteria 2047
207 Ga0207700_10141375 3300025928 Bacteria 1978
208 Ga0207700_10157756 3300025928 Bacteria 1882
209 Ga0207700_10178296 3300025928 Bacteria 1777
210 Ga0207700_10256242 3300025928 Bacteria 1496
211 Ga0207700_10565363 3300025928 Bacteria 1010
212 Ga0207664_10000311 3300025929 Bacteria 36120
213 Ga0207664_10002972 3300025929 Bacteria 11259
214 Ga0207664_10003599 3300025929 Bacteria 10367
215 Ga0207664_10014939 3300025929 Bacteria 5622
216 Ga0207664_10021154 3300025929 Bacteria 4832
217 Ga0207664_10094685 3300025929 Bacteria 2455
218 Ga0207664_10108552 3300025929 Bacteria 2304
219 Ga0207664_10126741 3300025929 Bacteria 2144
220 Ga0207664_10149404 3300025929 Bacteria 1984
221 Ga0207706_10117932 3300025933 Bacteria 2334
222 Ga0207704_10064196 3300025938 Bacteria 2293
223 Ga0207665_10000215 3300025939 Bacteria 38950
224 Ga0207665_10021179 3300025939 Bacteria 4273
225 Ga0207665_10090415 3300025939 Bacteria 2121
226 Ga0207665_10140550 3300025939 Bacteria 1721
227 Ga0207689_10022096 3300025942 Bacteria 5350
228 Ga0207661_10047982 3300025944 Bacteria 3392
229 Ga0207661_10135001 3300025944 Bacteria 2118
230 Ga0207661_10143979 3300025944 Bacteria 2054
231 Ga0207712_10131577 3300025961 Bacteria 1907
232 Ga0207640_10035769 3300025981 Bacteria 3111
233 Ga0207678_10001012 3300026067 Bacteria 25636
234 Ga0207678_10072890 3300026067 Bacteria 2943
235 Ga0207708_10130103 3300026075 Bacteria 1968
236 Ga0207648_10128087 3300026089 Bacteria 2233
237 Ga0207674_10040759 3300026116 Bacteria 4808
238 Ga0207674_10086389 3300026116 Bacteria 3132
239 Ga0207674_10262138 3300026116 Bacteria 1676
240 Ga0207683_10015016 3300026121 Bacteria 6591
241 Ga0207683_10281046 3300026121 Bacteria 1521
242 Ga0268266_10119497 3300028379 Bacteria 2344
243 Ga0265337_1000705 3300028556 Bacteria 17624
244 Ga0265319_1002204 3300028563 Bacteria 10846
245 Ga0265334_10001922 3300028573 Bacteria 9860
246 Ga0265318_10009335 3300028577 Bacteria 4317
247 Ga0265322_10007546 3300028654 Bacteria 3171
248 Ga0265336_10001837 3300028666 Bacteria 9243
249 Ga0265338_10004045 3300028800 Bacteria 20114
250 Ga0265338_10011623 3300028800 Bacteria 10147
251 Ga0265338_10050303 3300028800 Bacteria 3768
252 Ga0265338_10221689 3300028800 Bacteria 1412
253 Ga0265324_10001640 3300029957 Bacteria 12383
254 Ga0265332_10001213 3300031238 Bacteria 14920
255 Ga0265320_10016908 3300031240 Bacteria 4068
256 Ga0265325_10003537 3300031241 Bacteria 10158
257 Ga0265340_10002891 3300031247 Bacteria 9776
258 Ga0265339_10037849 3300031249 Bacteria 2694
259 Ga0265316_10064170 3300031344 Bacteria 2845
260 Ga0307508_10258701 3300031616 Bacteria 1336
261 Ga0265314_10056921 3300031711 Bacteria 2689
262 Ga0265342_10004344 3300031712 Bacteria 11215
263 Ga0316212_1004648 3300033547 Bacteria 1991
264 Ga0373948_0025756 3300034817 Bacteria 1156
265 Ga0373926_0000454 3300035083 Bacteria 10694
266 Ga0373926_0001774 3300035083 Bacteria 6700
267 Ga0373934_0007837 3300035086 Bacteria 3970
268 Ga0373934_0015843 3300035086 Bacteria 2863
269 Ga0373934_0064461 3300035086 Bacteria 1462
270 Ga0373944_0001200 3300035089 Bacteria 6487
271 Ga0373944_0017598 3300035089 Bacteria 2031
272 Ga0373923_0000846 3300035111 Bacteria 8084
273 Ga0373923_0009479 3300035111 Bacteria 3514
274 Ga0373923_0050304 3300035111 Bacteria 1745
275 Ga0373936_0000499 3300035113 Bacteria 13299
276 Ga0373936_0001290 3300035113 Bacteria 9066
277 Ga0373936_0041278 3300035113 Bacteria 1850
278 Ga0373945_0002934 3300035116 Bacteria 5356
279 Ga0373945_0007665 3300035116 Bacteria 3500
280 Ga0373953_0012376 3300035117 Bacteria 3020
281 Ga0373954_0014514 3300035118 Bacteria 3514
282 Ga0373956_0007407 3300035119 Bacteria 4417
283 Ga0373956_0030633 3300035119 Bacteria 2353
284 Ga0373956_0043128 3300035119 Bacteria 2007
285 Ga0373957_0022012 3300035120 Bacteria 2268
286 Ga0373957_0029605 3300035120 Bacteria 2001
287 Ga0373957_0039754 3300035120 Bacteria 1765
288 Ga0373943_0000222 3300035170 Bacteria 23119
289 Ga0373943_0002487 3300035170 Bacteria 8373
290 Ga0373946_0000702 3300035171 Bacteria 11336
291 Ga0373946_0000978 3300035171 Bacteria 9788
292 Ga0373955_0009642 3300035172 Bacteria 4533
293 Ga0373955_0012042 3300035172 Bacteria 4147
294 Ga0373955_0064737 3300035172 Bacteria 2027
295 Ga0373924_0000857 3300035410 Bacteria 9565
296 Ga0373924_0004452 3300035410 Bacteria 4894
297 Ga0373924_0017104 3300035410 Bacteria 2777
298 Ga0373924_0111914 3300035410 Bacteria 1180
299 Ga0373931_0202324 3300035691 Bacteria 1187
300 Ga0373935_0000284 3300035692 Bacteria 24989
301 Ga0373935_0001615 3300035692 Bacteria 12571
302 Ga0373935_0012542 3300035692 Bacteria 5098
303 Ga0373935_0019589 3300035692 Bacteria 4125
304 Ga0373935_0142872 3300035692 Bacteria 1618
305 Ga0373935_0307964 3300035692 Bacteria 1121
306 Ga0373927_0000383 3300035695 Bacteria 34290
307 Ga0373927_0044143 3300035695 Bacteria 2884
308 Ga0373927_0050651 3300035695 Bacteria 2686
309 Ga0373933_0012926 3300035724 Bacteria 4618
310 Ga0373933_0013718 3300035724 Bacteria 4495
311 Ga0373933_0056330 3300035724 Bacteria 2359
312 Ga0373933_0326771 3300035724 Bacteria 995
313 Ga0373947_0000002 3300035725 Bacteria 383924
314 Ga0373947_0000546 3300035725 Bacteria 22043
315 Ga0373937_0057654 3300036401 Bacteria 3568
316 Ga0373937_0192109 3300036401 Bacteria 1918
317 Ga0373937_0342844 3300036401 Bacteria 1415
318 Ga0373925_0000010 3300037068 Bacteria 229059
319 Ga0373925_0001242 3300037068 Bacteria 22486
320 Ga0373925_0048412 3300037068 Bacteria 3167
321 Ga0373925_0079462 3300037068 Bacteria 2492
322 Ga0373925_0137739 3300037068 Bacteria 1908
323 Ga0436364_0050870 3300037853 Bacteria 3676
324 Ga0436364_0180602 3300037853 Bacteria 2646
325 Ga0436364_0238485 3300037853 Bacteria 2489
326 Ga0436364_0238492 3300037853 Bacteria 2002
327 Ga0436364_0358294 3300037853 Bacteria 3366
328 Ga0436364_0658367 3300037853 Bacteria 21323
329 Ga0436364_1127757 3300037853 Bacteria 43348
330 Ga0436365_1391382 3300039437 Bacteria 1374
331 Ga0436360_1271218 3300039438 Bacteria 1117
332 Ga0436363_1287925 3300039450 Bacteria 1005
333 Ga0436362_1236812 3300039453 Bacteria 2167
334 Ga0466961_0102648 3300044693 Bacteria 1801
335 Ga0466963_0044063 3300044694 Bacteria 2936
336 Ga0466963_0052953 3300044694 Bacteria 2694
337 Ga0466963_0137961 3300044694 Bacteria 1688
338 Ga0466968_0033502 3300044735 Bacteria 2141
339 Ga0466957_0329900 3300044842 Bacteria 1031
340 Ga0466959_0077714 3300045049 Bacteria 2395
341 Ga0466958_0148312 3300045836 Bacteria 1479
342 Ga0466967_0084006 3300045976 Bacteria 2880
343 Ga0466967_0102619 3300045976 Bacteria 2617
344 Ga0466967_0425325 3300045976 Bacteria 1295
345 Ga0495592_0043492 3300046454 Bacteria 3360
346 Ga0495592_0057944 3300046454 Bacteria 2858
347 Ga0495629_0005984 3300046459 Bacteria 9045
348 Ga0495629_0093684 3300046459 Bacteria 2096
349 Ga0495641_0006605 3300046461 Bacteria 7471
350 Ga0495641_0007675 3300046461 Bacteria 6695
351 Ga0495641_0012082 3300046461 Bacteria 4861
352 Ga0495651_0013357 3300046462 Bacteria 6352
353 Ga0495651_0015245 3300046462 Bacteria 5941
354 Ga0495651_0031340 3300046462 Bacteria 4146
355 Ga0495651_0059101 3300046462 Bacteria 2940
356 Ga0495651_0071256 3300046462 Bacteria 2642
357 Ga0495653_0011580 3300046463 Bacteria 7200
358 Ga0495653_0037617 3300046463 Bacteria 3800
359 Ga0495653_0037981 3300046463 Bacteria 3780
360 Ga0495653_0039573 3300046463 Bacteria 3692
361 Ga0495580_0028667 3300046472 Bacteria 4046
362 Ga0495582_0003237 3300046473 Bacteria 9147
363 Ga0495582_0048751 3300046473 Bacteria 2332
364 Ga0495639_0001120 3300046475 Bacteria 12111
365 Ga0495662_0000239 3300046476 Bacteria 23143
366 Ga0495662_0015177 3300046476 Bacteria 3742
367 Ga0495664_0002344 3300046477 Bacteria 10143
368 Ga0495664_0002466 3300046477 Bacteria 9960
369 Ga0495664_0027147 3300046477 Bacteria 3337
370 Ga0495664_0108760 3300046477 Bacteria 1672
371 Ga0495594_0002716 3300046499 Bacteria 9180
372 Ga0495608_0025774 3300046511 Bacteria 4013
373 Ga0495608_0108692 3300046511 Bacteria 1783
374 Ga0495618_0003708 3300046514 Bacteria 9461
375 Ga0495618_0004006 3300046514 Bacteria 9083
376 Ga0495618_0010322 3300046514 Bacteria 5651
377 Ga0495618_0012483 3300046514 Bacteria 5160
378 Ga0495618_0123885 3300046514 Bacteria 1655
379 Ga0495618_0162852 3300046514 Bacteria 1421
380 Ga0495628_0063325 3300046516 Bacteria 2898
381 Ga0495628_0069076 3300046516 Bacteria 2755
382 Ga0495628_0329545 3300046516 Bacteria 1125
383 Ga0495628_0359276 3300046516 Bacteria 1069
384 Ga0495630_0002081 3300046517 Bacteria 13915
385 Ga0495630_0002328 3300046517 Bacteria 13211
386 Ga0495630_0128786 3300046517 Bacteria 1921
387 Ga0495652_0009146 3300046529 Bacteria 9006
388 Ga0495652_0039323 3300046529 Bacteria 4090
389 Ga0495652_0097308 3300046529 Bacteria 2394
390 Ga0495665_0000894 3300046531 Bacteria 15661
391 Ga0495665_0003447 3300046531 Bacteria 8592
392 Ga0495665_0052836 3300046531 Bacteria 2150
393 Ga0495640_0005258 3300046533 Bacteria 10291
394 Ga0495640_0010948 3300046533 Bacteria 6989
395 Ga0495640_0049027 3300046533 Bacteria 2914
396 Ga0495640_0076759 3300046533 Bacteria 2229
397 Ga0495586_0002326 3300046535 Bacteria 10334
398 Ga0495586_0015900 3300046535 Bacteria 4003
399 Ga0495587_0004162 3300046536 Bacteria 9575
400 Ga0495587_0036609 3300046536 Bacteria 2951
401 Ga0495587_0048217 3300046536 Bacteria 2522
402 Ga0495645_0008403 3300046543 Bacteria 7212
403 Ga0495645_0038090 3300046543 Bacteria 3506
404 Ga0495645_0055938 3300046543 Bacteria 2864
405 Ga0495645_0080744 3300046543 Bacteria 2334
406 Ga0495645_0225941 3300046543 Bacteria 1256
407 Ga0495667_0026920 3300046559 Bacteria 3875
408 Ga0495667_0057997 3300046559 Bacteria 2543
409 Ga0495667_0065558 3300046559 Bacteria 2375
410 Ga0495667_0075919 3300046559 Bacteria 2186
411 Ga0495667_0134503 3300046559 Bacteria 1594
412 Ga0495634_0010554 3300046642 Bacteria 6763
413 Ga0495634_0015103 3300046642 Bacteria 5550
414 Ga0495634_0046394 3300046642 Bacteria 2932
415 Ga0495635_0000373 3300046663 Bacteria 28369
416 Ga0495635_0016079 3300046663 Bacteria 5225
417 Ga0495635_0033324 3300046663 Bacteria 3573
418 Ga0495635_0040000 3300046663 Bacteria 3241
419 Ga0495635_0055091 3300046663 Bacteria 2739
420 Ga0495657_0007829 3300046675 Bacteria 8199
421 Ga0495657_0027468 3300046675 Bacteria 4015
422 Ga0495657_0031933 3300046675 Bacteria 3678
423 Ga0495657_0115446 3300046675 Bacteria 1696
424 Ga0495599_0010285 3300046678 Bacteria 5725
425 Ga0495599_0109198 3300046678 Bacteria 1723
426 Ga0495599_0142041 3300046678 Bacteria 1489
427 Ga0495599_0150150 3300046678 Bacteria 1443
428 Ga0495599_0157709 3300046678 Bacteria 1403
429 Ga0495623_0014382 3300046679 Bacteria 5122
430 Ga0495623_0057651 3300046679 Bacteria 2443
431 Ga0495623_0060298 3300046679 Bacteria 2380
432 Ga0495646_0011973 3300046680 Bacteria 5518
433 Ga0495646_0060526 3300046680 Bacteria 2258
434 Ga0495647_0019921 3300046681 Bacteria 2403
435 Ga0495658_0001706 3300046683 Bacteria 11419
436 Ga0495658_0005755 3300046683 Bacteria 6090
437 Ga0495658_0023988 3300046683 Bacteria 3244
438 Ga0495613_0000459 3300046689 Bacteria 34915
439 Ga0495613_0032161 3300046689 Bacteria 3896
440 Ga0495600_0023998 3300046809 Bacteria 3926
441 Ga0495600_0051326 3300046809 Bacteria 2692
442 Ga0495600_0059052 3300046809 Bacteria 2505
443 Ga0495600_0071115 3300046809 Bacteria 2273
444 Ga0495600_0210642 3300046809 Bacteria 1245
445 Ga0495581_0001745 3300047315 Bacteria 12126
446 Ga0495581_0035578 3300047315 Bacteria 2881
447 Ga0495604_0005987 3300047317 Bacteria 9655
448 Ga0495604_0015198 3300047317 Bacteria 6145
449 Ga0495604_0021178 3300047317 Bacteria 5189
450 Ga0495604_0094473 3300047317 Bacteria 2210
451 Ga0495674_0001403 3300047319 Bacteria 23570
452 Ga0495674_0083629 3300047319 Bacteria 2735
453 Ga0495674_0102757 3300047319 Bacteria 2430
454 Ga0495674_0146207 3300047319 Bacteria 1984
455 Ga0495674_0227947 3300047319 Bacteria 1538
456 Ga0495676_0005425 3300047321 Bacteria 11697
457 Ga0495676_0006002 3300047321 Bacteria 11158
458 Ga0495680_0017890 3300047322 Bacteria 6032
459 Ga0495680_0030178 3300047322 Bacteria 4429
460 Ga0495680_0050710 3300047322 Bacteria 3243
461 Ga0495680_0145616 3300047322 Bacteria 1730
462 Ga0495675_0020121 3300047444 Bacteria 4241
463 Ga0495675_0072778 3300047444 Bacteria 2168
464 Ga0495675_0205818 3300047444 Bacteria 1196
465 Ga0495684_0003049 3300047471 Bacteria 13176
466 Ga0495684_0005057 3300047471 Bacteria 10296
467 Ga0495684_0021755 3300047471 Bacteria 4937
468 Ga0495684_0023456 3300047471 Bacteria 4743
469 Ga0495684_0052413 3300047471 Bacteria 3113
470 Ga0495684_0119189 3300047471 Bacteria 1988
471 Ga0495593_0017936 3300047673 Bacteria 3983
472 Ga0495602_0037501 3300048088 Bacteria 4497
473 Ga0495602_0045730 3300048088 Bacteria 3959
474 Ga0495602_0152883 3300048088 Bacteria 1811
475 Ga0495602_0332496 3300048088 Bacteria 1101
476 Ga0495614_0001294 3300048089 Bacteria 10778
477 Ga0495614_0038008 3300048089 Bacteria 2066
478 Ga0496103_0040429 3300048906 Bacteria 2865
479 Ga0496104_0015071 3300048907 Bacteria 6996
480 Ga0496105_0069313 3300048908 Bacteria 2914
481 Ga0496109_0080359 3300048912 Bacteria 3004
482 Ga0496110_0019044 3300048913 Bacteria 5769
483 Ga0496110_0035935 3300048913 Bacteria 4302
484 Ga0496111_0112406 3300048914 Bacteria 2006
485 Ga0496112_0308919 3300048915 Bacteria 1526
486 Ga0496113_0374039 3300048916 Bacteria 1143
487 Ga0496115_0137552 3300048918 Bacteria 2014
488 Ga0496126_0058948 3300048929 Bacteria 3459
489 Ga0496126_0062558 3300048929 Bacteria 3339
490 Ga0496126_0200288 3300048929 Bacteria 1687
491 Ga0501034_0005234 3300049571 Bacteria 14235
492 Ga0501036_0025558 3300049572 Bacteria 4982
493 Ga0501038_0002940 3300049574 Bacteria 15892
494 Ga0501039_0066817 3300049575 Bacteria 2792
495 Ga0501043_0003252 3300049579 Bacteria 13392
496 Ga0501046_0122613 3300049580 Bacteria 1977
497 Ga0501047_0191943 3300049581 Bacteria 1905
498 Ga0501048_0065247 3300049582 Bacteria 2575
499 Ga0501073_0081299 3300049589 Bacteria 2254
500 Ga0501044_0009131 3300049823 Bacteria 10828
501 nmdc:mga0n895_8643_c1 3300050512 Bacteria 8838
502 nmdc:mga0rr50_8952_c1 3300050513 Bacteria 6259
503 nmdc:mga08x19_137505_c1 3300050514 Bacteria 1648
504 nmdc:mga08x19_47243_c1 3300050514 Bacteria 2755
505 nmdc:mga0a205_173878_c1 3300050515 Bacteria 2049
506 Ga0495601_0025415 3300053077 Bacteria 3651
507 Ga0495601_0086160 3300053077 Bacteria 2018
508 Ga0495601_0094473 3300053077 Bacteria 1927
509 Ga0495601_0185267 3300053077 Bacteria 1361
510 Ga0495612_0021737 3300053078 Bacteria 2573
511 Ga0495595_0005530 3300053084 Bacteria 5117
512 Ga0495595_0010613 3300053084 Bacteria 3832
513 Ga0495595_0056247 3300053084 Bacteria 1833
514 Ga0495595_0057024 3300053084 Bacteria 1821
515 Ga0495619_0010591 3300053085 Bacteria 5800
516 Ga0495619_0011666 3300053085 Bacteria 5535
517 2816427737 2816332119 Bacteria 8120218
518 Ga0495684_0030028
519 Ga0070658_10025211
520 Ga0070683_100050641
521 Ga0070683_100130414
522 Ga0070683_100237899
523 Ga0070680_100033055
524 Ga0070682_100072702
525 Ga0068868_100030217
526 Ga0070660_100060537
527 Ga0070689_100084314
528 Ga0070691_10034533
529 Ga0070691_10061879
530 Ga0070675_100136950
531 Ga0070659_100062675
532 Ga0070709_10083072
533 Ga0070709_10098242
534 Ga0070709_10106699
535 Ga0070714_100004251
536 Ga0070714_100011026
537 Ga0070714_100014201
538 Ga0070714_100017386
539 Ga0070714_100021194
540 Ga0070714_100117575
541 Ga0070713_100009824
542 Ga0070713_100012254
543 Ga0070713_100056429
544 Ga0070713_100060448
545 Ga0070713_100092620
546 Ga0070713_100160310
547 Ga0070713_100379034
548 Ga0070710_10000341
549 Ga0070710_10000611
550 Ga0070710_10010203
551 Ga0070710_10013025
552 Ga0070710_10039467
553 Ga0070710_10060069
554 Ga0070710_10106704
555 Ga0070711_100012770
556 Ga0070711_100017564
557 Ga0070711_100027606
558 Ga0070711_100132006
559 Ga0070705_100082786
560 Ga0070705_100219253
561 Ga0070694_100265899
562 Ga0070708_100000954
563 Ga0070708_100011912
564 Ga0070708_100018541
565 Ga0070708_100092818
566 Ga0070663_100036030
567 Ga0070663_100054454
568 Ga0070678_100182194
569 Ga0070662_100186081
570 Ga0070681_10053340
571 Ga0070681_10553529
572 Ga0070685_10043212
573 Ga0070706_100016316
574 Ga0070706_100024283
575 Ga0070706_100041975
576 Ga0070706_100057710
577 Ga0070706_100059340
578 Ga0070706_100064134
579 Ga0070707_100013776
580 Ga0070707_100083601
581 Ga0070707_100093787
582 Ga0070707_100239384
583 Ga0070707_100308616
584 Ga0070698_100000223
585 Ga0070698_100004633
586 Ga0070698_100007801
587 Ga0070698_100068757
588 Ga0070698_100075963
589 Ga0070698_100129751
590 Ga0070698_100146632
591 Ga0070698_100455497
592 Ga0070699_100006399
593 Ga0070699_100164970
594 Ga0070699_100238907
595 Ga0070679_100017065
596 Ga0070679_100136739
597 Ga0070684_100015323
598 Ga0070684_100341517
599 Ga0070697_100007005
600 Ga0070697_100010436
601 Ga0070686_100086262
602 Ga0070695_100035030
603 Ga0068857_100159444
604 Ga0068854_100050883
605 Ga0068856_100084457
606 Ga0068856_100356414
607 Ga0068856_100568677
608 Ga0068859_100422307
609 Ga0068864_100072676
610 Ga0068863_100207405
611 Ga0068858_100181880
612 Ga0081540_1002480
613 Ga0081540_1005274
614 Ga0070717_10002093
615 Ga0070717_10004329
616 Ga0070717_10063045
617 Ga0070717_10071827
618 Ga0070717_10099468
619 Ga0070717_10105555
620 Ga0070717_10106094
621 Ga0070717_10162786
622 Ga0070717_10499326
623 Ga0070716_100039833
624 Ga0070716_100109094
625 Ga0070716_100110370
626 Ga0070716_100119427
627 Ga0070712_100003241
628 Ga0070712_100014923
629 Ga0070712_100067571
630 Ga0070712_100082785
631 Ga0070712_100091269
632 Ga0070712_100264707
633 Ga0070712_100395677
634 Ga0075433_10053217
635 Ga0075434_100007491
636 Ga0068865_100071795
637 Ga0075436_100040509
638 Ga0097620_100422320
639 Ga0075435_100055609
640 Ga0075435_100079300
641 Ga0075435_100314753
642 Ga0099794_10046886
643 Ga0105240_10098597
644 Ga0105240_10378861
645 Ga0111539_10446641
646 Ga0105248_10250534
647 Ga0105248_10726932
648 Ga0105238_10096449
649 Ga0105249_10256994
650 Ga0157373_10078238
651 Ga0157371_10056702
652 Ga0157370_10061292
653 Ga0157369_10092792
654 Ga0157369_10109315
655 Ga0157369_10225511
656 Ga0157378_10222166
657 Ga0163163_10155803
658 Ga0157380_10600563
659 Ga0157377_10040108
660 Ga0157379_10088002
661 Ga0157379_10405650
662 Ga0206356_11299977
663 Ga0206356_11331677
664 Ga0206354_11015892
665 Ga0206353_10357923
666 Ga0206353_11756776
667 Ga0213875_10000471
668 Ga0213875_10016530
669 Ga0213875_10099892
670 Ga0224712_10020824
671 Ga0224712_10071255
672 Ga0224712_10093936
673 Ga0224572_1019140
674 Ga0207653_10014581
675 Ga0207692_10001541
676 Ga0207692_10024429
677 Ga0207692_10050543
678 Ga0207688_10007138
679 Ga0207699_10000458
680 Ga0207699_10003675
681 Ga0207699_10010048
682 Ga0207699_10073753
683 Ga0207645_10114512
684 Ga0207705_10167166
685 Ga0207705_10250919
686 Ga0207684_10015953
687 Ga0207684_10023801
688 Ga0207684_10032434
689 Ga0207684_10042627
690 Ga0207684_10056907
691 Ga0207684_10075281
692 Ga0207684_10179493
693 Ga0207707_10469541
694 Ga0207693_10002614
695 Ga0207693_10006931
696 Ga0207693_10016679
697 Ga0207693_10026396
698 Ga0207693_10072052
699 Ga0207693_10092993
700 Ga0207693_10147168
701 Ga0207693_10364769
702 Ga0207663_10019252
703 Ga0207663_10042684
704 Ga0207663_10042951
705 Ga0207663_10136245
706 Ga0207663_10149884
707 Ga0207660_10170554
708 Ga0207657_10014627
709 Ga0207657_10026490
710 Ga0207652_10010545
711 Ga0207652_10130698
712 Ga0207646_10005502
713 Ga0207646_10042368
714 Ga0207646_10148229
715 Ga0207646_10247119
716 Ga0207694_10291642
717 Ga0207700_10001366
718 Ga0207700_10009817
719 Ga0207700_10012072
720 Ga0207700_10026138
721 Ga0207700_10050474
722 Ga0207700_10051701
723 Ga0207700_10131053
724 Ga0207700_10141375
725 Ga0207700_10157756
726 Ga0207700_10178296
727 Ga0207700_10256242
728 Ga0207700_10565363
729 Ga0207664_10000311
730 Ga0207664_10002972
731 Ga0207664_10003599
732 Ga0207664_10014939
733 Ga0207664_10021154
734 Ga0207664_10094685
735 Ga0207664_10108552
736 Ga0207664_10126741
737 Ga0207664_10149404
738 Ga0207706_10117932
739 Ga0207704_10064196
740 Ga0207665_10000215
741 Ga0207665_10021179
742 Ga0207665_10090415
743 Ga0207665_10140550
744 Ga0207689_10022096
745 Ga0207661_10047982
746 Ga0207661_10135001
747 Ga0207661_10143979
748 Ga0207712_10131577
749 Ga0207640_10035769
750 Ga0207678_10001012
751 Ga0207678_10072890
752 Ga0207708_10130103
753 Ga0207648_10128087
754 Ga0207674_10040759
755 Ga0207674_10086389
756 Ga0207674_10262138
757 Ga0207683_10015016
758 Ga0207683_10281046
759 Ga0268266_10119497
760 Ga0265337_1000705
761 Ga0265319_1002204
762 Ga0265334_10001922
763 Ga0265318_10009335
764 Ga0265322_10007546
765 Ga0265336_10001837
766 Ga0265338_10004045
767 Ga0265338_10011623
768 Ga0265338_10050303
769 Ga0265338_10221689
770 Ga0265324_10001640
771 Ga0265332_10001213
772 Ga0265320_10016908
773 Ga0265325_10003537
774 Ga0265340_10002891
775 Ga0265339_10037849
776 Ga0265316_10064170
777 Ga0307508_10258701
778 Ga0265314_10056921
779 Ga0265342_10004344
780 Ga0316212_1004648
781 Ga0373948_0025756
782 Ga0373926_0000454
783 Ga0373926_0001774
784 Ga0373934_0007837
785 Ga0373934_0015843
786 Ga0373934_0064461
787 Ga0373944_0001200
788 Ga0373944_0017598
789 Ga0373923_0000846
790 Ga0373923_0009479
791 Ga0373923_0050304
792 Ga0373936_0000499
793 Ga0373936_0001290
794 Ga0373936_0041278
795 Ga0373945_0002934
796 Ga0373945_0007665
797 Ga0373953_0012376
798 Ga0373954_0014514
799 Ga0373956_0007407
800 Ga0373956_0030633
801 Ga0373956_0043128
802 Ga0373957_0022012
803 Ga0373957_0029605
804 Ga0373957_0039754
805 Ga0373943_0000222
806 Ga0373943_0002487
807 Ga0373946_0000702
808 Ga0373946_0000978
809 Ga0373955_0009642
810 Ga0373955_0012042
811 Ga0373955_0064737
812 Ga0373924_0000857
813 Ga0373924_0004452
814 Ga0373924_0017104
815 Ga0373924_0111914
816 Ga0373931_0202324
817 Ga0373935_0000284
818 Ga0373935_0001615
819 Ga0373935_0012542
820 Ga0373935_0019589
821 Ga0373935_0142872
822 Ga0373935_0307964
823 Ga0373927_0000383
824 Ga0373927_0044143
825 Ga0373927_0050651
826 Ga0373933_0012926
827 Ga0373933_0013718
828 Ga0373933_0056330
829 Ga0373933_0326771
830 Ga0373947_0000002
831 Ga0373947_0000546
832 Ga0373937_0057654
833 Ga0373937_0192109
834 Ga0373937_0342844
835 Ga0373925_0000010
836 Ga0373925_0001242
837 Ga0373925_0048412
838 Ga0373925_0079462
839 Ga0373925_0137739
840 Ga0436364_0050870
841 Ga0436364_0180602
842 Ga0436364_0238485
843 Ga0436364_0238492
844 Ga0436364_0358294
845 Ga0436364_0658367
846 Ga0436364_1127757
847 Ga0436365_1391382
848 Ga0436360_1271218
849 Ga0436363_1287925
850 Ga0436362_1236812
851 Ga0466961_0102648
852 Ga0466963_0044063
853 Ga0466963_0052953
854 Ga0466963_0137961
855 Ga0466968_0033502
856 Ga0466957_0329900
857 Ga0466959_0077714
858 Ga0466958_0148312
859 Ga0466967_0084006
860 Ga0466967_0102619
861 Ga0466967_0425325
862 Ga0495592_0043492
863 Ga0495592_0057944
864 Ga0495629_0005984
865 Ga0495629_0093684
866 Ga0495641_0006605
867 Ga0495641_0007675
868 Ga0495641_0012082
869 Ga0495651_0013357
870 Ga0495651_0015245
871 Ga0495651_0031340
872 Ga0495651_0059101
873 Ga0495651_0071256
874 Ga0495653_0011580
875 Ga0495653_0037617
876 Ga0495653_0037981
877 Ga0495653_0039573
878 Ga0495580_0028667
879 Ga0495582_0003237
880 Ga0495582_0048751
881 Ga0495639_0001120
882 Ga0495662_0000239
883 Ga0495662_0015177
884 Ga0495664_0002344
885 Ga0495664_0002466
886 Ga0495664_0027147
887 Ga0495664_0108760
888 Ga0495594_0002716
889 Ga0495608_0025774
890 Ga0495608_0108692
891 Ga0495618_0003708
892 Ga0495618_0004006
893 Ga0495618_0010322
894 Ga0495618_0012483
895 Ga0495618_0123885
896 Ga0495618_0162852
897 Ga0495628_0063325
898 Ga0495628_0069076
899 Ga0495628_0329545
900 Ga0495628_0359276
901 Ga0495630_0002081
902 Ga0495630_0002328
903 Ga0495630_0128786
904 Ga0495652_0009146
905 Ga0495652_0039323
906 Ga0495652_0097308
907 Ga0495665_0000894
908 Ga0495665_0003447
909 Ga0495665_0052836
910 Ga0495640_0005258
911 Ga0495640_0010948
912 Ga0495640_0049027
913 Ga0495640_0076759
914 Ga0495586_0002326
915 Ga0495586_0015900
916 Ga0495587_0004162
917 Ga0495587_0036609
918 Ga0495587_0048217
919 Ga0495645_0008403
920 Ga0495645_0038090
921 Ga0495645_0055938
922 Ga0495645_0080744
923 Ga0495645_0225941
924 Ga0495667_0026920
925 Ga0495667_0057997
926 Ga0495667_0065558
927 Ga0495667_0075919
928 Ga0495667_0134503
929 Ga0495634_0010554
930 Ga0495634_0015103
931 Ga0495634_0046394
932 Ga0495635_0000373
933 Ga0495635_0016079
934 Ga0495635_0033324
935 Ga0495635_0040000
936 Ga0495635_0055091
937 Ga0495657_0007829
938 Ga0495657_0027468
939 Ga0495657_0031933
940 Ga0495657_0115446
941 Ga0495599_0010285
942 Ga0495599_0109198
943 Ga0495599_0142041
944 Ga0495599_0150150
945 Ga0495599_0157709
946 Ga0495623_0014382
947 Ga0495623_0057651
948 Ga0495623_0060298
949 Ga0495646_0011973
950 Ga0495646_0060526
951 Ga0495647_0019921
952 Ga0495658_0001706
953 Ga0495658_0005755
954 Ga0495658_0023988
955 Ga0495613_0000459
956 Ga0495613_0032161
957 Ga0495600_0023998
958 Ga0495600_0051326
959 Ga0495600_0059052
960 Ga0495600_0071115
961 Ga0495600_0210642
962 Ga0495581_0001745
963 Ga0495581_0035578
964 Ga0495604_0005987
965 Ga0495604_0015198
966 Ga0495604_0021178
967 Ga0495604_0094473
968 Ga0495674_0001403
969 Ga0495674_0083629
970 Ga0495674_0102757
971 Ga0495674_0146207
972 Ga0495674_0227947
973 Ga0495676_0005425
974 Ga0495676_0006002
975 Ga0495680_0017890
976 Ga0495680_0030178
977 Ga0495680_0050710
978 Ga0495680_0145616
979 Ga0495675_0020121
980 Ga0495675_0072778
981 Ga0495675_0205818
982 Ga0495684_0003049
983 Ga0495684_0005057
984 Ga0495684_0021755
985 Ga0495684_0023456
986 Ga0495684_0052413
987 Ga0495684_0119189
988 Ga0495593_0017936
989 Ga0495602_0037501
990 Ga0495602_0045730
991 Ga0495602_0152883
992 Ga0495602_0332496
993 Ga0495614_0001294
994 Ga0495614_0038008
995 Ga0496103_0040429
996 Ga0496104_0015071
997 Ga0496105_0069313
998 Ga0496109_0080359
999 Ga0496110_0019044
1000 Ga0496110_0035935
1001 Ga0496111_0112406
1002 Ga0496112_0308919
1003 Ga0496113_0374039
1004 Ga0496115_0137552
1005 Ga0496126_0058948
1006 Ga0496126_0062558
1007 Ga0496126_0200288
1008 Ga0501034_0005234
1009 Ga0501036_0025558
1010 Ga0501038_0002940
1011 Ga0501039_0066817
1012 Ga0501043_0003252
1013 Ga0501046_0122613
1014 Ga0501047_0191943
1015 Ga0501048_0065247
1016 Ga0501073_0081299
1017 Ga0501044_0009131
1018 nmdc:mga0n895_8643_c1
1019 nmdc:mga0rr50_8952_c1
1020 nmdc:mga08x19_137505_c1
1021 nmdc:mga08x19_47243_c1
1022 nmdc:mga0a205_173878_c1
1023 Ga0495601_0025415
1024 Ga0495601_0086160
1025 Ga0495601_0094473
1026 Ga0495601_0185267
1027 Ga0495612_0021737
1028 Ga0495595_0005530
1029 Ga0495595_0010613
1030 Ga0495595_0056247
1031 Ga0495595_0057024
1032 Ga0495619_0010591
1033 Ga0495619_0011666
1034 2816427737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

8

303

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lur-assembly2.cif.gz_B crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 0.8836 12 308
3nre-assembly4.cif.gz_D crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution 0.8772 12 308
3mwx-assembly2.cif.gz_B crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution 0.8737 7 308
1nsr-assembly1.cif.gz_B crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with glucose 0.8727 17 308
1mmu-assembly1.cif.gz_A crystal structure of galactose mutarotase from lactococcus lactis complexed with d-glucose 0.8649 15 308
ID Description Score Start End Superfamily
af_P32139_19_304_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9558 12 306 2.70.98.10
af_P32139_19_304_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9525 12 306 2.70.98.10
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9005 10 308 2.70.98.10
af_I1KJ59_42_349_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8932 52 308 2.70.98.10
af_P0A9C3_9_344_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8851 12 308 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A7K0C3C3-F1-model_v4 Aldose 1-epimerase 0.984 5 308 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A3D9SVK3-F1-model_v4 Aldose 1-epimerase 0.9831 5 308 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A852ZRF5-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9817 7 308 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A3A4A802-F1-model_v4 Aldose epimerase 0.9812 7 306 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A7K0C3C3-F1-model_v4 Aldose 1-epimerase 0.9808 5 308 GO:0004034
GO:0006006
GO:0030246
GO:0033499

Map