F457643

General Info

Members Datasets Scaffolds Average Seq Length
513 234 499 379

Family's Representative Sequence

Representative Sequence 3300053078|Ga0495612_0008835|Ga0495612_0008835_2147_3418
Length 423
Sequence MLAVDGEAGTTGTPRKRGGRNLPRSAGEEVKRVTDDQRGPRPPVVGMVGAGQLARMTCQAAIGLGIGFRVLAASPADSAALICTDTVTGDYTDLADLLAFARGCDVVTFDHEHVPGGHLAELEKAAAGQAGPAVRPGAAALRYTQDKLAMRERLRALGVPCPRYAPVSGLAGVCACAKEWGWPVVLKAVTGGYDGRGVWVCGTPDEAAAVLDHPVALFAEEHVAFRAELAALVARSPYGQGAAYPVVQTVQRGGVCHEVLAPASGLPPGMAGQAQRMALELAAELGVTGLLAVELFAAEAGLVVNELAMRPHNSGHWTIEGARTSQFEQHLRAVLDLPLGDPRMAAPQVVMANVFGASSPDIFARYVHVMAADPGVKVHLYGKQVRPGRKIGHVTVLGDDVAGLRERAARAASYLATGNEESG

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
3 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
4 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
5 2855683550 Micromonospora sp. RP3T Isolate Unclassified
6 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
7 2858868258 Micromonospora sp. MH33 Isolate Unclassified
8 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
9 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
10 2902582711 Micromonospora sp. AP08 Isolate Unclassified
11 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
12 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 649633069 Micromonospora sp. L5 Isolate Unclassified
234 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0.39
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 4.48
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10114591 3300005327 Bacteria 2235
2 Ga0070683_100031801 3300005329 Bacteria 4801
3 Ga0070683_100098669 3300005329 Bacteria 2749
4 Ga0070680_100197819 3300005336 Bacteria 1695
5 Ga0070660_100005373 3300005339 Bacteria 8867
6 Ga0070687_100029310 3300005343 Bacteria 2679
7 Ga0070661_100045758 3300005344 Bacteria 3199
8 Ga0070675_100024723 3300005354 Bacteria 4810
9 Ga0070671_100075190 3300005355 Bacteria 2822
10 Ga0070673_100027828 3300005364 Bacteria 4195
11 Ga0070659_100097630 3300005366 Bacteria 2361
12 Ga0070709_10000118 3300005434 Bacteria 53312
13 Ga0070709_10000847 3300005434 Bacteria 17113
14 Ga0070709_10015953 3300005434 Bacteria 4279
15 Ga0070709_10017986 3300005434 Bacteria 4062
16 Ga0070709_10092919 3300005434 Bacteria 1993
17 Ga0070714_100000408 3300005435 Bacteria 31629
18 Ga0070714_100003752 3300005435 Bacteria 11392
19 Ga0070714_100019994 3300005435 Bacteria 5463
20 Ga0070714_100107546 3300005435 Bacteria 2465
21 Ga0070714_100144746 3300005435 Bacteria 2137
22 Ga0070713_100000299 3300005436 Bacteria 32808
23 Ga0070713_100036461 3300005436 Bacteria 3968
24 Ga0070713_100041237 3300005436 Bacteria 3760
25 Ga0070713_100046726 3300005436 Bacteria 3553
26 Ga0070710_10000459 3300005437 Bacteria 19099
27 Ga0070710_10004583 3300005437 Bacteria 6531
28 Ga0070710_10029566 3300005437 Bacteria 2941
29 Ga0070710_10087138 3300005437 Bacteria 1835
30 Ga0070711_100000161 3300005439 Bacteria 36464
31 Ga0070711_100046066 3300005439 Bacteria 2969
32 Ga0070705_100017545 3300005440 Bacteria 3738
33 Ga0070708_100060887 3300005445 Bacteria 3371
34 Ga0070708_100108986 3300005445 Bacteria 2544
35 Ga0070663_100116137 3300005455 Bacteria 2017
36 Ga0070681_10099859 3300005458 Bacteria 2848
37 Ga0070685_10058704 3300005466 Bacteria 2244
38 Ga0070706_100002234 3300005467 Bacteria 19684
39 Ga0070706_100003621 3300005467 Bacteria 15136
40 Ga0070706_100048968 3300005467 Bacteria 3899
41 Ga0070706_100060346 3300005467 Bacteria 3501
42 Ga0070706_100235703 3300005467 Bacteria 1709
43 Ga0070707_100000873 3300005468 Bacteria 29922
44 Ga0070707_100005869 3300005468 Bacteria 11451
45 Ga0070707_100088076 3300005468 Bacteria 3003
46 Ga0070698_100000623 3300005471 Bacteria 38138
47 Ga0070698_100002967 3300005471 Bacteria 18663
48 Ga0070698_100007678 3300005471 Bacteria 11665
49 Ga0070698_100021747 3300005471 Bacteria 6717
50 Ga0070698_100095313 3300005471 Bacteria 2953
51 Ga0070679_100075979 3300005530 Bacteria 3349
52 Ga0070684_100067567 3300005535 Bacteria 3140
53 Ga0070686_100017466 3300005544 Bacteria 4193
54 Ga0070695_100119326 3300005545 Bacteria 1802
55 Ga0070696_100016286 3300005546 Bacteria 5002
56 Ga0068855_100370245 3300005563 Bacteria 1575
57 Ga0068856_100016108 3300005614 Bacteria 7227
58 Ga0068852_100250673 3300005616 Bacteria 1696
59 Ga0068859_100243315 3300005617 Bacteria 1888
60 Ga0068864_100157745 3300005618 Bacteria 2061
61 Ga0068863_100076585 3300005841 Bacteria 3164
62 Ga0068860_100347317 3300005843 Bacteria 1459
63 Ga0068862_100194240 3300005844 Bacteria 1828
64 Ga0081540_1000589 3300005983 Bacteria 34938
65 Ga0081540_1030662 3300005983 Bacteria 2974
66 Ga0081539_10001793 3300005985 Bacteria 34022
67 Ga0081539_10017250 3300005985 Bacteria 5082
68 Ga0081539_10074184 3300005985 Bacteria 1813
69 Ga0070717_10003735 3300006028 Bacteria 10936
70 Ga0070717_10010380 3300006028 Bacteria 7030
71 Ga0070717_10010526 3300006028 Bacteria 6988
72 Ga0070717_10063463 3300006028 Bacteria 3066
73 Ga0070717_10147472 3300006028 Bacteria 2033
74 Ga0070717_10149787 3300006028 Bacteria 2018
75 Ga0070715_10000374 3300006163 Bacteria 11195
76 Ga0070715_10010409 3300006163 Bacteria 3314
77 Ga0070715_10023294 3300006163 Bacteria 2424
78 Ga0070716_100000716 3300006173 Bacteria 14161
79 Ga0070716_100009948 3300006173 Bacteria 4756
80 Ga0070716_100013568 3300006173 Bacteria 4155
81 Ga0070716_100031194 3300006173 Bacteria 2897
82 Ga0070716_100050659 3300006173 Bacteria 2358
83 Ga0070716_100166024 3300006173 Bacteria 1435
84 Ga0070712_100001248 3300006175 Bacteria 15370
85 Ga0070712_100024690 3300006175 Bacteria 3986
86 Ga0070712_100031810 3300006175 Bacteria 3557
87 Ga0070712_100260006 3300006175 Bacteria 1391
88 Ga0075428_100187875 3300006844 Bacteria 2235
89 Ga0075433_10207458 3300006852 Bacteria 1742
90 Ga0075434_100003369 3300006871 Bacteria 14307
91 Ga0068865_100017155 3300006881 Bacteria 4652
92 Ga0075436_100032656 3300006914 Bacteria 3587
93 Ga0097620_100243324 3300006931 Bacteria 1888
94 Ga0075435_100003619 3300007076 Bacteria 10517
95 Ga0111539_10028450 3300009094 Bacteria 6818
96 Ga0105247_10064202 3300009101 Bacteria 2281
97 Ga0114129_10013919 3300009147 Bacteria 11460
98 Ga0105243_10056340 3300009148 Bacteria 3125
99 Ga0105248_10161954 3300009177 Bacteria 2523
100 Ga0105248_10304987 3300009177 Bacteria 1793
101 Ga0105238_10507209 3300009551 Bacteria 1208
102 Ga0105246_10049499 3300011119 Bacteria 2878
103 Ga0157371_10080280 3300013102 Bacteria 2310
104 Ga0157369_10010228 3300013105 Bacteria 10706
105 Ga0157369_10051530 3300013105 Bacteria 4454
106 Ga0157375_10046615 3300013308 Bacteria 4228
107 Ga0157375_10090558 3300013308 Bacteria 3118
108 Ga0157380_10107797 3300014326 Bacteria 2334
109 Ga0157379_10113829 3300014968 Bacteria 2431
110 Ga0157379_10274876 3300014968 Bacteria 1532
111 Ga0206354_10461789 3300020081 Bacteria 1782
112 Ga0206353_11975632 3300020082 Bacteria 3503
113 Ga0207692_10002670 3300025898 Bacteria 6868
114 Ga0207692_10004361 3300025898 Bacteria 5602
115 Ga0207699_10000106 3300025906 Bacteria 58842
116 Ga0207645_10107393 3300025907 Bacteria 1805
117 Ga0207643_10014840 3300025908 Bacteria 4236
118 Ga0207684_10002007 3300025910 Bacteria 20959
119 Ga0207684_10002085 3300025910 Bacteria 20499
120 Ga0207684_10006329 3300025910 Bacteria 10798
121 Ga0207684_10064865 3300025910 Bacteria 3101
122 Ga0207684_10183198 3300025910 Bacteria 1806
123 Ga0207693_10006289 3300025915 Bacteria 9851
124 Ga0207693_10007015 3300025915 Bacteria 9303
125 Ga0207693_10015513 3300025915 Bacteria 6113
126 Ga0207693_10019629 3300025915 Bacteria 5375
127 Ga0207693_10021673 3300025915 Bacteria 5108
128 Ga0207693_10034329 3300025915 Bacteria 4001
129 Ga0207693_10077716 3300025915 Bacteria 2599
130 Ga0207693_10163145 3300025915 Bacteria 1754
131 Ga0207663_10067515 3300025916 Bacteria 2293
132 Ga0207662_10011077 3300025918 Bacteria 4989
133 Ga0207657_10011980 3300025919 Bacteria 8579
134 Ga0207646_10000434 3300025922 Bacteria 55879
135 Ga0207646_10002183 3300025922 Bacteria 23341
136 Ga0207646_10103124 3300025922 Bacteria 2558
137 Ga0207659_10135527 3300025926 Bacteria 1905
138 Ga0207700_10000053 3300025928 Bacteria 75986
139 Ga0207700_10001269 3300025928 Bacteria 14393
140 Ga0207700_10020740 3300025928 Bacteria 4471
141 Ga0207700_10032339 3300025928 Bacteria 3730
142 Ga0207700_10100548 3300025928 Bacteria 2305
143 Ga0207700_10165834 3300025928 Bacteria 1838
144 Ga0207700_10207257 3300025928 Bacteria 1655
145 Ga0207664_10000277 3300025929 Bacteria 38796
146 Ga0207664_10000371 3300025929 Bacteria 32846
147 Ga0207664_10000708 3300025929 Bacteria 22711
148 Ga0207664_10003585 3300025929 Bacteria 10381
149 Ga0207664_10057055 3300025929 Bacteria 3103
150 Ga0207664_10098233 3300025929 Bacteria 2414
151 Ga0207664_10108178 3300025929 Bacteria 2308
152 Ga0207706_10064653 3300025933 Bacteria 3221
153 Ga0207709_10095232 3300025935 Bacteria 1956
154 Ga0207709_10124084 3300025935 Bacteria 1749
155 Ga0207665_10000166 3300025939 Bacteria 44650
156 Ga0207665_10000548 3300025939 Bacteria 25334
157 Ga0207665_10015375 3300025939 Bacteria 5026
158 Ga0207665_10051939 3300025939 Bacteria 2761
159 Ga0207665_10058856 3300025939 Bacteria 2599
160 Ga0207665_10077539 3300025939 Bacteria 2281
161 Ga0207665_10209701 3300025939 Bacteria 1423
162 Ga0207691_10032142 3300025940 Bacteria 4894
163 Ga0207689_10014165 3300025942 Bacteria 6784
164 Ga0207661_10196353 3300025944 Bacteria 1772
165 Ga0207678_10002087 3300026067 Bacteria 18102
166 Ga0207702_10050297 3300026078 Bacteria 3519
167 Ga0207702_10057955 3300026078 Bacteria 3294
168 Ga0207702_10216956 3300026078 Bacteria 1781
169 Ga0207641_10041060 3300026088 Bacteria 3877
170 Ga0207641_10110948 3300026088 Bacteria 2431
171 Ga0207648_10117829 3300026089 Bacteria 2333
172 Ga0207674_10008689 3300026116 Bacteria 11693
173 Ga0207675_100043939 3300026118 Bacteria 4173
174 Ga0207683_10004774 3300026121 Bacteria 11666
175 Ga0265337_1000327 3300028556 Bacteria 25433
176 Ga0307508_10022893 3300031616 Bacteria 5678
177 Ga0307516_10003208 3300031730 Bacteria 21234
178 Ga0316577_10044354 3300031733 Bacteria 2487
179 Ga0307413_10126885 3300031824 Bacteria 1739
180 Ga0307407_10078198 3300031903 Bacteria 1992
181 Ga0307412_10047442 3300031911 Bacteria 2822
182 Ga0307409_100239516 3300031995 Bacteria 1651
183 Ga0307416_100074215 3300032002 Bacteria 2840
184 Ga0307415_100001482 3300032126 Bacteria 11249
185 Ga0373930_0017534 3300034816 Bacteria 1367
186 Ga0373958_0005263 3300034819 Bacteria 1958
187 Ga0373926_0045492 3300035083 Bacteria 1573
188 Ga0373928_0003286 3300035084 Bacteria 3097
189 Ga0373929_0002835 3300035085 Bacteria 3167
190 Ga0373934_0000170 3300035086 Bacteria 23760
191 Ga0373934_0009015 3300035086 Bacteria 3730
192 Ga0373940_0018738 3300035088 Bacteria 1740
193 Ga0373944_0003807 3300035089 Bacteria 3907
194 Ga0373944_0006627 3300035089 Bacteria 3076
195 Ga0373951_0000053 3300035091 Bacteria 46153
196 Ga0373951_0023038 3300035091 Bacteria 1437
197 Ga0373923_0022560 3300035111 Bacteria 2470
198 Ga0373923_0028790 3300035111 Bacteria 2223
199 Ga0373923_0049112 3300035111 Bacteria 1764
200 Ga0373932_0025612 3300035112 Bacteria 1598
201 Ga0373936_0001196 3300035113 Bacteria 9347
202 Ga0373936_0011635 3300035113 Bacteria 3337
203 Ga0373936_0017085 3300035113 Bacteria 2791
204 Ga0373939_0055223 3300035114 Bacteria 1246
205 Ga0373945_0003531 3300035116 Bacteria 4923
206 Ga0373945_0027636 3300035116 Bacteria 1983
207 Ga0373953_0001517 3300035117 Bacteria 6740
208 Ga0373953_0009452 3300035117 Bacteria 3356
209 Ga0373953_0014354 3300035117 Bacteria 2848
210 Ga0373953_0035914 3300035117 Bacteria 1949
211 Ga0373954_0000889 3300035118 Bacteria 11625
212 Ga0373954_0010667 3300035118 Bacteria 4060
213 Ga0373954_0010741 3300035118 Bacteria 4048
214 Ga0373954_0043854 3300035118 Bacteria 2086
215 Ga0373954_0056627 3300035118 Bacteria 1845
216 Ga0373956_0000264 3300035119 Bacteria 21007
217 Ga0373956_0026003 3300035119 Bacteria 2533
218 Ga0373956_0027409 3300035119 Bacteria 2473
219 Ga0373957_0001062 3300035120 Bacteria 7251
220 Ga0373957_0010549 3300035120 Bacteria 3059
221 Ga0373957_0022121 3300035120 Bacteria 2262
222 Ga0373957_0048215 3300035120 Bacteria 1622
223 Ga0373943_0002803 3300035170 Bacteria 7924
224 Ga0373946_0001182 3300035171 Bacteria 9052
225 Ga0373946_0002613 3300035171 Bacteria 6366
226 Ga0373955_0007511 3300035172 Bacteria 5013
227 Ga0373955_0010237 3300035172 Bacteria 4422
228 Ga0373955_0057973 3300035172 Bacteria 2129
229 Ga0373942_0010553 3300035207 Bacteria 2176
230 Ga0373961_0005599 3300035241 Bacteria 3016
231 Ga0373962_0010573 3300035242 Bacteria 2303
232 Ga0373924_0002546 3300035410 Bacteria 6151
233 Ga0373924_0008944 3300035410 Bacteria 3658
234 Ga0373924_0010416 3300035410 Bacteria 3425
235 Ga0373931_0038198 3300035691 Bacteria 2510
236 Ga0373935_0003378 3300035692 Bacteria 9260
237 Ga0373935_0015848 3300035692 Bacteria 4561
238 Ga0373935_0052910 3300035692 Bacteria 2582
239 Ga0373927_0009962 3300035695 Bacteria 6368
240 Ga0373927_0133230 3300035695 Bacteria 1624
241 Ga0373927_0192095 3300035695 Bacteria 1340
242 Ga0373933_0000738 3300035724 Bacteria 19978
243 Ga0373933_0001746 3300035724 Bacteria 12607
244 Ga0373933_0020613 3300035724 Bacteria 3738
245 Ga0373933_0035765 3300035724 Bacteria 2903
246 Ga0373933_0040223 3300035724 Bacteria 2753
247 Ga0373933_0114259 3300035724 Bacteria 1686
248 Ga0373947_0003478 3300035725 Bacteria 9309
249 Ga0373937_0000336 3300036401 Bacteria 44361
250 Ga0373937_0003216 3300036401 Bacteria 13680
251 Ga0373937_0004237 3300036401 Bacteria 12159
252 Ga0373937_0011446 3300036401 Bacteria 7786
253 Ga0373937_0013893 3300036401 Bacteria 7100
254 Ga0373937_0016765 3300036401 Bacteria 6511
255 Ga0373937_0028535 3300036401 Bacteria 5050
256 Ga0373937_0151197 3300036401 Bacteria 2174
257 Ga0316584_0090382 3300036712 Bacteria 2292
258 Ga0373925_0007200 3300037068 Bacteria 8129
259 Ga0373925_0056800 3300037068 Bacteria 2932
260 Ga0373925_0074483 3300037068 Bacteria 2571
261 Ga0373925_0136859 3300037068 Bacteria 1914
262 Ga0436364_0035159 3300037853 Bacteria 1659
263 Ga0436364_0149025 3300037853 Bacteria 2026
264 Ga0436364_0306327 3300037853 Bacteria 4225
265 Ga0436363_0062040 3300039450 Bacteria 1566
266 Ga0451853_2484820 3300041512 Bacteria 2256
267 Ga0466963_0040266 3300044694 Bacteria 3063
268 Ga0466963_0166404 3300044694 Bacteria 1536
269 Ga0466963_0206248 3300044694 Bacteria 1375
270 Ga0466960_0155676 3300044901 Bacteria 1224
271 Ga0495592_0000094 3300046454 Bacteria 78801
272 Ga0495592_0007450 3300046454 Bacteria 8200
273 Ga0495592_0034505 3300046454 Bacteria 3813
274 Ga0495592_0061028 3300046454 Bacteria 2772
275 Ga0495592_0096093 3300046454 Bacteria 2118
276 Ga0495603_0038956 3300046455 Bacteria 2849
277 Ga0495629_0016233 3300046459 Bacteria 5345
278 Ga0495629_0028420 3300046459 Bacteria 3970
279 Ga0495641_0007889 3300046461 Bacteria 6576
280 Ga0495641_0038546 3300046461 Bacteria 2232
281 Ga0495651_0000041 3300046462 Bacteria 94160
282 Ga0495651_0018435 3300046462 Bacteria 5406
283 Ga0495651_0021242 3300046462 Bacteria 5045
284 Ga0495651_0026441 3300046462 Bacteria 4520
285 Ga0495651_0037343 3300046462 Bacteria 3781
286 Ga0495651_0057545 3300046462 Bacteria 2984
287 Ga0495651_0067957 3300046462 Bacteria 2717
288 Ga0495651_0095124 3300046462 Bacteria 2228
289 Ga0495653_0004994 3300046463 Bacteria 10765
290 Ga0495653_0009625 3300046463 Bacteria 7901
291 Ga0495653_0012654 3300046463 Bacteria 6891
292 Ga0495653_0018186 3300046463 Bacteria 5712
293 Ga0495653_0022891 3300046463 Bacteria 5052
294 Ga0495653_0045864 3300046463 Bacteria 3386
295 Ga0495653_0085610 3300046463 Bacteria 2318
296 Ga0495582_0016538 3300046473 Bacteria 4041
297 Ga0495582_0026640 3300046473 Bacteria 3169
298 Ga0495639_0025036 3300046475 Bacteria 2630
299 Ga0495639_0048753 3300046475 Bacteria 1921
300 Ga0495662_0001772 3300046476 Bacteria 10800
301 Ga0495662_0008023 3300046476 Bacteria 5199
302 Ga0495662_0100333 3300046476 Bacteria 1416
303 Ga0495664_0001662 3300046477 Bacteria 11825
304 Ga0495664_0010488 3300046477 Bacteria 5198
305 Ga0495664_0022014 3300046477 Bacteria 3687
306 Ga0495664_0029938 3300046477 Bacteria 3186
307 Ga0495664_0035625 3300046477 Bacteria 2931
308 Ga0495664_0041246 3300046477 Bacteria 2730
309 Ga0495664_0056135 3300046477 Bacteria 2342
310 Ga0495608_0000081 3300046511 Bacteria 69898
311 Ga0495608_0000619 3300046511 Bacteria 24496
312 Ga0495608_0008385 3300046511 Bacteria 7243
313 Ga0495608_0011941 3300046511 Bacteria 6041
314 Ga0495608_0034606 3300046511 Bacteria 3409
315 Ga0495608_0046780 3300046511 Bacteria 2878
316 Ga0495618_0018275 3300046514 Bacteria 4304
317 Ga0495618_0026988 3300046514 Bacteria 3574
318 Ga0495618_0055143 3300046514 Bacteria 2516
319 Ga0495628_0000164 3300046516 Bacteria 57810
320 Ga0495628_0006751 3300046516 Bacteria 9995
321 Ga0495628_0011096 3300046516 Bacteria 7626
322 Ga0495628_0026257 3300046516 Bacteria 4752
323 Ga0495628_0052259 3300046516 Bacteria 3228
324 Ga0495628_0098163 3300046516 Bacteria 2262
325 Ga0495630_0026044 3300046517 Bacteria 4328
326 Ga0495630_0040644 3300046517 Bacteria 3475
327 Ga0495630_0090011 3300046517 Bacteria 2318
328 Ga0495630_0140360 3300046517 Bacteria 1837
329 Ga0495630_0187863 3300046517 Bacteria 1576
330 Ga0495652_0000289 3300046529 Bacteria 59692
331 Ga0495652_0031841 3300046529 Bacteria 4616
332 Ga0495652_0037626 3300046529 Bacteria 4196
333 Ga0495652_0042581 3300046529 Bacteria 3914
334 Ga0495665_0003750 3300046531 Bacteria 8222
335 Ga0495665_0005991 3300046531 Bacteria 6554
336 Ga0495665_0033373 3300046531 Bacteria 2753
337 Ga0495665_0044784 3300046531 Bacteria 2350
338 Ga0495640_0105190 3300046533 Bacteria 1849
339 Ga0495640_0117079 3300046533 Bacteria 1735
340 Ga0495640_0141891 3300046533 Bacteria 1548
341 Ga0495586_0034969 3300046535 Bacteria 2699
342 Ga0495586_0055904 3300046535 Bacteria 2139
343 Ga0495587_0007128 3300046536 Bacteria 7254
344 Ga0495587_0012853 3300046536 Bacteria 5265
345 Ga0495587_0022250 3300046536 Bacteria 3903
346 Ga0495587_0034304 3300046536 Bacteria 3060
347 Ga0495587_0047130 3300046536 Bacteria 2556
348 Ga0495645_0126620 3300046543 Bacteria 1794
349 Ga0495667_0000070 3300046559 Bacteria 78776
350 Ga0495667_0002238 3300046559 Bacteria 12933
351 Ga0495667_0002703 3300046559 Bacteria 11859
352 Ga0495667_0102755 3300046559 Bacteria 1848
353 Ga0495667_0104272 3300046559 Bacteria 1833
354 Ga0495668_0000182 3300046616 Bacteria 93763
355 Ga0495634_0008998 3300046642 Bacteria 7387
356 Ga0495634_0009330 3300046642 Bacteria 7238
357 Ga0495634_0029817 3300046642 Bacteria 3774
358 Ga0495634_0078390 3300046642 Bacteria 2164
359 Ga0495634_0182124 3300046642 Bacteria 1314
360 Ga0495625_0004603 3300046660 Bacteria 12969
361 Ga0495635_0007888 3300046663 Bacteria 7436
362 Ga0495635_0036050 3300046663 Bacteria 3429
363 Ga0495635_0044144 3300046663 Bacteria 3075
364 Ga0495635_0068516 3300046663 Bacteria 2433
365 Ga0495635_0081959 3300046663 Bacteria 2207
366 Ga0495635_0103770 3300046663 Bacteria 1943
367 Ga0495635_0113979 3300046663 Bacteria 1845
368 Ga0495657_0000192 3300046675 Bacteria 55017
369 Ga0495657_0005780 3300046675 Bacteria 9744
370 Ga0495657_0102431 3300046675 Bacteria 1822
371 Ga0495657_0113337 3300046675 Bacteria 1715
372 Ga0495599_0000464 3300046678 Bacteria 23081
373 Ga0495599_0009638 3300046678 Bacteria 5910
374 Ga0495599_0016378 3300046678 Bacteria 4602
375 Ga0495599_0075512 3300046678 Bacteria 2104
376 Ga0495599_0099957 3300046678 Bacteria 1808
377 Ga0495623_0000248 3300046679 Bacteria 34834
378 Ga0495623_0006720 3300046679 Bacteria 7486
379 Ga0495623_0023792 3300046679 Bacteria 3952
380 Ga0495623_0046531 3300046679 Bacteria 2753
381 Ga0495623_0128511 3300046679 Bacteria 1520
382 Ga0495647_0061712 3300046681 Bacteria 1481
383 Ga0495658_0022511 3300046683 Bacteria 3333
384 Ga0495658_0087644 3300046683 Bacteria 1838
385 Ga0495613_0028945 3300046689 Bacteria 4119
386 Ga0495624_0005873 3300046690 Bacteria 8780
387 Ga0495624_0017687 3300046690 Bacteria 4780
388 Ga0495624_0029657 3300046690 Bacteria 3568
389 Ga0495600_0000747 3300046809 Bacteria 17139
390 Ga0495600_0009562 3300046809 Bacteria 5993
391 Ga0495600_0172835 3300046809 Bacteria 1394
392 Ga0495581_0003875 3300047315 Bacteria 8603
393 Ga0495581_0012740 3300047315 Bacteria 4870
394 Ga0495581_0017502 3300047315 Bacteria 4163
395 Ga0495604_0000061 3300047317 Bacteria 94158
396 Ga0495604_0001656 3300047317 Bacteria 18317
397 Ga0495604_0017455 3300047317 Bacteria 5745
398 Ga0495604_0035743 3300047317 Bacteria 3921
399 Ga0495604_0107415 3300047317 Bacteria 2040
400 Ga0495604_0110664 3300047317 Bacteria 2003
401 Ga0495674_0003598 3300047319 Bacteria 15072
402 Ga0495674_0040296 3300047319 Bacteria 4179
403 Ga0495674_0134156 3300047319 Bacteria 2084
404 Ga0495674_0218656 3300047319 Bacteria 1575
405 Ga0495672_0029327 3300047320 Bacteria 3467
406 Ga0495676_0008164 3300047321 Bacteria 9602
407 Ga0495676_0066426 3300047321 Bacteria 2795
408 Ga0495680_0000099 3300047322 Bacteria 78801
409 Ga0495680_0004255 3300047322 Bacteria 13748
410 Ga0495680_0015428 3300047322 Bacteria 6592
411 Ga0495680_0017002 3300047322 Bacteria 6226
412 Ga0495680_0023863 3300047322 Bacteria 5082
413 Ga0495680_0033990 3300047322 Bacteria 4124
414 Ga0495680_0035987 3300047322 Bacteria 3980
415 Ga0495680_0058296 3300047322 Bacteria 2984
416 Ga0495680_0163548 3300047322 Bacteria 1614
417 Ga0495675_0002273 3300047444 Bacteria 11473
418 Ga0495675_0003303 3300047444 Bacteria 9703
419 Ga0495675_0018839 3300047444 Bacteria 4385
420 Ga0495675_0027875 3300047444 Bacteria 3600
421 Ga0495675_0064407 3300047444 Bacteria 2318
422 Ga0495675_0088258 3300047444 Bacteria 1948
423 Ga0495684_0028935 3300047471 Bacteria 4252
424 Ga0495684_0035792 3300047471 Bacteria 3806
425 Ga0495684_0119652 3300047471 Bacteria 1984
426 Ga0495684_0201842 3300047471 Bacteria 1465
427 Ga0495686_0148630 3300047472 Bacteria 1377
428 Ga0495593_0002249 3300047673 Bacteria 11576
429 Ga0495593_0025757 3300047673 Bacteria 3254
430 Ga0495602_0000319 3300048088 Bacteria 44489
431 Ga0495602_0022196 3300048088 Bacteria 6221
432 Ga0495602_0043008 3300048088 Bacteria 4111
433 Ga0495602_0056413 3300048088 Bacteria 3454
434 Ga0495626_0000113 3300048091 Bacteria 105218
435 Ga0496100_0007511 3300048903 Bacteria 6020
436 Ga0496100_0057341 3300048903 Bacteria 2551
437 Ga0496102_0135104 3300048905 Bacteria 2311
438 Ga0496104_0000269 3300048907 Bacteria 46045
439 Ga0496104_0189924 3300048907 Bacteria 1965
440 Ga0496105_0000335 3300048908 Bacteria 30825
441 Ga0496106_0124108 3300048909 Bacteria 2020
442 Ga0496107_0092399 3300048910 Bacteria 2212
443 Ga0496108_0002957 3300048911 Bacteria 13660
444 Ga0496109_0003960 3300048912 Bacteria 12367
445 Ga0496109_0005793 3300048912 Bacteria 10342
446 Ga0496109_0257107 3300048912 Bacteria 1645
447 Ga0496109_0398300 3300048912 Bacteria 1300
448 Ga0496110_0020469 3300048913 Bacteria 5587
449 Ga0496111_0104570 3300048914 Bacteria 2083
450 Ga0496111_0176496 3300048914 Bacteria 1588
451 Ga0496112_0000319 3300048915 Bacteria 30940
452 Ga0496112_0139289 3300048915 Bacteria 2395
453 Ga0496113_0011694 3300048916 Bacteria 5870
454 Ga0496114_0097032 3300048917 Bacteria 2510
455 Ga0496115_0004207 3300048918 Bacteria 10406
456 Ga0496115_0031075 3300048918 Bacteria 4205
457 Ga0496115_0052268 3300048918 Bacteria 3277
458 Ga0501031_0021000 3300049568 Bacteria 4258
459 Ga0501034_0001372 3300049571 Bacteria 32717
460 Ga0501034_0214487 3300049571 Bacteria 1879
461 Ga0501036_0005052 3300049572 Bacteria 10680
462 Ga0501037_0013215 3300049573 Bacteria 6085
463 Ga0501037_0017880 3300049573 Bacteria 5219
464 Ga0501038_0001037 3300049574 Bacteria 25085
465 Ga0501038_0002724 3300049574 Bacteria 16479
466 Ga0501038_0105407 3300049574 Bacteria 2342
467 Ga0501043_0009823 3300049579 Bacteria 7502
468 Ga0501047_0005772 3300049581 Bacteria 11656
469 Ga0501047_0009394 3300049581 Bacteria 9236
470 Ga0501048_0000438 3300049582 Bacteria 29240
471 Ga0501048_0001344 3300049582 Bacteria 18643
472 Ga0501069_0053665 3300049585 Bacteria 2245
473 Ga0501070_0004294 3300049586 Bacteria 12253
474 Ga0501073_0039416 3300049589 Bacteria 3347
475 Ga0501035_0014948 3300049822 Bacteria 7163
476 Ga0501044_0017608 3300049823 Bacteria 7663
477 Ga0501044_0019345 3300049823 Bacteria 7287
478 Ga0501044_0116919 3300049823 Bacteria 2671
479 nmdc:mga05p37_86241_c1 3300050507 Bacteria 3870
480 nmdc:mga08y16_236902_c1 3300050511 Bacteria 1887
481 nmdc:mga0n895_3248_c1 3300050512 Bacteria 13032
482 nmdc:mga0rr50_156471_c1 3300050513 Bacteria 1847
483 nmdc:mga0rr50_19988_c1 3300050513 Bacteria 4536
484 nmdc:mga08x19_15188_c1 3300050514 Bacteria 4682
485 nmdc:mga08x19_28582_c1 3300050514 Bacteria 3493
486 nmdc:mga0a205_196409_c1 3300050515 Bacteria 1909
487 nmdc:mga0a205_449300_c1 3300050515 Bacteria 1149
488 Ga0495601_0038597 3300053077 Bacteria 2987
489 Ga0495601_0107781 3300053077 Bacteria 1802
490 Ga0495612_0004495 3300053078 Bacteria 5787
491 Ga0495612_0008835 3300053078 Bacteria 4084
492 Ga0495595_0004145 3300053084 Bacteria 5820
493 Ga0495595_0005361 3300053084 Bacteria 5192
494 Ga0495619_0022341 3300053085 Bacteria 4047
495 Ga0495619_0025496 3300053085 Bacteria 3797
496 Ga0495619_0062431 3300053085 Bacteria 2480
497 Ga0495619_0193686 3300053085 Bacteria 1407
498 Ga0500573_0013386 3300053140 Bacteria 4622
499 Ga0500573_0069848 3300053140 Bacteria 2004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0026003 Ga0373956_0026003_1596_2522 304
2 3300046679 Ga0495623_0128511 Ga0495623_0128511_21_998 321
3 3300036712 Ga0316584_0090382 Ga0316584_0090382_739_1824 325
4 3300035091 Ga0373951_0023038 Ga0373951_0023038_19_1026 335
5 3300031733 Ga0316577_10044354 Ga0316577_100443543 338
6 3300009148 Ga0105243_10056340 Ga0105243_100563402 340
7 3300013308 Ga0157375_10090558 Ga0157375_100905583 340
8 3300046642 Ga0495634_0182124 Ga0495634_0182124_248_1294 343
9 3300005435 Ga0070714_100000408 Ga0070714_1000004083 346
10 3300006028 Ga0070717_10149787 Ga0070717_101497872 346
11 3300025929 Ga0207664_10000277 Ga0207664_1000027715 346
12 3300037853 Ga0436364_0149025 Ga0436364_0149025_18_1076 348
13 3300005616 Ga0068852_100250673 Ga0068852_1002506732 355
14 3300005618 Ga0068864_100157745 Ga0068864_1001577452 355
15 3300025928 Ga0207700_10207257 Ga0207700_102072571 355
16 3300025935 Ga0207709_10124084 Ga0207709_101240842 355
17 3300013105 Ga0157369_10051530 Ga0157369_100515303 356
18 3300044901 Ga0466960_0155676 Ga0466960_0155676_117_1202 356
19 3300035114 Ga0373939_0055223 Ga0373939_0055223_143_1231 357
20 3300049585 Ga0501069_0053665 Ga0501069_0053665_131_1288 357
21 3300053140 Ga0500573_0069848 Ga0500573_0069848_790_1914 357
22 3300041512 Ga0451853_2484820 Ga0451853_2484820_277_1380 358
23 3300047320 Ga0495672_0029327 Ga0495672_0029327_1442_2545 359
24 3300005329 Ga0070683_100098669 Ga0070683_1000986692 360
25 3300025944 Ga0207661_10196353 Ga0207661_101963532 360
26 3300037068 Ga0373925_0056800 Ga0373925_0056800_1453_2562 360
27 iso_pu_bacteria 2902582711 2902586129 361
28 3300048912 Ga0496109_0398300 Ga0496109_0398300_187_1275 362
29 iso_pu_bacteria 2821268502 2821269293 362
30 iso_pu_bacteria 2870622029 2870624635 362
31 3300048918 Ga0496115_0004207 Ga0496115_0004207_2952_4109 363
32 3300005437 Ga0070710_10087138 Ga0070710_100871382 364
33 3300053140 Ga0500573_0013386 Ga0500573_0013386_2106_3230 364
34 3300044694 Ga0466963_0166404 Ga0466963_0166404_345_1475 365
35 3300048912 Ga0496109_0003960 Ga0496109_0003960_6711_7838 365
36 3300048914 Ga0496111_0176496 Ga0496111_0176496_445_1572 365
37 3300049571 Ga0501034_0001372 Ga0501034_0001372_21063_22175 365
38 3300049572 Ga0501036_0005052 Ga0501036_0005052_1533_2645 365
39 3300049573 Ga0501037_0017880 Ga0501037_0017880_1334_2446 365
40 3300049574 Ga0501038_0001037 Ga0501038_0001037_8871_9983 365
41 3300049574 Ga0501038_0105407 Ga0501038_0105407_151_1263 365
42 3300049579 Ga0501043_0009823 Ga0501043_0009823_5383_6495 365
43 3300049581 Ga0501047_0005772 Ga0501047_0005772_4228_5340 365
44 3300049582 Ga0501048_0001344 Ga0501048_0001344_574_1686 365
45 3300049589 Ga0501073_0039416 Ga0501073_0039416_688_1800 365
46 3300049823 Ga0501044_0017608 Ga0501044_0017608_3354_4466 365
47 3300005435 Ga0070714_100107546 Ga0070714_1001075462 366
48 3300005563 Ga0068855_100370245 Ga0068855_1003702452 366
49 3300005983 Ga0081540_1000589 Ga0081540_10005897 366
50 3300006844 Ga0075428_100187875 Ga0075428_1001878752 366
51 3300009094 Ga0111539_10028450 Ga0111539_100284505 366
52 3300009147 Ga0114129_10013919 Ga0114129_100139199 366
53 3300025929 Ga0207664_10108178 Ga0207664_101081782 366
54 3300034819 Ga0373958_0005263 Ga0373958_0005263_13_1131 366
55 3300035083 Ga0373926_0045492 Ga0373926_0045492_116_1231 366
56 3300035084 Ga0373928_0003286 Ga0373928_0003286_838_1953 366
57 3300035085 Ga0373929_0002835 Ga0373929_0002835_1482_2597 366
58 3300035086 Ga0373934_0000170 Ga0373934_0000170_21704_22819 366
59 3300035086 Ga0373934_0009015 Ga0373934_0009015_2427_3536 366
60 3300035088 Ga0373940_0018738 Ga0373940_0018738_457_1572 366
61 3300035111 Ga0373923_0022560 Ga0373923_0022560_1251_2360 366
62 3300035112 Ga0373932_0025612 Ga0373932_0025612_341_1456 366
63 3300035113 Ga0373936_0017085 Ga0373936_0017085_1395_2510 366
64 3300035116 Ga0373945_0027636 Ga0373945_0027636_392_1507 366
65 3300035117 Ga0373953_0001517 Ga0373953_0001517_4980_6095 366
66 3300035117 Ga0373953_0014354 Ga0373953_0014354_1192_2301 366
67 3300035118 Ga0373954_0000889 Ga0373954_0000889_4918_6033 366
68 3300035118 Ga0373954_0010667 Ga0373954_0010667_1782_2891 366
69 3300035118 Ga0373954_0010741 Ga0373954_0010741_1720_2835 366
70 3300035119 Ga0373956_0000264 Ga0373956_0000264_14959_16074 366
71 3300035119 Ga0373956_0027409 Ga0373956_0027409_1261_2370 366
72 3300035120 Ga0373957_0001062 Ga0373957_0001062_1153_2268 366
73 3300035172 Ga0373955_0057973 Ga0373955_0057973_915_2024 366
74 3300035241 Ga0373961_0005599 Ga0373961_0005599_1856_2971 366
75 3300035410 Ga0373924_0002546 Ga0373924_0002546_1174_2289 366
76 3300035692 Ga0373935_0052910 Ga0373935_0052910_935_2050 366
77 3300035724 Ga0373933_0000738 Ga0373933_0000738_17922_19037 366
78 3300035724 Ga0373933_0001746 Ga0373933_0001746_4348_5463 366
79 3300035724 Ga0373933_0114259 Ga0373933_0114259_495_1604 366
80 3300036401 Ga0373937_0000336 Ga0373937_0000336_4984_6099 366
81 3300036401 Ga0373937_0003216 Ga0373937_0003216_2352_3461 366
82 3300036401 Ga0373937_0004237 Ga0373937_0004237_9550_10665 366
83 3300036401 Ga0373937_0011446 Ga0373937_0011446_5072_6181 366
84 3300046454 Ga0495592_0000094 Ga0495592_0000094_72703_73818 366
85 3300046454 Ga0495592_0007450 Ga0495592_0007450_1881_2996 366
86 3300046454 Ga0495592_0096093 Ga0495592_0096093_306_1415 366
87 3300046455 Ga0495603_0038956 Ga0495603_0038956_697_1812 366
88 3300046459 Ga0495629_0028420 Ga0495629_0028420_1508_2623 366
89 3300046461 Ga0495641_0007889 Ga0495641_0007889_976_2091 366
90 3300046462 Ga0495651_0000041 Ga0495651_0000041_88062_89177 366
91 3300046462 Ga0495651_0026441 Ga0495651_0026441_3126_4235 366
92 3300046462 Ga0495651_0037343 Ga0495651_0037343_1942_3057 366
93 3300046463 Ga0495653_0009625 Ga0495653_0009625_1595_2710 366
94 3300046463 Ga0495653_0022891 Ga0495653_0022891_1363_2478 366
95 3300046473 Ga0495582_0016538 Ga0495582_0016538_2844_3959 366
96 3300046477 Ga0495664_0010488 Ga0495664_0010488_2488_3603 366
97 3300046511 Ga0495608_0000081 Ga0495608_0000081_63807_64922 366
98 3300046511 Ga0495608_0008385 Ga0495608_0008385_5847_6962 366
99 3300046514 Ga0495618_0018275 Ga0495618_0018275_410_1525 366
100 3300046514 Ga0495618_0055143 Ga0495618_0055143_509_1624 366
101 3300046516 Ga0495628_0000164 Ga0495628_0000164_4968_6083 366
102 3300046516 Ga0495628_0006751 Ga0495628_0006751_7127_8242 366
103 3300046517 Ga0495630_0026044 Ga0495630_0026044_723_1838 366
104 3300046517 Ga0495630_0090011 Ga0495630_0090011_1006_2121 366
105 3300046529 Ga0495652_0000289 Ga0495652_0000289_53612_54727 366
106 3300046529 Ga0495652_0037626 Ga0495652_0037626_1940_3049 366
107 3300046531 Ga0495665_0005991 Ga0495665_0005991_4962_6077 366
108 3300046535 Ga0495586_0055904 Ga0495586_0055904_218_1333 366
109 3300046536 Ga0495587_0007128 Ga0495587_0007128_3184_4299 366
110 3300046536 Ga0495587_0047130 Ga0495587_0047130_1147_2256 366
111 3300046559 Ga0495667_0000070 Ga0495667_0000070_4977_6092 366
112 3300046642 Ga0495634_0009330 Ga0495634_0009330_818_1933 366
113 3300046663 Ga0495635_0044144 Ga0495635_0044144_1826_2941 366
114 3300046663 Ga0495635_0081959 Ga0495635_0081959_818_1933 366
115 3300046663 Ga0495635_0103770 Ga0495635_0103770_715_1824 366
116 3300046675 Ga0495657_0000192 Ga0495657_0000192_1070_2185 366
117 3300046675 Ga0495657_0005780 Ga0495657_0005780_306_1415 366
118 3300046678 Ga0495599_0000464 Ga0495599_0000464_4950_6065 366
119 3300046678 Ga0495599_0075512 Ga0495599_0075512_14_1123 366
120 3300046678 Ga0495599_0099957 Ga0495599_0099957_68_1183 366
121 3300046679 Ga0495623_0000248 Ga0495623_0000248_4956_6071 366
122 3300046679 Ga0495623_0023792 Ga0495623_0023792_159_1268 366
123 3300046679 Ga0495623_0046531 Ga0495623_0046531_393_1508 366
124 3300046683 Ga0495658_0022511 Ga0495658_0022511_1606_2721 366
125 3300046689 Ga0495613_0028945 Ga0495613_0028945_1603_2718 366
126 3300046690 Ga0495624_0017687 Ga0495624_0017687_1705_2820 366
127 3300046809 Ga0495600_0009562 Ga0495600_0009562_3120_4235 366
128 3300046809 Ga0495600_0172835 Ga0495600_0172835_173_1282 366
129 3300047315 Ga0495581_0017502 Ga0495581_0017502_2979_4094 366
130 3300047317 Ga0495604_0000061 Ga0495604_0000061_4984_6099 366
131 3300047317 Ga0495604_0035743 Ga0495604_0035743_1989_3104 366
132 3300047317 Ga0495604_0107415 Ga0495604_0107415_105_1214 366
133 3300047319 Ga0495674_0218656 Ga0495674_0218656_412_1527 366
134 3300047321 Ga0495676_0066426 Ga0495676_0066426_812_1927 366
135 3300047322 Ga0495680_0000099 Ga0495680_0000099_4984_6099 366
136 3300047322 Ga0495680_0004255 Ga0495680_0004255_1780_2889 366
137 3300047322 Ga0495680_0023863 Ga0495680_0023863_2602_3717 366
138 3300047322 Ga0495680_0058296 Ga0495680_0058296_933_2048 366
139 3300047444 Ga0495675_0002273 Ga0495675_0002273_4984_6099 366
140 3300047444 Ga0495675_0003303 Ga0495675_0003303_6036_7151 366
141 3300048088 Ga0495602_0000319 Ga0495602_0000319_38391_39506 366
142 3300048088 Ga0495602_0022196 Ga0495602_0022196_1684_2793 366
143 3300048088 Ga0495602_0043008 Ga0495602_0043008_2865_3974 366
144 3300048903 Ga0496100_0007511 Ga0496100_0007511_1872_2987 366
145 3300048910 Ga0496107_0092399 Ga0496107_0092399_260_1375 366
146 3300048914 Ga0496111_0104570 Ga0496111_0104570_441_1556 366
147 3300048916 Ga0496113_0011694 Ga0496113_0011694_3178_4293 366
148 3300048918 Ga0496115_0031075 Ga0496115_0031075_2252_3367 366
149 3300050507 nmdc:mga05p37_86241_c1 nmdc:mga05p37_86241_c1_349_1455 366
150 3300050511 nmdc:mga08y16_236902_c1 nmdc:mga08y16_236902_c1_761_1867 366
151 3300050513 nmdc:mga0rr50_156471_c1 nmdc:mga0rr50_156471_c1_43_1149 366
152 3300050514 nmdc:mga08x19_28582_c1 nmdc:mga08x19_28582_c1_2267_3373 366
153 3300050515 nmdc:mga0a205_196409_c1 nmdc:mga0a205_196409_c1_236_1342 366
154 3300050515 nmdc:mga0a205_449300_c1 nmdc:mga0a205_449300_c1_11_1129 366
155 3300053077 Ga0495601_0038597 Ga0495601_0038597_145_1260 366
156 3300053084 Ga0495595_0005361 Ga0495595_0005361_3340_4455 366
157 3300053085 Ga0495619_0062431 Ga0495619_0062431_501_1616 366
158 3300005445 Ga0070708_100060887 Ga0070708_1000608872 367
159 3300005467 Ga0070706_100003621 Ga0070706_1000036216 367
160 3300005468 Ga0070707_100005869 Ga0070707_1000058693 367
161 3300005471 Ga0070698_100021747 Ga0070698_1000217475 367
162 3300006028 Ga0070717_10010526 Ga0070717_100105263 367
163 3300025910 Ga0207684_10002085 Ga0207684_100020855 367
164 3300025922 Ga0207646_10002183 Ga0207646_100021836 367
165 3300031995 Ga0307409_100239516 Ga0307409_1002395162 367
166 3300031616 Ga0307508_10022893 Ga0307508_100228933 369
167 3300005434 Ga0070709_10000847 Ga0070709_1000084710 370
168 3300005436 Ga0070713_100041237 Ga0070713_1000412372 370
169 3300005436 Ga0070713_100046726 Ga0070713_1000467263 370
170 3300005445 Ga0070708_100108986 Ga0070708_1001089862 370
171 3300005468 Ga0070707_100088076 Ga0070707_1000880763 370
172 3300005471 Ga0070698_100095313 Ga0070698_1000953132 370
173 3300006028 Ga0070717_10063463 Ga0070717_100634633 370
174 3300006173 Ga0070716_100013568 Ga0070716_1000135682 370
175 3300006175 Ga0070712_100024690 Ga0070712_1000246903 370
176 3300006175 Ga0070712_100260006 Ga0070712_1002600061 370
177 3300025915 Ga0207693_10015513 Ga0207693_100155132 370
178 3300025915 Ga0207693_10034329 Ga0207693_100343292 370
179 3300025915 Ga0207693_10163145 Ga0207693_101631452 370
180 3300025922 Ga0207646_10103124 Ga0207646_101031242 370
181 3300025928 Ga0207700_10001269 Ga0207700_100012696 370
182 3300025928 Ga0207700_10100548 Ga0207700_101005482 370
183 3300025928 Ga0207700_10165834 Ga0207700_101658342 370
184 3300025929 Ga0207664_10000708 Ga0207664_1000070812 370
185 3300025929 Ga0207664_10098233 Ga0207664_100982332 370
186 3300025939 Ga0207665_10000548 Ga0207665_100005484 370
187 3300035172 Ga0373955_0010237 Ga0373955_0010237_1196_2329 370
188 3300035695 Ga0373927_0133230 Ga0373927_0133230_461_1594 370
189 3300035724 Ga0373933_0035765 Ga0373933_0035765_1064_2197 370
190 3300036401 Ga0373937_0013893 Ga0373937_0013893_2353_3486 370
191 3300037068 Ga0373925_0074483 Ga0373925_0074483_601_1734 370
192 3300044694 Ga0466963_0206248 Ga0466963_0206248_65_1186 370
193 3300046462 Ga0495651_0018435 Ga0495651_0018435_1106_2239 370
194 3300046463 Ga0495653_0004994 Ga0495653_0004994_534_1667 370
195 3300046476 Ga0495662_0100333 Ga0495662_0100333_148_1281 370
196 3300046477 Ga0495664_0022014 Ga0495664_0022014_2133_3266 370
197 3300046477 Ga0495664_0035625 Ga0495664_0035625_707_1840 370
198 3300046511 Ga0495608_0000619 Ga0495608_0000619_14253_15386 370
199 3300046516 Ga0495628_0011096 Ga0495628_0011096_2518_3651 370
200 3300046517 Ga0495630_0187863 Ga0495630_0187863_347_1480 370
201 3300046529 Ga0495652_0042581 Ga0495652_0042581_2230_3363 370
202 3300046533 Ga0495640_0105190 Ga0495640_0105190_617_1750 370
203 3300046533 Ga0495640_0117079 Ga0495640_0117079_97_1230 370
204 3300046559 Ga0495667_0002238 Ga0495667_0002238_8023_9156 370
205 3300046663 Ga0495635_0007888 Ga0495635_0007888_2932_4065 370
206 3300046678 Ga0495599_0009638 Ga0495599_0009638_1661_2794 370
207 3300046809 Ga0495600_0000747 Ga0495600_0000747_6897_8030 370
208 3300047317 Ga0495604_0001656 Ga0495604_0001656_9102_10235 370
209 3300047319 Ga0495674_0040296 Ga0495674_0040296_715_1848 370
210 3300047322 Ga0495680_0035987 Ga0495680_0035987_329_1462 370
211 3300047444 Ga0495675_0027875 Ga0495675_0027875_2311_3444 370
212 3300048088 Ga0495602_0056413 Ga0495602_0056413_1494_2627 370
213 3300053085 Ga0495619_0022341 Ga0495619_0022341_2493_3626 370
214 3300005434 Ga0070709_10017986 Ga0070709_100179863 371
215 3300005436 Ga0070713_100036461 Ga0070713_1000364611 371
216 3300005437 Ga0070710_10029566 Ga0070710_100295663 371
217 3300005614 Ga0068856_100016108 Ga0068856_1000161085 371
218 3300006028 Ga0070717_10147472 Ga0070717_101474721 371
219 3300006163 Ga0070715_10000374 Ga0070715_100003744 371
220 3300006173 Ga0070716_100009948 Ga0070716_1000099484 371
221 3300009101 Ga0105247_10064202 Ga0105247_100642022 371
222 3300009177 Ga0105248_10161954 Ga0105248_101619542 371
223 3300009551 Ga0105238_10507209 Ga0105238_105072091 371
224 3300011119 Ga0105246_10049499 Ga0105246_100494992 371
225 3300013102 Ga0157371_10080280 Ga0157371_100802802 371
226 3300013308 Ga0157375_10046615 Ga0157375_100466151 371
227 3300014326 Ga0157380_10107797 Ga0157380_101077973 371
228 3300014968 Ga0157379_10274876 Ga0157379_102748762 371
229 3300025898 Ga0207692_10002670 Ga0207692_100026705 371
230 3300025915 Ga0207693_10007015 Ga0207693_100070153 371
231 3300025929 Ga0207664_10003585 Ga0207664_100035856 371
232 3300025939 Ga0207665_10015375 Ga0207665_100153753 371
233 3300026078 Ga0207702_10050297 Ga0207702_100502973 371
234 3300034816 Ga0373930_0017534 Ga0373930_0017534_105_1220 371
235 3300035089 Ga0373944_0003807 Ga0373944_0003807_70_1185 371
236 3300035111 Ga0373923_0049112 Ga0373923_0049112_94_1209 371
237 3300035113 Ga0373936_0011635 Ga0373936_0011635_1901_3016 371
238 3300035117 Ga0373953_0035914 Ga0373953_0035914_322_1437 371
239 3300035118 Ga0373954_0056627 Ga0373954_0056627_718_1833 371
240 3300035120 Ga0373957_0010549 Ga0373957_0010549_1911_3026 371
241 3300035120 Ga0373957_0048215 Ga0373957_0048215_280_1395 371
242 3300035171 Ga0373946_0002613 Ga0373946_0002613_3152_4267 371
243 3300035207 Ga0373942_0010553 Ga0373942_0010553_100_1215 371
244 3300035242 Ga0373962_0010573 Ga0373962_0010573_1041_2156 371
245 3300035410 Ga0373924_0010416 Ga0373924_0010416_641_1756 371
246 3300035691 Ga0373931_0038198 Ga0373931_0038198_1271_2386 371
247 3300035724 Ga0373933_0020613 Ga0373933_0020613_1084_2199 371
248 3300036401 Ga0373937_0016765 Ga0373937_0016765_2534_3649 371
249 3300037853 Ga0436364_0306327 Ga0436364_0306327_1913_3031 371
250 3300044694 Ga0466963_0040266 Ga0466963_0040266_1886_3001 371
251 3300046454 Ga0495592_0061028 Ga0495592_0061028_18_1133 371
252 3300046462 Ga0495651_0067957 Ga0495651_0067957_1186_2301 371
253 3300046462 Ga0495651_0095124 Ga0495651_0095124_834_1949 371
254 3300046463 Ga0495653_0085610 Ga0495653_0085610_321_1436 371
255 3300046476 Ga0495662_0008023 Ga0495662_0008023_2895_4010 371
256 3300046477 Ga0495664_0056135 Ga0495664_0056135_71_1186 371
257 3300046511 Ga0495608_0034606 Ga0495608_0034606_1670_2785 371
258 3300046516 Ga0495628_0052259 Ga0495628_0052259_439_1554 371
259 3300046517 Ga0495630_0140360 Ga0495630_0140360_306_1421 371
260 3300046531 Ga0495665_0003750 Ga0495665_0003750_2494_3609 371
261 3300046536 Ga0495587_0022250 Ga0495587_0022250_265_1380 371
262 3300046559 Ga0495667_0102755 Ga0495667_0102755_555_1670 371
263 3300046642 Ga0495634_0008998 Ga0495634_0008998_6223_7338 371
264 3300046642 Ga0495634_0029817 Ga0495634_0029817_2520_3635 371
265 3300046663 Ga0495635_0068516 Ga0495635_0068516_1269_2384 371
266 3300046675 Ga0495657_0113337 Ga0495657_0113337_578_1693 371
267 3300047315 Ga0495581_0003875 Ga0495581_0003875_2762_3877 371
268 3300047317 Ga0495604_0110664 Ga0495604_0110664_207_1322 371
269 3300047321 Ga0495676_0008164 Ga0495676_0008164_2410_3525 371
270 3300047322 Ga0495680_0015428 Ga0495680_0015428_5039_6154 371
271 3300047322 Ga0495680_0033990 Ga0495680_0033990_2832_3947 371
272 3300047444 Ga0495675_0064407 Ga0495675_0064407_288_1403 371
273 3300047471 Ga0495684_0028935 Ga0495684_0028935_1218_2333 371
274 3300047471 Ga0495684_0201842 Ga0495684_0201842_280_1395 371
275 3300047673 Ga0495593_0002249 Ga0495593_0002249_280_1395 371
276 3300048903 Ga0496100_0057341 Ga0496100_0057341_1226_2365 371
277 3300048905 Ga0496102_0135104 Ga0496102_0135104_290_1429 371
278 3300048907 Ga0496104_0000269 Ga0496104_0000269_38763_39902 371
279 3300048907 Ga0496104_0189924 Ga0496104_0189924_179_1294 371
280 3300048908 Ga0496105_0000335 Ga0496105_0000335_17972_19111 371
281 3300048909 Ga0496106_0124108 Ga0496106_0124108_729_1868 371
282 3300048911 Ga0496108_0002957 Ga0496108_0002957_464_1603 371
283 3300048912 Ga0496109_0005793 Ga0496109_0005793_3962_5101 371
284 3300048913 Ga0496110_0020469 Ga0496110_0020469_1029_2144 371
285 3300048915 Ga0496112_0000319 Ga0496112_0000319_10268_11407 371
286 3300048915 Ga0496112_0139289 Ga0496112_0139289_1138_2253 371
287 3300048917 Ga0496114_0097032 Ga0496114_0097032_487_1602 371
288 3300048918 Ga0496115_0052268 Ga0496115_0052268_997_2136 371
289 iso_pu_bacteria 2984576629 2984580574 371
290 iso_pu_bacteria 2990256926 2990258266 371
291 3300006173 Ga0070716_100050659 Ga0070716_1000506592 372
292 3300025939 Ga0207665_10209701 Ga0207665_102097011 372
293 3300046616 Ga0495668_0000182 Ga0495668_0000182_18161_19306 372
294 3300046660 Ga0495625_0004603 Ga0495625_0004603_2264_3409 372
295 3300047472 Ga0495686_0148630 Ga0495686_0148630_115_1287 372
296 3300048091 Ga0495626_0000113 Ga0495626_0000113_3240_4385 372
297 iso_pu_bacteria 2501939600 2501943592 372
298 iso_pu_bacteria 2799112218 2799184824 372
299 iso_pu_bacteria 2856858025 2856860612 372
300 iso_pu_bacteria 649633069 649811347 372
301 3300005467 Ga0070706_100048968 Ga0070706_1000489684 373
302 iso_pu_bacteria 2855683550 2855684901 373
303 iso_pu_bacteria 2858868258 2858869348 373
304 iso_pu_bacteria 2858902515 2858903333 373
305 3300032126 Ga0307415_100001482 Ga0307415_1000014826 374
306 iso_pu_bacteria 8056060235 8056065199 374
307 3300005434 Ga0070709_10015953 Ga0070709_100159534 375
308 3300005437 Ga0070710_10004583 Ga0070710_100045834 375
309 3300005439 Ga0070711_100046066 Ga0070711_1000460661 375
310 3300005471 Ga0070698_100007678 Ga0070698_10000767810 375
311 3300005985 Ga0081539_10001793 Ga0081539_1000179334 375
312 3300005985 Ga0081539_10074184 Ga0081539_100741842 375
313 3300006173 Ga0070716_100031194 Ga0070716_1000311942 375
314 3300014968 Ga0157379_10113829 Ga0157379_101138292 375
315 3300025928 Ga0207700_10032339 Ga0207700_100323391 375
316 3300025939 Ga0207665_10051939 Ga0207665_100519392 375
317 3300031824 Ga0307413_10126885 Ga0307413_101268852 375
318 3300031903 Ga0307407_10078198 Ga0307407_100781982 375
319 3300031911 Ga0307412_10047442 Ga0307412_100474421 375
320 3300032002 Ga0307416_100074215 Ga0307416_1000742152 375
321 3300035091 Ga0373951_0000053 Ga0373951_0000053_19923_21068 375
322 3300035695 Ga0373927_0192095 Ga0373927_0192095_178_1320 375
323 3300036401 Ga0373937_0151197 Ga0373937_0151197_620_1762 375
324 3300046462 Ga0495651_0021242 Ga0495651_0021242_3119_4261 375
325 3300046463 Ga0495653_0018186 Ga0495653_0018186_927_2069 375
326 3300046477 Ga0495664_0041246 Ga0495664_0041246_1484_2626 375
327 3300046514 Ga0495618_0026988 Ga0495618_0026988_2089_3231 375
328 3300046516 Ga0495628_0026257 Ga0495628_0026257_1317_2459 375
329 3300046533 Ga0495640_0141891 Ga0495640_0141891_155_1297 375
330 3300046543 Ga0495645_0126620 Ga0495645_0126620_54_1196 375
331 3300046559 Ga0495667_0104272 Ga0495667_0104272_201_1343 375
332 3300046663 Ga0495635_0113979 Ga0495635_0113979_19_1161 375
333 3300047317 Ga0495604_0017455 Ga0495604_0017455_139_1281 375
334 3300047444 Ga0495675_0088258 Ga0495675_0088258_768_1910 375
335 3300047471 Ga0495684_0119652 Ga0495684_0119652_587_1729 375
336 3300005985 Ga0081539_10017250 Ga0081539_100172502 376
337 3300009177 Ga0105248_10304987 Ga0105248_103049872 376
338 3300013105 Ga0157369_10010228 Ga0157369_1001022811 376
339 3300020082 Ga0206353_11975632 Ga0206353_119756324 376
340 3300031730 Ga0307516_10003208 Ga0307516_1000320814 376
341 3300046690 Ga0495624_0029657 Ga0495624_0029657_1779_2930 376
342 3300049568 Ga0501031_0021000 Ga0501031_0021000_644_1819 376
343 3300049571 Ga0501034_0214487 Ga0501034_0214487_353_1528 376
344 3300049573 Ga0501037_0013215 Ga0501037_0013215_591_1766 376
345 3300049574 Ga0501038_0002724 Ga0501038_0002724_6830_8005 376
346 3300049581 Ga0501047_0009394 Ga0501047_0009394_695_1870 376
347 3300049582 Ga0501048_0000438 Ga0501048_0000438_9550_10725 376
348 3300049586 Ga0501070_0004294 Ga0501070_0004294_6856_8031 376
349 3300049822 Ga0501035_0014948 Ga0501035_0014948_324_1499 376
350 3300049823 Ga0501044_0019345 Ga0501044_0019345_3082_4257 376
351 iso_pu_bacteria 2731639228 2731908786 376
352 3300005435 Ga0070714_100144746 Ga0070714_1001447462 379
353 3300028556 Ga0265337_1000327 Ga0265337_100032716 379
354 3300006852 Ga0075433_10207458 Ga0075433_102074581 380
355 3300006871 Ga0075434_100003369 Ga0075434_10000336910 380
356 3300006914 Ga0075436_100032656 Ga0075436_1000326562 380
357 3300007076 Ga0075435_100003619 Ga0075435_1000036194 380
358 3300049823 Ga0501044_0116919 Ga0501044_0116919_1059_2285 380
359 3300050512 nmdc:mga0n895_3248_c1 nmdc:mga0n895_3248_c1_10494_11687 380
360 3300050513 nmdc:mga0rr50_19988_c1 nmdc:mga0rr50_19988_c1_1119_2312 380
361 3300050514 nmdc:mga08x19_15188_c1 nmdc:mga08x19_15188_c1_910_2103 380
362 3300005336 Ga0070680_100197819 Ga0070680_1001978192 381
363 3300005355 Ga0070671_100075190 Ga0070671_1000751901 381
364 3300005434 Ga0070709_10000118 Ga0070709_1000011840 381
365 3300005435 Ga0070714_100003752 Ga0070714_1000037522 381
366 3300005436 Ga0070713_100000299 Ga0070713_10000029931 381
367 3300005437 Ga0070710_10000459 Ga0070710_100004594 381
368 3300005439 Ga0070711_100000161 Ga0070711_10000016118 381
369 3300005440 Ga0070705_100017545 Ga0070705_1000175452 381
370 3300005545 Ga0070695_100119326 Ga0070695_1001193262 381
371 3300005841 Ga0068863_100076585 Ga0068863_1000765852 381
372 3300005983 Ga0081540_1030662 Ga0081540_10306622 381
373 3300006028 Ga0070717_10003735 Ga0070717_100037354 381
374 3300006163 Ga0070715_10010409 Ga0070715_100104092 381
375 3300006173 Ga0070716_100000716 Ga0070716_10000071613 381
376 3300006175 Ga0070712_100001248 Ga0070712_10000124816 381
377 3300025898 Ga0207692_10004361 Ga0207692_100043612 381
378 3300025906 Ga0207699_10000106 Ga0207699_1000010650 381
379 3300025915 Ga0207693_10006289 Ga0207693_100062898 381
380 3300025915 Ga0207693_10077716 Ga0207693_100777162 381
381 3300025916 Ga0207663_10067515 Ga0207663_100675152 381
382 3300025928 Ga0207700_10000053 Ga0207700_1000005332 381
383 3300025929 Ga0207664_10000371 Ga0207664_1000037130 381
384 3300025939 Ga0207665_10000166 Ga0207665_1000016612 381
385 3300025939 Ga0207665_10058856 Ga0207665_100588562 381
386 3300026078 Ga0207702_10216956 Ga0207702_102169562 381
387 3300026088 Ga0207641_10041060 Ga0207641_100410604 381
388 3300005435 Ga0070714_100019994 Ga0070714_1000199943 382
389 3300005467 Ga0070706_100060346 Ga0070706_1000603463 382
390 3300005467 Ga0070706_100235703 Ga0070706_1002357032 382
391 3300005471 Ga0070698_100002967 Ga0070698_10000296722 382
392 3300006028 Ga0070717_10010380 Ga0070717_100103804 382
393 3300025910 Ga0207684_10006329 Ga0207684_100063293 382
394 3300025910 Ga0207684_10183198 Ga0207684_101831982 382
395 3300035111 Ga0373923_0028790 Ga0373923_0028790_768_1949 382
396 3300035113 Ga0373936_0001196 Ga0373936_0001196_4608_5789 382
397 3300035117 Ga0373953_0009452 Ga0373953_0009452_1991_3172 382
398 3300035118 Ga0373954_0043854 Ga0373954_0043854_875_2056 382
399 3300035120 Ga0373957_0022121 Ga0373957_0022121_313_1494 382
400 3300035172 Ga0373955_0007511 Ga0373955_0007511_939_2120 382
401 3300035410 Ga0373924_0008944 Ga0373924_0008944_1606_2787 382
402 3300035692 Ga0373935_0003378 Ga0373935_0003378_872_2053 382
403 3300035724 Ga0373933_0040223 Ga0373933_0040223_275_1456 382
404 3300036401 Ga0373937_0028535 Ga0373937_0028535_769_1950 382
405 3300037068 Ga0373925_0136859 Ga0373925_0136859_183_1364 382
406 3300046454 Ga0495592_0034505 Ga0495592_0034505_2175_3356 382
407 3300046459 Ga0495629_0016233 Ga0495629_0016233_3639_4820 382
408 3300046462 Ga0495651_0057545 Ga0495651_0057545_1346_2527 382
409 3300046463 Ga0495653_0045864 Ga0495653_0045864_2175_3356 382
410 3300046473 Ga0495582_0026640 Ga0495582_0026640_1155_2336 382
411 3300046475 Ga0495639_0048753 Ga0495639_0048753_30_1211 382
412 3300046476 Ga0495662_0001772 Ga0495662_0001772_5569_6750 382
413 3300046477 Ga0495664_0029938 Ga0495664_0029938_671_1852 382
414 3300046511 Ga0495608_0011941 Ga0495608_0011941_1839_3020 382
415 3300046516 Ga0495628_0098163 Ga0495628_0098163_313_1494 382
416 3300046517 Ga0495630_0040644 Ga0495630_0040644_458_1639 382
417 3300046531 Ga0495665_0044784 Ga0495665_0044784_402_1583 382
418 3300046535 Ga0495586_0034969 Ga0495586_0034969_646_1827 382
419 3300046536 Ga0495587_0034304 Ga0495587_0034304_1335_2516 382
420 3300046642 Ga0495634_0078390 Ga0495634_0078390_458_1639 382
421 3300046679 Ga0495623_0006720 Ga0495623_0006720_5460_6641 382
422 3300046683 Ga0495658_0087644 Ga0495658_0087644_482_1663 382
423 3300046690 Ga0495624_0005873 Ga0495624_0005873_4031_5212 382
424 3300047315 Ga0495581_0012740 Ga0495581_0012740_1607_2788 382
425 3300047319 Ga0495674_0134156 Ga0495674_0134156_31_1212 382
426 3300047322 Ga0495680_0163548 Ga0495680_0163548_31_1212 382
427 3300047444 Ga0495675_0018839 Ga0495675_0018839_2331_3512 382
428 3300047673 Ga0495593_0025757 Ga0495593_0025757_1200_2381 382
429 3300053077 Ga0495601_0107781 Ga0495601_0107781_458_1639 382
430 3300053078 Ga0495612_0004495 Ga0495612_0004495_693_1874 382
431 3300053084 Ga0495595_0004145 Ga0495595_0004145_1619_2800 382
432 3300053085 Ga0495619_0025496 Ga0495619_0025496_2331_3512 382
433 3300005467 Ga0070706_100002234 Ga0070706_1000022344 384
434 3300005468 Ga0070707_100000873 Ga0070707_10000087328 384
435 3300005471 Ga0070698_100000623 Ga0070698_10000062328 384
436 3300025910 Ga0207684_10002007 Ga0207684_1000200718 384
437 3300025922 Ga0207646_10000434 Ga0207646_1000043434 384
438 3300053078 Ga0495612_0008835 Ga0495612_0008835_2147_3418 384
439 3300025907 Ga0207645_10107393 Ga0207645_101073932 385
440 3300039450 Ga0436363_0062040 Ga0436363_0062040_164_1348 385
441 3300025910 Ga0207684_10064865 Ga0207684_100648653 386
442 3300005434 Ga0070709_10092919 Ga0070709_100929192 387
443 3300006173 Ga0070716_100166024 Ga0070716_1001660242 387
444 3300025915 Ga0207693_10021673 Ga0207693_100216732 387
445 3300005327 Ga0070658_10114591 Ga0070658_101145911 389
446 3300005329 Ga0070683_100031801 Ga0070683_1000318014 389
447 3300005339 Ga0070660_100005373 Ga0070660_1000053734 389
448 3300005343 Ga0070687_100029310 Ga0070687_1000293102 389
449 3300005344 Ga0070661_100045758 Ga0070661_1000457581 389
450 3300005354 Ga0070675_100024723 Ga0070675_1000247233 389
451 3300005364 Ga0070673_100027828 Ga0070673_1000278284 389
452 3300005366 Ga0070659_100097630 Ga0070659_1000976302 389
453 3300005455 Ga0070663_100116137 Ga0070663_1001161371 389
454 3300005458 Ga0070681_10099859 Ga0070681_100998592 389
455 3300005466 Ga0070685_10058704 Ga0070685_100587041 389
456 3300005530 Ga0070679_100075979 Ga0070679_1000759792 389
457 3300005535 Ga0070684_100067567 Ga0070684_1000675673 389
458 3300005544 Ga0070686_100017466 Ga0070686_1000174662 389
459 3300005546 Ga0070696_100016286 Ga0070696_1000162863 389
460 3300005617 Ga0068859_100243315 Ga0068859_1002433152 389
461 3300005843 Ga0068860_100347317 Ga0068860_1003473171 389
462 3300005844 Ga0068862_100194240 Ga0068862_1001942402 389
463 3300006163 Ga0070715_10023294 Ga0070715_100232942 389
464 3300006175 Ga0070712_100031810 Ga0070712_1000318102 389
465 3300006881 Ga0068865_100017155 Ga0068865_1000171552 389
466 3300006931 Ga0097620_100243324 Ga0097620_1002433241 389
467 3300020081 Ga0206354_10461789 Ga0206354_104617892 389
468 3300025908 Ga0207643_10014840 Ga0207643_100148403 389
469 3300025915 Ga0207693_10019629 Ga0207693_100196292 389
470 3300025918 Ga0207662_10011077 Ga0207662_100110774 389
471 3300025919 Ga0207657_10011980 Ga0207657_100119805 389
472 3300025926 Ga0207659_10135527 Ga0207659_101355272 389
473 3300025928 Ga0207700_10020740 Ga0207700_100207404 389
474 3300025929 Ga0207664_10057055 Ga0207664_100570552 389
475 3300025933 Ga0207706_10064653 Ga0207706_100646532 389
476 3300025935 Ga0207709_10095232 Ga0207709_100952321 389
477 3300025939 Ga0207665_10077539 Ga0207665_100775392 389
478 3300025940 Ga0207691_10032142 Ga0207691_100321422 389
479 3300025942 Ga0207689_10014165 Ga0207689_100141654 389
480 3300026067 Ga0207678_10002087 Ga0207678_100020874 389
481 3300026078 Ga0207702_10057955 Ga0207702_100579551 389
482 3300026088 Ga0207641_10110948 Ga0207641_101109481 389
483 3300026089 Ga0207648_10117829 Ga0207648_101178292 389
484 3300026116 Ga0207674_10008689 Ga0207674_100086894 389
485 3300026118 Ga0207675_100043939 Ga0207675_1000439391 389
486 3300026121 Ga0207683_10004774 Ga0207683_1000477410 389
487 3300035089 Ga0373944_0006627 Ga0373944_0006627_1475_2644 389
488 3300035116 Ga0373945_0003531 Ga0373945_0003531_935_2104 389
489 3300035170 Ga0373943_0002803 Ga0373943_0002803_2260_3429 389
490 3300035171 Ga0373946_0001182 Ga0373946_0001182_4486_5655 389
491 3300035692 Ga0373935_0015848 Ga0373935_0015848_795_1964 389
492 3300035695 Ga0373927_0009962 Ga0373927_0009962_720_1889 389
493 3300035725 Ga0373947_0003478 Ga0373947_0003478_4486_5655 389
494 3300037068 Ga0373925_0007200 Ga0373925_0007200_4765_5934 389
495 3300037853 Ga0436364_0035159 Ga0436364_0035159_259_1455 389
496 3300046461 Ga0495641_0038546 Ga0495641_0038546_131_1300 389
497 3300046463 Ga0495653_0012654 Ga0495653_0012654_3805_4974 389
498 3300046475 Ga0495639_0025036 Ga0495639_0025036_93_1262 389
499 3300046477 Ga0495664_0001662 Ga0495664_0001662_7028_8197 389
500 3300046511 Ga0495608_0046780 Ga0495608_0046780_383_1552 389
501 3300046529 Ga0495652_0031841 Ga0495652_0031841_2049_3218 389
502 3300046531 Ga0495665_0033373 Ga0495665_0033373_287_1456 389
503 3300046536 Ga0495587_0012853 Ga0495587_0012853_2686_3855 389
504 3300046559 Ga0495667_0002703 Ga0495667_0002703_3477_4646 389
505 3300046663 Ga0495635_0036050 Ga0495635_0036050_1340_2509 389
506 3300046675 Ga0495657_0102431 Ga0495657_0102431_224_1393 389
507 3300046678 Ga0495599_0016378 Ga0495599_0016378_1758_2927 389
508 3300046681 Ga0495647_0061712 Ga0495647_0061712_164_1333 389
509 3300047319 Ga0495674_0003598 Ga0495674_0003598_9418_10587 389
510 3300047322 Ga0495680_0017002 Ga0495680_0017002_430_1599 389
511 3300047471 Ga0495684_0035792 Ga0495684_0035792_1016_2185 389
512 3300048912 Ga0496109_0257107 Ga0496109_0257107_232_1401 389
513 3300053085 Ga0495619_0193686 Ga0495619_0193686_180_1349 389

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02222

ATP-grasp

ATP-grasp domain

154

322

0.96

PF17769

PurK_C

Phosphoribosylaminoimidazole carboxylase C-terminal domain

349

407

0.91

PF22660

RS_preATP-grasp-like

Ribonucleotide synthetase preATP-grasp domain

43

145

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k5h-assembly1.cif.gz_B crystal structure of carboxyaminoimidazole ribonucleotide synthase from asperigillus clavatus complexed with atp 0.9349 14 381
3aw8-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 0.9275 16 383
3qff-assembly1.cif.gz_B crystal structure of adp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase 0.9232 13 382
4ma0-assembly1.cif.gz_A the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp 0.9223 17 379
3k5i-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole synthase from aspergillus clavatus in complex with adp and 5-aminoimadazole ribonucleotide 0.9223 14 381
ID Description Score Start End Superfamily
af_P9WHL9_13_120_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9867 14 117 3.40.50.20
af_P9WHL9_202_394_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9796 195 381 3.30.470.20
af_A0A1D6M0Q5_75_186_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.956 15 120 3.40.50.20
af_P9WHL9_202_394_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9446 195 381 3.30.470.20
af_P9WHL9_13_120_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9419 14 117 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A263DA78-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) 0.9841 15 381 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034028
GO:0046872
AF-A0A6A9UUW8-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase) 0.9829 14 382 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034028
GO:0046872
AF-A0A2N3FB30-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide synthase 0.9822 193 385 GO:0003824
GO:0005524
GO:0005829
GO:0046872
AF-H0BAX1-F1-model_v4 Phosphoribosylaminoimidazole carboxylase ATPase subunit 0.9815 157 382 GO:0003824
GO:0005524
GO:0005829
GO:0006164
GO:0046872
AF-A0A850CE45-F1-model_v4 ATP-grasp domain-containing protein 0.9806 15 217 GO:0003824
GO:0005524
GO:0005829
GO:0006164
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.03 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map