F456532

General Info

Members Datasets Scaffolds Average Seq Length
506 238 495 266

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10131757|Ga0207688_101317572
Length 305
Sequence MRTPAPGDMICGMARQDRLRRISQAHDRRRPGRPGRAVAIMMPLWDLHRGDGPLIVNVPHAGTFAPPAIAARLTTAGQAWPDTDWHVEKLYAFARDEGATLLCATHSRYVVDLNRDPSGAALYAGADNTEVCPTRTFANEPIYEEGGAPAQEESVHRIAAYFWPYHDTLAAEIERVRARHGYAVLLDGHSIRSEVPRFFAGRLPDLNLGTADGASCAPALQAQAADVLAGANGLTHVVNGRFKGGWITRRYGRPAEGVHALQLEVGQRCYMDEAPPYPWDAKRATALSDVLRKLVAVLAAWRPPA

Samples

Sample ID Description Type Environment
1 2643221734 Bosea sp. Root670 Isolate Unclassified
2 2643221736 Bosea sp. Root483D1 Isolate Unclassified
3 2818991467 Bosea vestrisii 3192 Isolate Unclassified
4 2841760612 Bosea sp. Tri-49 Isolate Nodule
5 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
6 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
7 2844104063 Bosea sp. Tri-39 Isolate Nodule
8 2851182111 Bosea sp. Tri-44 Isolate Nodule
9 2851246043 Bosea sp. Tri-54 Isolate Nodule
10 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 1.38
Rhizoplane 3.75
Rhizosphere 85.57
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000018 3300003187 Bacteria 238438
2 Ga0055526_1001056 3300003771 Bacteria 20118
3 Ga0055526_1002567 3300003771 Bacteria 12179
4 Ga0055524_1000048 3300003775 Bacteria 149598
5 Ga0055524_1009451 3300003775 Bacteria 3962
6 Ga0065165_1000062 3300005262 Bacteria 178885
7 Ga0070658_10447455 3300005327 Bacteria 1113
8 Ga0070676_10006880 3300005328 Bacteria 6089
9 Ga0070676_10249893 3300005328 Bacteria 1183
10 Ga0070683_100012992 3300005329 Bacteria 7248
11 Ga0070690_100037239 3300005330 Bacteria 3065
12 Ga0070690_100291460 3300005330 Bacteria 1167
13 Ga0070670_100003749 3300005331 Bacteria 12653
14 Ga0070670_100023561 3300005331 Bacteria 5299
15 Ga0070670_100040074 3300005331 Bacteria 4029
16 Ga0070670_100047725 3300005331 Bacteria 3685
17 Ga0070670_100058151 3300005331 Bacteria 3319
18 Ga0070670_100070298 3300005331 Bacteria 3005
19 Ga0070670_100233648 3300005331 Bacteria 1600
20 Ga0070670_100446162 3300005331 Bacteria 1146
21 Ga0070670_100633668 3300005331 Bacteria 958
22 Ga0070677_10007016 3300005333 Bacteria 3748
23 Ga0070677_10010629 3300005333 Bacteria 3152
24 Ga0068869_100000926 3300005334 Bacteria 16926
25 Ga0068869_100030096 3300005334 Bacteria 3808
26 Ga0068869_100035343 3300005334 Bacteria 3541
27 Ga0068869_100161235 3300005334 Bacteria 1746
28 Ga0070666_10005904 3300005335 Bacteria 7520
29 Ga0070666_10008121 3300005335 Bacteria 6500
30 Ga0070666_10216679 3300005335 Bacteria 1349
31 Ga0070680_100145255 3300005336 Bacteria 1990
32 Ga0068868_100003652 3300005338 Bacteria 10741
33 Ga0068868_100010424 3300005338 Bacteria 6729
34 Ga0068868_100127380 3300005338 Bacteria 2081
35 Ga0070660_100000940 3300005339 Bacteria 19449
36 Ga0070660_100035806 3300005339 Bacteria 3757
37 Ga0070660_100194222 3300005339 Bacteria 1645
38 Ga0070689_100012276 3300005340 Bacteria 6165
39 Ga0070689_100061506 3300005340 Bacteria 2921
40 Ga0070687_100002271 3300005343 Bacteria 7135
41 Ga0070661_100002505 3300005344 Bacteria 12584
42 Ga0070661_100015498 3300005344 Bacteria 5379
43 Ga0070661_100206447 3300005344 Bacteria 1502
44 Ga0070692_10180786 3300005345 Bacteria 1222
45 Ga0070668_100000779 3300005347 Bacteria 21987
46 Ga0070668_100005217 3300005347 Bacteria 9636
47 Ga0070668_100009357 3300005347 Bacteria 7268
48 Ga0070668_100016106 3300005347 Bacteria 5594
49 Ga0070668_100038163 3300005347 Bacteria 3670
50 Ga0070668_100046636 3300005347 Bacteria 3329
51 Ga0070668_100104673 3300005347 Bacteria 2246
52 Ga0070669_100000668 3300005353 Bacteria 25208
53 Ga0070669_100005376 3300005353 Bacteria 9242
54 Ga0070669_100075780 3300005353 Bacteria 2496
55 Ga0070669_100127502 3300005353 Bacteria 1949
56 Ga0070669_100608637 3300005353 Bacteria 916
57 Ga0070675_100009190 3300005354 Bacteria 7676
58 Ga0070675_100013475 3300005354 Bacteria 6425
59 Ga0070671_100334255 3300005355 Bacteria 1292
60 Ga0070671_100341903 3300005355 Bacteria 1277
61 Ga0070674_100000737 3300005356 Bacteria 16729
62 Ga0070674_100020370 3300005356 Bacteria 4236
63 Ga0070674_100177338 3300005356 Unclassified 1629
64 Ga0070673_100000729 3300005364 Bacteria 18191
65 Ga0070673_100023220 3300005364 Bacteria 4530
66 Ga0070673_100078160 3300005364 Bacteria 2676
67 Ga0070673_100156232 3300005364 Bacteria 1936
68 Ga0070688_100004856 3300005365 Bacteria 7031
69 Ga0070688_100387721 3300005365 Bacteria 1031
70 Ga0070659_100050635 3300005366 Bacteria 3264
71 Ga0070659_100058232 3300005366 Bacteria 3048
72 Ga0070659_100169717 3300005366 Bacteria 1787
73 Ga0070659_100179956 3300005366 Bacteria 1735
74 Ga0070667_100001232 3300005367 Bacteria 23249
75 Ga0070667_100335688 3300005367 Bacteria 1366
76 Ga0070667_100489845 3300005367 Bacteria 1126
77 Ga0070709_10076017 3300005434 Bacteria 2180
78 Ga0070714_100092767 3300005435 Bacteria 2647
79 Ga0070701_10021305 3300005438 Bacteria 3091
80 Ga0070700_100106860 3300005441 Bacteria 1854
81 Ga0070708_100000538 3300005445 Bacteria 28503
82 Ga0070663_100140704 3300005455 Bacteria 1842
83 Ga0070678_100001539 3300005456 Bacteria 12334
84 Ga0070678_100029519 3300005456 Bacteria 3756
85 Ga0070678_100049763 3300005456 Bacteria 3026
86 Ga0070678_100225656 3300005456 Bacteria 1559
87 Ga0070662_100010358 3300005457 Bacteria 6114
88 Ga0070662_100226831 3300005457 Bacteria 1493
89 Ga0070681_10023269 3300005458 Bacteria 6230
90 Ga0068867_100001858 3300005459 Bacteria 14677
91 Ga0068867_100034757 3300005459 Bacteria 3655
92 Ga0068867_100105399 3300005459 Bacteria 2159
93 Ga0068867_100499268 3300005459 Bacteria 1045
94 Ga0070685_10012098 3300005466 Bacteria 4526
95 Ga0070685_10201482 3300005466 Bacteria 1294
96 Ga0070679_100137945 3300005530 Bacteria 2420
97 Ga0068853_100016729 3300005539 Bacteria 6040
98 Ga0068853_100033649 3300005539 Bacteria 4349
99 Ga0068853_100097982 3300005539 Bacteria 2589
100 Ga0070672_100000287 3300005543 Bacteria 28567
101 Ga0070672_100001456 3300005543 Bacteria 14663
102 Ga0070672_100120768 3300005543 Bacteria 2144
103 Ga0070672_100152639 3300005543 Bacteria 1911
104 Ga0070672_100454706 3300005543 Bacteria 1103
105 Ga0070686_100045474 3300005544 Bacteria 2765
106 Ga0070696_100250046 3300005546 Bacteria 1340
107 Ga0070693_100023562 3300005547 Bacteria 3292
108 Ga0070693_100077306 3300005547 Bacteria 1975
109 Ga0070665_100012851 3300005548 Bacteria 8429
110 Ga0070665_100090878 3300005548 Bacteria 3059
111 Ga0070665_100491048 3300005548 Bacteria 1239
112 Ga0070665_100508358 3300005548 Bacteria 1216
113 Ga0070704_100510893 3300005549 Bacteria 1044
114 Ga0068855_100021114 3300005563 Bacteria 7808
115 Ga0068855_100054928 3300005563 Bacteria 4679
116 Ga0068855_100195862 3300005563 Bacteria 2276
117 Ga0070664_100025762 3300005564 Bacteria 4876
118 Ga0070664_100084880 3300005564 Bacteria 2734
119 Ga0070664_100098008 3300005564 Bacteria 2546
120 Ga0070664_100102003 3300005564 Bacteria 2496
121 Ga0070664_100398613 3300005564 Unclassified 1258
122 Ga0068857_100006994 3300005577 Bacteria 9707
123 Ga0068857_100014442 3300005577 Bacteria 6888
124 Ga0068857_100070471 3300005577 Bacteria 3114
125 Ga0068857_100165704 3300005577 Bacteria 2007
126 Ga0068854_100018173 3300005578 Bacteria 4716
127 Ga0068854_100030709 3300005578 Bacteria 3729
128 Ga0068854_100054950 3300005578 Bacteria 2866
129 Ga0068854_100074011 3300005578 Bacteria 2498
130 Ga0068856_100003384 3300005614 Bacteria 16150
131 Ga0068856_100164595 3300005614 Bacteria 2229
132 Ga0070702_100055611 3300005615 Bacteria 2282
133 Ga0068852_100001607 3300005616 Bacteria 15383
134 Ga0068852_100001757 3300005616 Bacteria 14754
135 Ga0068852_100007039 3300005616 Bacteria 8191
136 Ga0068852_100049718 3300005616 Bacteria 3588
137 Ga0068852_100741480 3300005616 Bacteria 994
138 Ga0068859_100004806 3300005617 Bacteria 13755
139 Ga0068859_100040552 3300005617 Bacteria 4673
140 Ga0068859_100052884 3300005617 Bacteria 4084
141 Ga0068859_100752712 3300005617 Bacteria 1063
142 Ga0068864_100001285 3300005618 Bacteria 20888
143 Ga0068864_100008284 3300005618 Bacteria 8574
144 Ga0068864_100054096 3300005618 Bacteria 3464
145 Ga0068864_100246502 3300005618 Bacteria 1657
146 Ga0068866_10124373 3300005718 Bacteria 1458
147 Ga0068861_100030445 3300005719 Bacteria 3955
148 Ga0068861_100101839 3300005719 Bacteria 2285
149 Ga0068861_100146315 3300005719 Bacteria 1934
150 Ga0068861_100160578 3300005719 Bacteria 1853
151 Ga0068851_10002374 3300005834 Bacteria 8270
152 Ga0068851_10080831 3300005834 Bacteria 1697
153 Ga0068870_10001701 3300005840 Bacteria 8995
154 Ga0068870_10002898 3300005840 Bacteria 7229
155 Ga0068870_10021789 3300005840 Bacteria 3140
156 Ga0068863_100005435 3300005841 Bacteria 12549
157 Ga0068863_100007038 3300005841 Bacteria 11021
158 Ga0068863_100007445 3300005841 Bacteria 10713
159 Ga0068863_100324512 3300005841 Bacteria 1496
160 Ga0068858_100030372 3300005842 Bacteria 5017
161 Ga0068858_100034495 3300005842 Bacteria 4694
162 Ga0068858_100138789 3300005842 Bacteria 2282
163 Ga0068860_100005493 3300005843 Bacteria 12840
164 Ga0068860_100017730 3300005843 Bacteria 6935
165 Ga0068860_100035344 3300005843 Bacteria 4792
166 Ga0068860_100262593 3300005843 Bacteria 1683
167 Ga0068862_100006542 3300005844 Bacteria 9671
168 Ga0068862_100073377 3300005844 Bacteria 2957
169 Ga0068862_100225520 3300005844 Bacteria 1698
170 Ga0075368_10006065 3300006042 Bacteria 4200
171 Ga0075363_100013355 3300006048 Bacteria 3977
172 Ga0070716_100238351 3300006173 Bacteria 1232
173 Ga0075362_10068508 3300006177 Bacteria 1616
174 Ga0075366_10023116 3300006195 Bacteria 3621
175 Ga0097621_100001308 3300006237 Bacteria 17135
176 Ga0097621_100393040 3300006237 Bacteria 1240
177 Ga0075370_10014087 3300006353 Bacteria 4259
178 Ga0068871_100001077 3300006358 Bacteria 18307
179 Ga0068871_100161240 3300006358 Bacteria 1918
180 Ga0068871_100199050 3300006358 Bacteria 1729
181 Ga0068871_100295907 3300006358 Bacteria 1419
182 Ga0075428_100104144 3300006844 Bacteria 3094
183 Ga0075433_10244429 3300006852 Bacteria 1593
184 Ga0068865_100113104 3300006881 Bacteria 2006
185 Ga0097620_100004806 3300006931 Bacteria 13755
186 Ga0097620_100040550 3300006931 Bacteria 4673
187 Ga0097620_100052888 3300006931 Bacteria 4084
188 Ga0097620_100752747 3300006931 Bacteria 1063
189 Ga0105240_10002428 3300009093 Bacteria 29958
190 Ga0105245_10241799 3300009098 Bacteria 1750
191 Ga0105243_10182802 3300009148 Bacteria 1825
192 Ga0105243_10271154 3300009148 Bacteria 1524
193 Ga0105241_10022261 3300009174 Bacteria 4692
194 Ga0105242_10042406 3300009176 Bacteria 3674
195 Ga0105242_10044438 3300009176 Bacteria 3598
196 Ga0105248_10002074 3300009177 Bacteria 22178
197 Ga0105248_10323351 3300009177 Bacteria 1737
198 Ga0105248_10642683 3300009177 Bacteria 1197
199 Ga0105237_10330965 3300009545 Bacteria 1527
200 Ga0105238_10001044 3300009551 Bacteria 28027
201 Ga0105249_10053405 3300009553 Bacteria 3693
202 Ga0105239_10426412 3300010375 Bacteria 1503
203 Ga0105246_10090883 3300011119 Bacteria 2199
204 Ga0105246_10677933 3300011119 Unclassified 901
205 Ga0157370_10015688 3300013104 Bacteria 7695
206 Ga0157369_10014238 3300013105 Bacteria 8986
207 Ga0171462_1009 3300013250 Bacteria 344993
208 Ga0157374_10001312 3300013296 Bacteria 21166
209 Ga0157374_10003097 3300013296 Bacteria 13957
210 Ga0157374_10048388 3300013296 Bacteria 3945
211 Ga0157374_10903612 3300013296 Bacteria 901
212 Ga0157378_10029765 3300013297 Bacteria 4821
213 Ga0157378_10183501 3300013297 Bacteria 1969
214 Ga0157378_10240073 3300013297 Bacteria 1730
215 Ga0163162_10005459 3300013306 Bacteria 12283
216 Ga0163162_10401407 3300013306 Bacteria 1503
217 Ga0157372_10004393 3300013307 Bacteria 15042
218 Ga0157375_10002469 3300013308 Bacteria 16013
219 Ga0157375_10004713 3300013308 Bacteria 11862
220 Ga0157375_10052859 3300013308 Bacteria 3995
221 Ga0157375_10075973 3300013308 Bacteria 3385
222 Ga0157375_10220013 3300013308 Bacteria 2057
223 Ga0157375_10442930 3300013308 Bacteria 1465
224 Ga0163163_10016698 3300014325 Bacteria 6827
225 Ga0163163_10180571 3300014325 Bacteria 2157
226 Ga0157380_10008656 3300014326 Bacteria 7274
227 Ga0157380_10012745 3300014326 Bacteria 6105
228 Ga0157380_10059234 3300014326 Bacteria 3055
229 Ga0157380_10289124 3300014326 Bacteria 1504
230 Ga0157377_10031200 3300014745 Bacteria 2894
231 Ga0157379_10000858 3300014968 Bacteria 24649
232 Ga0157379_10003487 3300014968 Bacteria 13323
233 Ga0157379_10119043 3300014968 Bacteria 2375
234 Ga0157376_10012373 3300014969 Bacteria 6332
235 Ga0157376_10074505 3300014969 Bacteria 2894
236 Ga0157376_10117530 3300014969 Bacteria 2351
237 Ga0163161_10010199 3300017792 Bacteria 6504
238 Ga0163161_10021494 3300017792 Bacteria 4534
239 Ga0163161_10047569 3300017792 Bacteria 3097
240 Ga0213872_10064326 3300021361 Bacteria 1657
241 Ga0209673_1020163 3300025273 Bacteria 2369
242 Ga0209130_1000235 3300025284 Bacteria 71379
243 Ga0209675_1000239 3300025291 Bacteria 54796
244 Ga0209025_1000010 3300025294 Bacteria 986612
245 Ga0209025_1018750 3300025294 Bacteria 3896
246 Ga0209025_1024131 3300025294 Bacteria 3152
247 Ga0209025_1048588 3300025294 Bacteria 1718
248 Ga0209564_1000019 3300025295 Bacteria 573686
249 Ga0209564_1000034 3300025295 Bacteria 444284
250 Ga0209256_1000026 3300025299 Bacteria 432835
251 Ga0209256_1000182 3300025299 Bacteria 122471
252 Ga0207697_10000414 3300025315 Bacteria 24140
253 Ga0207656_10008813 3300025321 Bacteria 3730
254 Ga0207656_10028284 3300025321 Bacteria 2300
255 Ga0207682_10001566 3300025893 Bacteria 10511
256 Ga0207682_10007385 3300025893 Bacteria 4381
257 Ga0207688_10001416 3300025901 Bacteria 12500
258 Ga0207688_10131757 3300025901 Bacteria 1466
259 Ga0207680_10000458 3300025903 Bacteria 19273
260 Ga0207680_10191932 3300025903 Bacteria 1387
261 Ga0207699_10231547 3300025906 Bacteria 1266
262 Ga0207645_10000308 3300025907 Bacteria 41052
263 Ga0207645_10000661 3300025907 Bacteria 28611
264 Ga0207643_10000515 3300025908 Bacteria 24751
265 Ga0207643_10005399 3300025908 Bacteria 6841
266 Ga0207643_10017207 3300025908 Bacteria 3950
267 Ga0207643_10136125 3300025908 Bacteria 1464
268 Ga0207707_10106830 3300025912 Bacteria 2447
269 Ga0207693_10330001 3300025915 Bacteria 1194
270 Ga0207660_10402337 3300025917 Bacteria 1103
271 Ga0207662_10007274 3300025918 Bacteria 6019
272 Ga0207657_10019674 3300025919 Bacteria 6402
273 Ga0207657_10022078 3300025919 Bacteria 5973
274 Ga0207657_10164626 3300025919 Bacteria 1799
275 Ga0207649_10069130 3300025920 Bacteria 2248
276 Ga0207649_10244663 3300025920 Bacteria 1289
277 Ga0207652_10108831 3300025921 Bacteria 2456
278 Ga0207681_10013968 3300025923 Bacteria 4976
279 Ga0207681_10032962 3300025923 Bacteria 3394
280 Ga0207681_10042165 3300025923 Bacteria 3047
281 Ga0207681_10116360 3300025923 Bacteria 1953
282 Ga0207681_10169549 3300025923 Bacteria 1653
283 Ga0207694_10009651 3300025924 Bacteria 7276
284 Ga0207650_10005013 3300025925 Bacteria 9045
285 Ga0207650_10033665 3300025925 Bacteria 3712
286 Ga0207650_10068239 3300025925 Bacteria 2670
287 Ga0207650_10099075 3300025925 Bacteria 2240
288 Ga0207650_10339861 3300025925 Bacteria 1233
289 Ga0207659_10001947 3300025926 Bacteria 12255
290 Ga0207659_10006871 3300025926 Bacteria 6998
291 Ga0207659_10009786 3300025926 Bacteria 5997
292 Ga0207644_10004658 3300025931 Bacteria 8914
293 Ga0207644_10011516 3300025931 Bacteria 5855
294 Ga0207644_10018704 3300025931 Bacteria 4690
295 Ga0207644_10058309 3300025931 Bacteria 2790
296 Ga0207644_10112707 3300025931 Bacteria 2059
297 Ga0207644_10185620 3300025931 Bacteria 1632
298 Ga0207690_10014956 3300025932 Bacteria 4699
299 Ga0207690_10077309 3300025932 Bacteria 2313
300 Ga0207690_10095013 3300025932 Bacteria 2117
301 Ga0207690_10307952 3300025932 Bacteria 1241
302 Ga0207706_10003433 3300025933 Bacteria 15131
303 Ga0207706_10049200 3300025933 Bacteria 3726
304 Ga0207686_10023568 3300025934 Bacteria 3557
305 Ga0207709_10107197 3300025935 Bacteria 1860
306 Ga0207670_10023785 3300025936 Bacteria 3819
307 Ga0207670_10049705 3300025936 Bacteria 2806
308 Ga0207670_10231592 3300025936 Bacteria 1419
309 Ga0207669_10010269 3300025937 Bacteria 4501
310 Ga0207669_10021749 3300025937 Bacteria 3393
311 Ga0207669_10026018 3300025937 Bacteria 3174
312 Ga0207669_10083275 3300025937 Bacteria 2057
313 Ga0207704_10007203 3300025938 Bacteria 5238
314 Ga0207704_10040324 3300025938 Bacteria 2728
315 Ga0207665_10238818 3300025939 Bacteria 1338
316 Ga0207691_10000249 3300025940 Bacteria 53276
317 Ga0207691_10001733 3300025940 Bacteria 21505
318 Ga0207691_10023071 3300025940 Bacteria 5861
319 Ga0207691_10259259 3300025940 Bacteria 1499
320 Ga0207691_10428016 3300025940 Bacteria 1127
321 Ga0207711_10015621 3300025941 Bacteria 6298
322 Ga0207711_10328908 3300025941 Bacteria 1413
323 Ga0207689_10002125 3300025942 Bacteria 18643
324 Ga0207689_10003129 3300025942 Bacteria 15185
325 Ga0207689_10006079 3300025942 Bacteria 10675
326 Ga0207689_10077369 3300025942 Bacteria 2735
327 Ga0207689_10269273 3300025942 Bacteria 1410
328 Ga0207661_10319838 3300025944 Bacteria 1395
329 Ga0207661_10514393 3300025944 Bacteria 1094
330 Ga0207679_10033811 3300025945 Bacteria 3601
331 Ga0207679_10054877 3300025945 Bacteria 2935
332 Ga0207679_10134935 3300025945 Bacteria 1986
333 Ga0207679_10306697 3300025945 Bacteria 1370
334 Ga0207679_10479547 3300025945 Unclassified 1107
335 Ga0207667_10005138 3300025949 Bacteria 15985
336 Ga0207667_10049514 3300025949 Bacteria 4437
337 Ga0207667_10160958 3300025949 Bacteria 2309
338 Ga0207651_10006581 3300025960 Bacteria 6103
339 Ga0207651_10073054 3300025960 Bacteria 2437
340 Ga0207651_10114070 3300025960 Bacteria 2035
341 Ga0207651_10129294 3300025960 Bacteria 1930
342 Ga0207651_10151536 3300025960 Bacteria 1805
343 Ga0207712_10209738 3300025961 Bacteria 1550
344 Ga0207668_10002554 3300025972 Bacteria 10635
345 Ga0207668_10005847 3300025972 Bacteria 7243
346 Ga0207668_10013549 3300025972 Bacteria 5026
347 Ga0207668_10035407 3300025972 Bacteria 3323
348 Ga0207668_10085662 3300025972 Bacteria 2300
349 Ga0207668_10134559 3300025972 Bacteria 1892
350 Ga0207668_10275826 3300025972 Bacteria 1376
351 Ga0207668_10288337 3300025972 Bacteria 1349
352 Ga0207640_10050889 3300025981 Bacteria 2690
353 Ga0207658_10001272 3300025986 Bacteria 19944
354 Ga0207658_10022052 3300025986 Bacteria 4429
355 Ga0207658_10087701 3300025986 Bacteria 2403
356 Ga0207658_10096788 3300025986 Bacteria 2303
357 Ga0207658_10198865 3300025986 Unclassified 1672
358 Ga0207658_10262189 3300025986 Bacteria 1473
359 Ga0207677_10001441 3300026023 Bacteria 12630
360 Ga0207677_10007009 3300026023 Bacteria 6201
361 Ga0207677_10127016 3300026023 Bacteria 1929
362 Ga0207703_10007973 3300026035 Bacteria 8370
363 Ga0207703_10011900 3300026035 Bacteria 6776
364 Ga0207703_10465575 3300026035 Bacteria 1183
365 Ga0207639_10038520 3300026041 Bacteria 3556
366 Ga0207639_10238296 3300026041 Bacteria 1580
367 Ga0207678_10013575 3300026067 Bacteria 7152
368 Ga0207678_10106194 3300026067 Bacteria 2396
369 Ga0207678_10144812 3300026067 Bacteria 2028
370 Ga0207708_10173582 3300026075 Bacteria 1708
371 Ga0207708_10429752 3300026075 Bacteria 1097
372 Ga0207702_10009250 3300026078 Bacteria 8280
373 Ga0207641_10000374 3300026088 Bacteria 53088
374 Ga0207641_10012062 3300026088 Bacteria 7089
375 Ga0207641_10026060 3300026088 Bacteria 4824
376 Ga0207641_10028677 3300026088 Bacteria 4601
377 Ga0207641_10076588 3300026088 Bacteria 2892
378 Ga0207641_10140897 3300026088 Bacteria 2175
379 Ga0207641_10223185 3300026088 Bacteria 1748
380 Ga0207641_10232145 3300026088 Bacteria 1715
381 Ga0207641_10297679 3300026088 Bacteria 1523
382 Ga0207648_10000523 3300026089 Bacteria 42961
383 Ga0207648_10002934 3300026089 Bacteria 18047
384 Ga0207648_10029738 3300026089 Bacteria 4844
385 Ga0207648_10038007 3300026089 Bacteria 4237
386 Ga0207648_10093524 3300026089 Bacteria 2629
387 Ga0207648_10098829 3300026089 Bacteria 2555
388 Ga0207676_10012004 3300026095 Bacteria 6199
389 Ga0207676_10017764 3300026095 Bacteria 5161
390 Ga0207676_10055793 3300026095 Bacteria 3103
391 Ga0207676_10296358 3300026095 Unclassified 1475
392 Ga0207674_10000118 3300026116 Bacteria 92408
393 Ga0207674_10004098 3300026116 Bacteria 17651
394 Ga0207674_10036123 3300026116 Bacteria 5152
395 Ga0207674_10103685 3300026116 Bacteria 2823
396 Ga0207675_100000635 3300026118 Bacteria 34445
397 Ga0207675_100002219 3300026118 Bacteria 19296
398 Ga0207675_100027244 3300026118 Bacteria 5323
399 Ga0207675_100215225 3300026118 Bacteria 1849
400 Ga0207675_100342860 3300026118 Bacteria 1463
401 Ga0207675_100370411 3300026118 Bacteria 1407
402 Ga0207675_100500280 3300026118 Bacteria 1210
403 Ga0207683_10000476 3300026121 Bacteria 37318
404 Ga0207683_10000672 3300026121 Bacteria 31425
405 Ga0207683_10002112 3300026121 Bacteria 17478
406 Ga0207683_10025522 3300026121 Bacteria 5099
407 Ga0207683_10325189 3300026121 Bacteria 1409
408 Ga0207698_10412923 3300026142 Bacteria 1293
409 Ga0207698_10415004 3300026142 Bacteria 1290
410 Ga0207698_10516654 3300026142 Bacteria 1165
411 Ga0209971_1034506 3300027682 Bacteria 1216
412 Ga0209813_10002939 3300027866 Bacteria 3945
413 Ga0209974_10031769 3300027876 Bacteria 1749
414 Ga0268266_10005562 3300028379 Bacteria 11729
415 Ga0268266_10122479 3300028379 Bacteria 2316
416 Ga0268266_10334000 3300028379 Bacteria 1421
417 Ga0268265_10006395 3300028380 Bacteria 7985
418 Ga0268265_10007463 3300028380 Bacteria 7384
419 Ga0268265_10206294 3300028380 Bacteria 1709
420 Ga0268265_10247883 3300028380 Bacteria 1576
421 Ga0268265_10550497 3300028380 Bacteria 1095
422 Ga0268264_10002850 3300028381 Bacteria 15079
423 Ga0268264_10035616 3300028381 Bacteria 4097
424 Ga0268264_10599710 3300028381 Bacteria 1085
425 Ga0265330_10029055 3300031235 Bacteria 2488
426 Ga0265325_10001765 3300031241 Bacteria 14982
427 Ga0265339_10011970 3300031249 Bacteria 5316
428 Ga0265316_10050931 3300031344 Bacteria 3255
429 Ga0265314_10065716 3300031711 Bacteria 2449
430 Ga0307405_10003090 3300031731 Bacteria 7556
431 Ga0307413_10023009 3300031824 Bacteria 3370
432 Ga0307410_10025239 3300031852 Bacteria 3725
433 Ga0307406_10006314 3300031901 Bacteria 6536
434 Ga0307406_10365151 3300031901 Bacteria 1133
435 Ga0307407_10050317 3300031903 Bacteria 2383
436 Ga0307412_10005056 3300031911 Bacteria 7373
437 Ga0307409_100000504 3300031995 Bacteria 16863
438 Ga0307416_100034762 3300032002 Bacteria 3840
439 Ga0307416_100309559 3300032002 Bacteria 1575
440 Ga0307411_10008803 3300032005 Bacteria 5254
441 Ga0307507_10042998 3300033179 Bacteria 4491
442 Ga0373939_0111890 3300035114 Bacteria 952
443 Ga0373955_0344122 3300035172 Bacteria 902
444 Ga0373924_0001169 3300035410 Bacteria 8430
445 Ga0373933_0052689 3300035724 Bacteria 2436
446 Ga0373933_0124889 3300035724 Bacteria 1614
447 Ga0373947_0109402 3300035725 Bacteria 1745
448 Ga0373947_0398981 3300035725 Bacteria 927
449 Ga0495606_0008981 3300046507 Bacteria 8549
450 Ga0495643_0079168 3300046522 Bacteria 1714
451 Ga0495686_0001810 3300047472 Bacteria 21581
452 Ga0496100_0455593 3300048903 Bacteria 981
453 Ga0496101_0005009 3300048904 Bacteria 8416
454 Ga0496101_0075703 3300048904 Bacteria 2478
455 Ga0496102_0034110 3300048905 Bacteria 4577
456 Ga0496102_0190732 3300048905 Bacteria 1931
457 Ga0496103_0201467 3300048906 Bacteria 1280
458 Ga0496104_0021708 3300048907 Bacteria 5897
459 Ga0496104_0398410 3300048907 Bacteria 1289
460 Ga0496105_0007050 3300048908 Bacteria 8663
461 Ga0496106_0011048 3300048909 Bacteria 6675
462 Ga0496107_0034684 3300048910 Bacteria 3615
463 Ga0496108_0004760 3300048911 Bacteria 10940
464 Ga0496108_0420528 3300048911 Bacteria 1167
465 Ga0496109_0046869 3300048912 Bacteria 3927
466 Ga0496109_0135071 3300048912 Bacteria 2304
467 Ga0496110_0007678 3300048913 Bacteria 8630
468 Ga0496113_0244567 3300048916 Bacteria 1432
469 Ga0496114_0014725 3300048917 Bacteria 6285
470 Ga0496114_0589351 3300048917 Bacteria 981
471 Ga0496117_0056498 3300048920 Bacteria 2733
472 Ga0496122_0055794 3300048925 Bacteria 2952
473 Ga0496123_0019134 3300048926 Bacteria 5406
474 Ga0496125_0059253 3300048928 Bacteria 3087
475 Ga0496126_0000823 3300048929 Bacteria 55212
476 Ga0501034_0340463 3300049571 Bacteria 1430
477 Ga0501037_0227244 3300049573 Bacteria 1311
478 Ga0501070_0115702 3300049586 Bacteria 2215
479 Ga0501071_0166408 3300049587 Bacteria 1650
480 Ga0501044_0024730 3300049823 Bacteria 6371
481 nmdc:mga03683_15428_c1 3300050489 Bacteria 2851
482 nmdc:mga03n38_976_c1 3300050490 Bacteria 7782
483 nmdc:mga00v17_31433_c1 3300050491 Bacteria 3131
484 nmdc:mga0yw44_63939_c1 3300050492 Bacteria 2264
485 nmdc:mga0k408_27226_c1 3300050493 Bacteria 3246
486 nmdc:mga06z11_2506_c1 3300050494 Bacteria 7025
487 nmdc:mga04h51_7355_c1 3300050495 Bacteria 2902
488 nmdc:mga07m45_1279_c2 3300050496 Bacteria 4652
489 nmdc:mga0sz30_11294_c1 3300050516 Bacteria 2994
490 Ga0500578_0168392 3300053086 Bacteria 1356
491 Ga0500588_0000211 3300053146 Bacteria 8154
492 Ga0500616_0028018 3300053153 Bacteria 3108
493 Ga0500622_0041856 3300053156 Bacteria 2382
494 Ga0500636_0019135 3300053177 Bacteria 4052
495 Ga0500645_011546 3300053730 Bacteria 2881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053177 Ga0500636_0019135 Ga0500636_0019135_2522_3235 235
2 3300009148 Ga0105243_10271154 Ga0105243_102711543 243
3 3300025294 Ga0209025_1024131 Ga0209025_10241312 243
4 3300031344 Ga0265316_10050931 Ga0265316_100509313 250
5 3300035172 Ga0373955_0344122 Ga0373955_0344122_17_784 250
6 3300025915 Ga0207693_10330001 Ga0207693_103300011 254
7 3300005262 Ga0065165_1000062 Ga0065165_100006222 259
8 3300005353 Ga0070669_100075780 Ga0070669_1000757802 259
9 3300005353 Ga0070669_100608637 Ga0070669_1006086371 259
10 3300005456 Ga0070678_100225656 Ga0070678_1002256562 259
11 3300005459 Ga0068867_100034757 Ga0068867_1000347575 259
12 3300005466 Ga0070685_10201482 Ga0070685_102014822 259
13 3300005719 Ga0068861_100101839 Ga0068861_1001018392 259
14 3300005844 Ga0068862_100225520 Ga0068862_1002255203 259
15 3300013308 Ga0157375_10442930 Ga0157375_104429301 259
16 3300014326 Ga0157380_10008656 Ga0157380_100086565 259
17 3300014326 Ga0157380_10289124 Ga0157380_102891243 259
18 3300017792 Ga0163161_10021494 Ga0163161_100214942 259
19 3300025284 Ga0209130_1000235 Ga0209130_100023555 259
20 3300025923 Ga0207681_10042165 Ga0207681_100421655 259
21 3300025986 Ga0207658_10096788 Ga0207658_100967883 259
22 3300026089 Ga0207648_10029738 Ga0207648_100297385 259
23 3300026118 Ga0207675_100027244 Ga0207675_1000272445 259
24 3300026118 Ga0207675_100342860 Ga0207675_1003428603 259
25 3300026121 Ga0207683_10025522 Ga0207683_100255223 259
26 3300026121 Ga0207683_10325189 Ga0207683_103251892 259
27 3300028380 Ga0268265_10550497 Ga0268265_105504972 259
28 3300031731 Ga0307405_10003090 Ga0307405_100030907 259
29 3300031824 Ga0307413_10023009 Ga0307413_100230093 259
30 3300031852 Ga0307410_10025239 Ga0307410_100252393 259
31 3300031901 Ga0307406_10006314 Ga0307406_100063144 259
32 3300031903 Ga0307407_10050317 Ga0307407_100503173 259
33 3300031911 Ga0307412_10005056 Ga0307412_100050563 259
34 3300031995 Ga0307409_100000504 Ga0307409_1000005047 259
35 3300032002 Ga0307416_100034762 Ga0307416_1000347623 259
36 3300032005 Ga0307411_10008803 Ga0307411_100088032 259
37 3300035410 Ga0373924_0001169 Ga0373924_0001169_4611_5399 259
38 3300005331 Ga0070670_100040074 Ga0070670_1000400743 260
39 3300005347 Ga0070668_100005217 Ga0070668_1000052176 260
40 3300005364 Ga0070673_100156232 Ga0070673_1001562322 260
41 3300005459 Ga0068867_100105399 Ga0068867_1001053992 260
42 3300005543 Ga0070672_100120768 Ga0070672_1001207682 260
43 3300005564 Ga0070664_100398613 Ga0070664_1003986132 260
44 3300005617 Ga0068859_100752712 Ga0068859_1007527122 260
45 3300005618 Ga0068864_100246502 Ga0068864_1002465021 260
46 3300005842 Ga0068858_100138789 Ga0068858_1001387893 260
47 3300006931 Ga0097620_100752747 Ga0097620_1007527472 260
48 3300013297 Ga0157378_10240073 Ga0157378_102400732 260
49 3300014326 Ga0157380_10059234 Ga0157380_100592342 260
50 3300025937 Ga0207669_10021749 Ga0207669_100217494 260
51 3300025940 Ga0207691_10259259 Ga0207691_102592592 260
52 3300025942 Ga0207689_10269273 Ga0207689_102692732 260
53 3300025960 Ga0207651_10114070 Ga0207651_101140703 260
54 3300025972 Ga0207668_10005847 Ga0207668_100058475 260
55 3300025986 Ga0207658_10198865 Ga0207658_101988652 260
56 3300026035 Ga0207703_10465575 Ga0207703_104655752 260
57 3300026067 Ga0207678_10144812 Ga0207678_101448123 260
58 3300026075 Ga0207708_10429752 Ga0207708_104297522 260
59 3300026089 Ga0207648_10098829 Ga0207648_100988293 260
60 3300028380 Ga0268265_10247883 Ga0268265_102478831 260
61 3300035724 Ga0373933_0124889 Ga0373933_0124889_163_954 260
62 3300049586 Ga0501070_0115702 Ga0501070_0115702_704_1501 260
63 3300005327 Ga0070658_10447455 Ga0070658_104474552 261
64 3300005328 Ga0070676_10006880 Ga0070676_100068805 261
65 3300005328 Ga0070676_10249893 Ga0070676_102498932 261
66 3300005330 Ga0070690_100037239 Ga0070690_1000372393 261
67 3300005330 Ga0070690_100291460 Ga0070690_1002914602 261
68 3300005331 Ga0070670_100003749 Ga0070670_1000037494 261
69 3300005331 Ga0070670_100047725 Ga0070670_1000477254 261
70 3300005331 Ga0070670_100058151 Ga0070670_1000581513 261
71 3300005331 Ga0070670_100070298 Ga0070670_1000702982 261
72 3300005331 Ga0070670_100446162 Ga0070670_1004461621 261
73 3300005334 Ga0068869_100000926 Ga0068869_10000092613 261
74 3300005334 Ga0068869_100035343 Ga0068869_1000353432 261
75 3300005335 Ga0070666_10008121 Ga0070666_100081212 261
76 3300005338 Ga0068868_100003652 Ga0068868_1000036522 261
77 3300005338 Ga0068868_100127380 Ga0068868_1001273802 261
78 3300005340 Ga0070689_100012276 Ga0070689_1000122769 261
79 3300005344 Ga0070661_100206447 Ga0070661_1002064473 261
80 3300005347 Ga0070668_100009357 Ga0070668_1000093575 261
81 3300005347 Ga0070668_100016106 Ga0070668_1000161063 261
82 3300005347 Ga0070668_100038163 Ga0070668_1000381635 261
83 3300005347 Ga0070668_100046636 Ga0070668_1000466362 261
84 3300005353 Ga0070669_100000668 Ga0070669_10000066819 261
85 3300005353 Ga0070669_100005376 Ga0070669_1000053768 261
86 3300005353 Ga0070669_100127502 Ga0070669_1001275022 261
87 3300005354 Ga0070675_100009190 Ga0070675_1000091908 261
88 3300005354 Ga0070675_100013475 Ga0070675_1000134752 261
89 3300005355 Ga0070671_100334255 Ga0070671_1003342551 261
90 3300005356 Ga0070674_100020370 Ga0070674_1000203704 261
91 3300005356 Ga0070674_100177338 Ga0070674_1001773383 261
92 3300005364 Ga0070673_100023220 Ga0070673_1000232204 261
93 3300005364 Ga0070673_100078160 Ga0070673_1000781602 261
94 3300005366 Ga0070659_100179956 Ga0070659_1001799562 261
95 3300005367 Ga0070667_100001232 Ga0070667_10000123217 261
96 3300005367 Ga0070667_100335688 Ga0070667_1003356881 261
97 3300005367 Ga0070667_100489845 Ga0070667_1004898451 261
98 3300005445 Ga0070708_100000538 Ga0070708_1000005384 261
99 3300005455 Ga0070663_100140704 Ga0070663_1001407042 261
100 3300005456 Ga0070678_100001539 Ga0070678_10000153914 261
101 3300005457 Ga0070662_100226831 Ga0070662_1002268312 261
102 3300005459 Ga0068867_100001858 Ga0068867_10000185812 261
103 3300005539 Ga0068853_100033649 Ga0068853_1000336494 261
104 3300005539 Ga0068853_100097982 Ga0068853_1000979824 261
105 3300005543 Ga0070672_100000287 Ga0070672_10000028726 261
106 3300005543 Ga0070672_100454706 Ga0070672_1004547062 261
107 3300005546 Ga0070696_100250046 Ga0070696_1002500462 261
108 3300005548 Ga0070665_100090878 Ga0070665_1000908783 261
109 3300005548 Ga0070665_100491048 Ga0070665_1004910482 261
110 3300005548 Ga0070665_100508358 Ga0070665_1005083582 261
111 3300005549 Ga0070704_100510893 Ga0070704_1005108931 261
112 3300005563 Ga0068855_100195862 Ga0068855_1001958622 261
113 3300005577 Ga0068857_100070471 Ga0068857_1000704712 261
114 3300005616 Ga0068852_100741480 Ga0068852_1007414802 261
115 3300005617 Ga0068859_100004806 Ga0068859_10000480614 261
116 3300005617 Ga0068859_100040552 Ga0068859_1000405522 261
117 3300005618 Ga0068864_100001285 Ga0068864_10000128514 261
118 3300005618 Ga0068864_100008284 Ga0068864_1000082842 261
119 3300005718 Ga0068866_10124373 Ga0068866_101243732 261
120 3300005719 Ga0068861_100030445 Ga0068861_1000304453 261
121 3300005719 Ga0068861_100146315 Ga0068861_1001463152 261
122 3300005840 Ga0068870_10002898 Ga0068870_100028983 261
123 3300005841 Ga0068863_100005435 Ga0068863_1000054356 261
124 3300005841 Ga0068863_100007445 Ga0068863_1000074459 261
125 3300005841 Ga0068863_100324512 Ga0068863_1003245123 261
126 3300005842 Ga0068858_100034495 Ga0068858_1000344952 261
127 3300005843 Ga0068860_100005493 Ga0068860_10000549314 261
128 3300005843 Ga0068860_100035344 Ga0068860_1000353442 261
129 3300005844 Ga0068862_100006542 Ga0068862_1000065428 261
130 3300006042 Ga0075368_10006065 Ga0075368_100060653 261
131 3300006048 Ga0075363_100013355 Ga0075363_1000133553 261
132 3300006177 Ga0075362_10068508 Ga0075362_100685081 261
133 3300006195 Ga0075366_10023116 Ga0075366_100231165 261
134 3300006237 Ga0097621_100001308 Ga0097621_1000013089 261
135 3300006353 Ga0075370_10014087 Ga0075370_100140873 261
136 3300006358 Ga0068871_100001077 Ga0068871_10000107713 261
137 3300006358 Ga0068871_100295907 Ga0068871_1002959072 261
138 3300006852 Ga0075433_10244429 Ga0075433_102444293 261
139 3300006881 Ga0068865_100113104 Ga0068865_1001131042 261
140 3300006931 Ga0097620_100004806 Ga0097620_10000480614 261
141 3300006931 Ga0097620_100040550 Ga0097620_1000405502 261
142 3300009148 Ga0105243_10182802 Ga0105243_101828023 261
143 3300009177 Ga0105248_10002074 Ga0105248_1000207418 261
144 3300009177 Ga0105248_10642683 Ga0105248_106426832 261
145 3300009545 Ga0105237_10330965 Ga0105237_103309653 261
146 3300011119 Ga0105246_10677933 Ga0105246_106779331 261
147 3300013296 Ga0157374_10001312 Ga0157374_100013126 261
148 3300013306 Ga0163162_10005459 Ga0163162_100054595 261
149 3300013308 Ga0157375_10002469 Ga0157375_1000246913 261
150 3300013308 Ga0157375_10075973 Ga0157375_100759733 261
151 3300013308 Ga0157375_10220013 Ga0157375_102200133 261
152 3300014325 Ga0163163_10180571 Ga0163163_101805713 261
153 3300014968 Ga0157379_10000858 Ga0157379_1000085812 261
154 3300014968 Ga0157379_10119043 Ga0157379_101190432 261
155 3300014969 Ga0157376_10012373 Ga0157376_100123732 261
156 3300014969 Ga0157376_10117530 Ga0157376_101175302 261
157 3300017792 Ga0163161_10047569 Ga0163161_100475693 261
158 3300025294 Ga0209025_1048588 Ga0209025_10485882 261
159 3300025893 Ga0207682_10007385 Ga0207682_100073853 261
160 3300025903 Ga0207680_10000458 Ga0207680_1000045814 261
161 3300025908 Ga0207643_10005399 Ga0207643_100053992 261
162 3300025908 Ga0207643_10136125 Ga0207643_101361252 261
163 3300025923 Ga0207681_10013968 Ga0207681_100139682 261
164 3300025923 Ga0207681_10032962 Ga0207681_100329622 261
165 3300025923 Ga0207681_10116360 Ga0207681_101163603 261
166 3300025925 Ga0207650_10033665 Ga0207650_100336654 261
167 3300025925 Ga0207650_10068239 Ga0207650_100682393 261
168 3300025925 Ga0207650_10099075 Ga0207650_100990752 261
169 3300025925 Ga0207650_10339861 Ga0207650_103398612 261
170 3300025926 Ga0207659_10001947 Ga0207659_1000194712 261
171 3300025926 Ga0207659_10009786 Ga0207659_100097862 261
172 3300025931 Ga0207644_10004658 Ga0207644_100046583 261
173 3300025931 Ga0207644_10112707 Ga0207644_101127074 261
174 3300025932 Ga0207690_10095013 Ga0207690_100950132 261
175 3300025933 Ga0207706_10049200 Ga0207706_100492002 261
176 3300025935 Ga0207709_10107197 Ga0207709_101071972 261
177 3300025936 Ga0207670_10023785 Ga0207670_100237852 261
178 3300025936 Ga0207670_10231592 Ga0207670_102315922 261
179 3300025937 Ga0207669_10083275 Ga0207669_100832753 261
180 3300025938 Ga0207704_10007203 Ga0207704_100072034 261
181 3300025940 Ga0207691_10000249 Ga0207691_1000024924 261
182 3300025940 Ga0207691_10428016 Ga0207691_104280162 261
183 3300025941 Ga0207711_10015621 Ga0207711_100156215 261
184 3300025942 Ga0207689_10003129 Ga0207689_100031292 261
185 3300025942 Ga0207689_10006079 Ga0207689_100060799 261
186 3300025944 Ga0207661_10319838 Ga0207661_103198382 261
187 3300025945 Ga0207679_10306697 Ga0207679_103066972 261
188 3300025945 Ga0207679_10479547 Ga0207679_104795471 261
189 3300025949 Ga0207667_10160958 Ga0207667_101609582 261
190 3300025960 Ga0207651_10129294 Ga0207651_101292943 261
191 3300025960 Ga0207651_10151536 Ga0207651_101515362 261
192 3300025961 Ga0207712_10209738 Ga0207712_102097382 261
193 3300025972 Ga0207668_10002554 Ga0207668_100025549 261
194 3300025972 Ga0207668_10013549 Ga0207668_100135493 261
195 3300025972 Ga0207668_10085662 Ga0207668_100856623 261
196 3300025972 Ga0207668_10288337 Ga0207668_102883372 261
197 3300025986 Ga0207658_10001272 Ga0207658_1000127210 261
198 3300025986 Ga0207658_10022052 Ga0207658_100220523 261
199 3300025986 Ga0207658_10262189 Ga0207658_102621893 261
200 3300026023 Ga0207677_10007009 Ga0207677_100070093 261
201 3300026023 Ga0207677_10127016 Ga0207677_101270162 261
202 3300026035 Ga0207703_10007973 Ga0207703_100079735 261
203 3300026035 Ga0207703_10011900 Ga0207703_100119005 261
204 3300026041 Ga0207639_10238296 Ga0207639_102382962 261
205 3300026067 Ga0207678_10106194 Ga0207678_101061943 261
206 3300026088 Ga0207641_10000374 Ga0207641_1000037451 261
207 3300026088 Ga0207641_10026060 Ga0207641_100260604 261
208 3300026088 Ga0207641_10028677 Ga0207641_100286773 261
209 3300026088 Ga0207641_10076588 Ga0207641_100765885 261
210 3300026088 Ga0207641_10223185 Ga0207641_102231853 261
211 3300026088 Ga0207641_10232145 Ga0207641_102321453 261
212 3300026088 Ga0207641_10297679 Ga0207641_102976792 261
213 3300026089 Ga0207648_10000523 Ga0207648_1000052321 261
214 3300026089 Ga0207648_10002934 Ga0207648_1000293411 261
215 3300026095 Ga0207676_10012004 Ga0207676_100120045 261
216 3300026095 Ga0207676_10017764 Ga0207676_100177645 261
217 3300026095 Ga0207676_10296358 Ga0207676_102963581 261
218 3300026116 Ga0207674_10036123 Ga0207674_100361234 261
219 3300026118 Ga0207675_100002219 Ga0207675_10000221911 261
220 3300026118 Ga0207675_100370411 Ga0207675_1003704112 261
221 3300026118 Ga0207675_100500280 Ga0207675_1005002802 261
222 3300026121 Ga0207683_10000476 Ga0207683_1000047625 261
223 3300026142 Ga0207698_10516654 Ga0207698_105166542 261
224 3300027866 Ga0209813_10002939 Ga0209813_100029394 261
225 3300028379 Ga0268266_10005562 Ga0268266_100055625 261
226 3300028379 Ga0268266_10122479 Ga0268266_101224792 261
227 3300028379 Ga0268266_10334000 Ga0268266_103340002 261
228 3300028380 Ga0268265_10006395 Ga0268265_100063955 261
229 3300028380 Ga0268265_10007463 Ga0268265_100074633 261
230 3300028380 Ga0268265_10206294 Ga0268265_102062941 261
231 3300028381 Ga0268264_10002850 Ga0268264_1000285010 261
232 3300028381 Ga0268264_10035616 Ga0268264_100356164 261
233 3300031235 Ga0265330_10029055 Ga0265330_100290552 261
234 3300031241 Ga0265325_10001765 Ga0265325_100017657 261
235 3300031249 Ga0265339_10011970 Ga0265339_100119703 261
236 3300031711 Ga0265314_10065716 Ga0265314_100657162 261
237 3300032002 Ga0307416_100309559 Ga0307416_1003095592 261
238 3300033179 Ga0307507_10042998 Ga0307507_100429984 261
239 3300048903 Ga0496100_0455593 Ga0496100_0455593_154_951 261
240 3300048904 Ga0496101_0075703 Ga0496101_0075703_1163_1960 261
241 3300048905 Ga0496102_0190732 Ga0496102_0190732_583_1380 261
242 3300048907 Ga0496104_0398410 Ga0496104_0398410_25_819 261
243 3300048910 Ga0496107_0034684 Ga0496107_0034684_2264_3061 261
244 3300048911 Ga0496108_0420528 Ga0496108_0420528_350_1147 261
245 3300048912 Ga0496109_0135071 Ga0496109_0135071_1069_1866 261
246 3300050489 nmdc:mga03683_15428_c1 nmdc:mga03683_15428_c1_872_1678 261
247 3300050490 nmdc:mga03n38_976_c1 nmdc:mga03n38_976_c1_150_956 261
248 3300050491 nmdc:mga00v17_31433_c1 nmdc:mga00v17_31433_c1_1144_1950 261
249 3300050492 nmdc:mga0yw44_63939_c1 nmdc:mga0yw44_63939_c1_1309_2115 261
250 3300050493 nmdc:mga0k408_27226_c1 nmdc:mga0k408_27226_c1_806_1612 261
251 3300050494 nmdc:mga06z11_2506_c1 nmdc:mga06z11_2506_c1_4541_5347 261
252 3300050495 nmdc:mga04h51_7355_c1 nmdc:mga04h51_7355_c1_1723_2529 261
253 3300050496 nmdc:mga07m45_1279_c2 nmdc:mga07m45_1279_c2_2192_2998 261
254 3300050516 nmdc:mga0sz30_11294_c1 nmdc:mga0sz30_11294_c1_797_1603 261
255 3300053146 Ga0500588_0000211 Ga0500588_0000211_1150_1947 261
256 iso_pu_bacteria 2841911363 2841916889 261
257 iso_pu_bacteria 2841917233 2841917607 261
258 3300005329 Ga0070683_100012992 Ga0070683_1000129923 262
259 3300005331 Ga0070670_100023561 Ga0070670_1000235613 262
260 3300005331 Ga0070670_100233648 Ga0070670_1002336482 262
261 3300005331 Ga0070670_100633668 Ga0070670_1006336681 262
262 3300005333 Ga0070677_10007016 Ga0070677_100070163 262
263 3300005333 Ga0070677_10010629 Ga0070677_100106295 262
264 3300005334 Ga0068869_100030096 Ga0068869_1000300963 262
265 3300005334 Ga0068869_100161235 Ga0068869_1001612352 262
266 3300005335 Ga0070666_10005904 Ga0070666_100059043 262
267 3300005335 Ga0070666_10216679 Ga0070666_102166792 262
268 3300005336 Ga0070680_100145255 Ga0070680_1001452552 262
269 3300005338 Ga0068868_100010424 Ga0068868_1000104245 262
270 3300005339 Ga0070660_100000940 Ga0070660_1000009404 262
271 3300005339 Ga0070660_100035806 Ga0070660_1000358063 262
272 3300005339 Ga0070660_100194222 Ga0070660_1001942222 262
273 3300005343 Ga0070687_100002271 Ga0070687_1000022715 262
274 3300005344 Ga0070661_100002505 Ga0070661_1000025052 262
275 3300005344 Ga0070661_100015498 Ga0070661_1000154982 262
276 3300005345 Ga0070692_10180786 Ga0070692_101807861 262
277 3300005347 Ga0070668_100000779 Ga0070668_10000077911 262
278 3300005347 Ga0070668_100104673 Ga0070668_1001046732 262
279 3300005355 Ga0070671_100341903 Ga0070671_1003419032 262
280 3300005356 Ga0070674_100000737 Ga0070674_10000073716 262
281 3300005364 Ga0070673_100000729 Ga0070673_1000007297 262
282 3300005365 Ga0070688_100004856 Ga0070688_1000048565 262
283 3300005366 Ga0070659_100050635 Ga0070659_1000506355 262
284 3300005366 Ga0070659_100058232 Ga0070659_1000582323 262
285 3300005366 Ga0070659_100169717 Ga0070659_1001697173 262
286 3300005434 Ga0070709_10076017 Ga0070709_100760172 262
287 3300005435 Ga0070714_100092767 Ga0070714_1000927674 262
288 3300005438 Ga0070701_10021305 Ga0070701_100213052 262
289 3300005441 Ga0070700_100106860 Ga0070700_1001068603 262
290 3300005456 Ga0070678_100029519 Ga0070678_1000295193 262
291 3300005456 Ga0070678_100049763 Ga0070678_1000497632 262
292 3300005457 Ga0070662_100010358 Ga0070662_1000103582 262
293 3300005458 Ga0070681_10023269 Ga0070681_100232698 262
294 3300005459 Ga0068867_100499268 Ga0068867_1004992682 262
295 3300005466 Ga0070685_10012098 Ga0070685_100120982 262
296 3300005530 Ga0070679_100137945 Ga0070679_1001379453 262
297 3300005539 Ga0068853_100016729 Ga0068853_1000167292 262
298 3300005543 Ga0070672_100001456 Ga0070672_10000145618 262
299 3300005543 Ga0070672_100152639 Ga0070672_1001526392 262
300 3300005544 Ga0070686_100045474 Ga0070686_1000454744 262
301 3300005547 Ga0070693_100023562 Ga0070693_1000235622 262
302 3300005547 Ga0070693_100077306 Ga0070693_1000773062 262
303 3300005548 Ga0070665_100012851 Ga0070665_1000128518 262
304 3300005563 Ga0068855_100021114 Ga0068855_1000211143 262
305 3300005563 Ga0068855_100054928 Ga0068855_1000549284 262
306 3300005564 Ga0070664_100025762 Ga0070664_1000257622 262
307 3300005564 Ga0070664_100084880 Ga0070664_1000848802 262
308 3300005564 Ga0070664_100098008 Ga0070664_1000980083 262
309 3300005564 Ga0070664_100102003 Ga0070664_1001020033 262
310 3300005577 Ga0068857_100006994 Ga0068857_1000069946 262
311 3300005577 Ga0068857_100014442 Ga0068857_1000144425 262
312 3300005577 Ga0068857_100165704 Ga0068857_1001657042 262
313 3300005578 Ga0068854_100018173 Ga0068854_1000181734 262
314 3300005578 Ga0068854_100030709 Ga0068854_1000307093 262
315 3300005578 Ga0068854_100054950 Ga0068854_1000549505 262
316 3300005578 Ga0068854_100074011 Ga0068854_1000740112 262
317 3300005614 Ga0068856_100003384 Ga0068856_10000338415 262
318 3300005614 Ga0068856_100164595 Ga0068856_1001645953 262
319 3300005615 Ga0070702_100055611 Ga0070702_1000556112 262
320 3300005616 Ga0068852_100001607 Ga0068852_1000016073 262
321 3300005616 Ga0068852_100001757 Ga0068852_1000017575 262
322 3300005616 Ga0068852_100007039 Ga0068852_1000070396 262
323 3300005616 Ga0068852_100049718 Ga0068852_1000497182 262
324 3300005617 Ga0068859_100052884 Ga0068859_1000528843 262
325 3300005618 Ga0068864_100054096 Ga0068864_1000540966 262
326 3300005719 Ga0068861_100160578 Ga0068861_1001605782 262
327 3300005834 Ga0068851_10002374 Ga0068851_100023743 262
328 3300005834 Ga0068851_10080831 Ga0068851_100808311 262
329 3300005840 Ga0068870_10001701 Ga0068870_100017013 262
330 3300005840 Ga0068870_10021789 Ga0068870_100217893 262
331 3300005841 Ga0068863_100007038 Ga0068863_1000070386 262
332 3300005842 Ga0068858_100030372 Ga0068858_1000303723 262
333 3300005843 Ga0068860_100017730 Ga0068860_1000177303 262
334 3300005843 Ga0068860_100262593 Ga0068860_1002625932 262
335 3300005844 Ga0068862_100073377 Ga0068862_1000733772 262
336 3300006173 Ga0070716_100238351 Ga0070716_1002383512 262
337 3300006237 Ga0097621_100393040 Ga0097621_1003930402 262
338 3300006358 Ga0068871_100161240 Ga0068871_1001612402 262
339 3300006358 Ga0068871_100199050 Ga0068871_1001990502 262
340 3300006844 Ga0075428_100104144 Ga0075428_1001041443 262
341 3300006931 Ga0097620_100052888 Ga0097620_1000528883 262
342 3300009093 Ga0105240_10002428 Ga0105240_1000242833 262
343 3300009098 Ga0105245_10241799 Ga0105245_102417993 262
344 3300009174 Ga0105241_10022261 Ga0105241_100222615 262
345 3300009176 Ga0105242_10044438 Ga0105242_100444384 262
346 3300009177 Ga0105248_10323351 Ga0105248_103233512 262
347 3300009551 Ga0105238_10001044 Ga0105238_1000104414 262
348 3300009553 Ga0105249_10053405 Ga0105249_100534053 262
349 3300010375 Ga0105239_10426412 Ga0105239_104264122 262
350 3300011119 Ga0105246_10090883 Ga0105246_100908833 262
351 3300013104 Ga0157370_10015688 Ga0157370_100156888 262
352 3300013105 Ga0157369_10014238 Ga0157369_100142386 262
353 3300013296 Ga0157374_10003097 Ga0157374_1000309710 262
354 3300013296 Ga0157374_10048388 Ga0157374_100483884 262
355 3300013296 Ga0157374_10903612 Ga0157374_109036122 262
356 3300013297 Ga0157378_10183501 Ga0157378_101835012 262
357 3300013306 Ga0163162_10401407 Ga0163162_104014073 262
358 3300013307 Ga0157372_10004393 Ga0157372_1000439315 262
359 3300013308 Ga0157375_10052859 Ga0157375_100528592 262
360 3300014325 Ga0163163_10016698 Ga0163163_100166982 262
361 3300014326 Ga0157380_10012745 Ga0157380_100127456 262
362 3300014745 Ga0157377_10031200 Ga0157377_100312003 262
363 3300014968 Ga0157379_10003487 Ga0157379_100034875 262
364 3300014969 Ga0157376_10074505 Ga0157376_100745054 262
365 3300017792 Ga0163161_10010199 Ga0163161_100101993 262
366 3300021361 Ga0213872_10064326 Ga0213872_100643262 262
367 3300025315 Ga0207697_10000414 Ga0207697_100004145 262
368 3300025321 Ga0207656_10008813 Ga0207656_100088132 262
369 3300025321 Ga0207656_10028284 Ga0207656_100282843 262
370 3300025893 Ga0207682_10001566 Ga0207682_1000156611 262
371 3300025901 Ga0207688_10001416 Ga0207688_1000141613 262
372 3300025903 Ga0207680_10191932 Ga0207680_101919322 262
373 3300025906 Ga0207699_10231547 Ga0207699_102315472 262
374 3300025907 Ga0207645_10000308 Ga0207645_100003086 262
375 3300025907 Ga0207645_10000661 Ga0207645_1000066134 262
376 3300025908 Ga0207643_10000515 Ga0207643_1000051516 262
377 3300025908 Ga0207643_10017207 Ga0207643_100172075 262
378 3300025912 Ga0207707_10106830 Ga0207707_101068302 262
379 3300025917 Ga0207660_10402337 Ga0207660_104023372 262
380 3300025918 Ga0207662_10007274 Ga0207662_100072742 262
381 3300025919 Ga0207657_10019674 Ga0207657_100196743 262
382 3300025919 Ga0207657_10022078 Ga0207657_100220787 262
383 3300025919 Ga0207657_10164626 Ga0207657_101646262 262
384 3300025920 Ga0207649_10069130 Ga0207649_100691302 262
385 3300025920 Ga0207649_10244663 Ga0207649_102446632 262
386 3300025921 Ga0207652_10108831 Ga0207652_101088313 262
387 3300025923 Ga0207681_10169549 Ga0207681_101695492 262
388 3300025924 Ga0207694_10009651 Ga0207694_100096519 262
389 3300025925 Ga0207650_10005013 Ga0207650_100050133 262
390 3300025926 Ga0207659_10006871 Ga0207659_100068716 262
391 3300025931 Ga0207644_10018704 Ga0207644_100187045 262
392 3300025931 Ga0207644_10058309 Ga0207644_100583092 262
393 3300025931 Ga0207644_10185620 Ga0207644_101856201 262
394 3300025932 Ga0207690_10014956 Ga0207690_100149566 262
395 3300025932 Ga0207690_10077309 Ga0207690_100773093 262
396 3300025932 Ga0207690_10307952 Ga0207690_103079522 262
397 3300025933 Ga0207706_10003433 Ga0207706_100034333 262
398 3300025934 Ga0207686_10023568 Ga0207686_100235683 262
399 3300025936 Ga0207670_10049705 Ga0207670_100497054 262
400 3300025937 Ga0207669_10010269 Ga0207669_100102692 262
401 3300025937 Ga0207669_10026018 Ga0207669_100260185 262
402 3300025938 Ga0207704_10040324 Ga0207704_100403242 262
403 3300025939 Ga0207665_10238818 Ga0207665_102388182 262
404 3300025940 Ga0207691_10001733 Ga0207691_1000173327 262
405 3300025940 Ga0207691_10023071 Ga0207691_100230717 262
406 3300025941 Ga0207711_10328908 Ga0207711_103289082 262
407 3300025942 Ga0207689_10002125 Ga0207689_1000212512 262
408 3300025942 Ga0207689_10077369 Ga0207689_100773692 262
409 3300025944 Ga0207661_10514393 Ga0207661_105143932 262
410 3300025945 Ga0207679_10033811 Ga0207679_100338113 262
411 3300025945 Ga0207679_10054877 Ga0207679_100548774 262
412 3300025945 Ga0207679_10134935 Ga0207679_101349352 262
413 3300025949 Ga0207667_10005138 Ga0207667_1000513816 262
414 3300025949 Ga0207667_10049514 Ga0207667_100495143 262
415 3300025960 Ga0207651_10006581 Ga0207651_100065815 262
416 3300025960 Ga0207651_10073054 Ga0207651_100730543 262
417 3300025972 Ga0207668_10035407 Ga0207668_100354073 262
418 3300025972 Ga0207668_10134559 Ga0207668_101345591 262
419 3300025972 Ga0207668_10275826 Ga0207668_102758262 262
420 3300025981 Ga0207640_10050889 Ga0207640_100508893 262
421 3300025986 Ga0207658_10087701 Ga0207658_100877012 262
422 3300026023 Ga0207677_10001441 Ga0207677_100014415 262
423 3300026041 Ga0207639_10038520 Ga0207639_100385202 262
424 3300026067 Ga0207678_10013575 Ga0207678_100135753 262
425 3300026075 Ga0207708_10173582 Ga0207708_101735823 262
426 3300026078 Ga0207702_10009250 Ga0207702_1000925010 262
427 3300026088 Ga0207641_10012062 Ga0207641_100120625 262
428 3300026088 Ga0207641_10140897 Ga0207641_101408973 262
429 3300026089 Ga0207648_10038007 Ga0207648_100380072 262
430 3300026089 Ga0207648_10093524 Ga0207648_100935242 262
431 3300026095 Ga0207676_10055793 Ga0207676_100557931 262
432 3300026116 Ga0207674_10000118 Ga0207674_1000011874 262
433 3300026116 Ga0207674_10004098 Ga0207674_1000409812 262
434 3300026116 Ga0207674_10103685 Ga0207674_101036852 262
435 3300026118 Ga0207675_100000635 Ga0207675_10000063523 262
436 3300026118 Ga0207675_100215225 Ga0207675_1002152252 262
437 3300026121 Ga0207683_10000672 Ga0207683_1000067233 262
438 3300026121 Ga0207683_10002112 Ga0207683_1000211211 262
439 3300026142 Ga0207698_10412923 Ga0207698_104129232 262
440 3300026142 Ga0207698_10415004 Ga0207698_104150042 262
441 3300027682 Ga0209971_1034506 Ga0209971_10345062 262
442 3300027876 Ga0209974_10031769 Ga0209974_100317692 262
443 3300028381 Ga0268264_10599710 Ga0268264_105997102 262
444 3300035114 Ga0373939_0111890 Ga0373939_0111890_46_849 262
445 3300035724 Ga0373933_0052689 Ga0373933_0052689_119_922 262
446 3300035725 Ga0373947_0109402 Ga0373947_0109402_138_941 262
447 3300035725 Ga0373947_0398981 Ga0373947_0398981_28_831 262
448 3300046507 Ga0495606_0008981 Ga0495606_0008981_950_1771 262
449 3300048904 Ga0496101_0005009 Ga0496101_0005009_7437_8240 262
450 3300048905 Ga0496102_0034110 Ga0496102_0034110_3729_4532 262
451 3300048906 Ga0496103_0201467 Ga0496103_0201467_109_912 262
452 3300048907 Ga0496104_0021708 Ga0496104_0021708_3342_4145 262
453 3300048908 Ga0496105_0007050 Ga0496105_0007050_800_1603 262
454 3300048909 Ga0496106_0011048 Ga0496106_0011048_1279_2082 262
455 3300048911 Ga0496108_0004760 Ga0496108_0004760_9859_10662 262
456 3300048912 Ga0496109_0046869 Ga0496109_0046869_657_1460 262
457 3300048913 Ga0496110_0007678 Ga0496110_0007678_117_920 262
458 3300048916 Ga0496113_0244567 Ga0496113_0244567_398_1210 262
459 3300048917 Ga0496114_0014725 Ga0496114_0014725_612_1415 262
460 3300049587 Ga0501071_0166408 Ga0501071_0166408_169_981 262
461 3300049823 Ga0501044_0024730 Ga0501044_0024730_578_1381 262
462 3300053086 Ga0500578_0168392 Ga0500578_0168392_153_974 262
463 3300013308 Ga0157375_10004713 Ga0157375_1000471311 263
464 3300025901 Ga0207688_10131757 Ga0207688_101317572 263
465 3300048929 Ga0496126_0000823 Ga0496126_0000823_24813_25628 263
466 3300005340 Ga0070689_100061506 Ga0070689_1000615062 264
467 3300005365 Ga0070688_100387721 Ga0070688_1003877212 264
468 3300009176 Ga0105242_10042406 Ga0105242_100424063 264
469 3300013297 Ga0157378_10029765 Ga0157378_100297654 264
470 3300025931 Ga0207644_10011516 Ga0207644_100115164 264
471 3300047472 Ga0495686_0001810 Ga0495686_0001810_5238_6068 265
472 3300053730 Ga0500645_011546 Ga0500645_011546_1757_2587 265
473 iso_pu_bacteria 2643221734 2644733871 265
474 iso_pu_bacteria 2643221736 2644742387 265
475 iso_pu_bacteria 2818991467 2819716841 265
476 iso_pu_bacteria 2841760612 2841763812 265
477 iso_pu_bacteria 2844104063 2844109284 265
478 iso_pu_bacteria 2851182111 2851183065 265
479 iso_pu_bacteria 2851246043 2851251391 265
480 iso_pu_bacteria 2917699015 2917701645 265
481 iso_pu_bacteria 8057529695 8057534263 265
482 3300048917 Ga0496114_0589351 Ga0496114_0589351_106_915 266
483 3300003775 Ga0055524_1009451 Ga0055524_10094512 267
484 3300025299 Ga0209256_1000182 Ga0209256_100018262 267
485 3300048925 Ga0496122_0055794 Ga0496122_0055794_615_1418 267
486 3300053153 Ga0500616_0028018 Ga0500616_0028018_1036_1845 267
487 3300003187 JGI25151J46595_10000018 JGI25151J46595_10000018106 269
488 3300003771 Ga0055526_1001056 Ga0055526_10010566 269
489 3300003771 Ga0055526_1002567 Ga0055526_100256711 269
490 3300003775 Ga0055524_1000048 Ga0055524_100004824 269
491 3300013250 Ga0171462_1009 Ga0171462_100918 269
492 3300025273 Ga0209673_1020163 Ga0209673_10201632 269
493 3300025291 Ga0209675_1000239 Ga0209675_100023952 269
494 3300025294 Ga0209025_1000010 Ga0209025_1000010114 269
495 3300025294 Ga0209025_1018750 Ga0209025_10187502 269
496 3300025295 Ga0209564_1000019 Ga0209564_1000019291 269
497 3300025295 Ga0209564_1000034 Ga0209564_1000034281 269
498 3300025299 Ga0209256_1000026 Ga0209256_1000026269 269
499 3300031901 Ga0307406_10365151 Ga0307406_103651512 269
500 3300046522 Ga0495643_0079168 Ga0495643_0079168_624_1439 269
501 3300048920 Ga0496117_0056498 Ga0496117_0056498_1856_2665 269
502 3300048926 Ga0496123_0019134 Ga0496123_0019134_3652_4461 269
503 3300048928 Ga0496125_0059253 Ga0496125_0059253_451_1260 269
504 3300049571 Ga0501034_0340463 Ga0501034_0340463_314_1123 269
505 3300049573 Ga0501037_0227244 Ga0501037_0227244_146_955 269
506 3300053156 Ga0500622_0041856 Ga0500622_0041856_1415_2230 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05013

FGase

N-formylglutamate amidohydrolase

52

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.8009 2 259
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7996 5 267
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7928 5 267
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7804 5 267
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7739 5 267
ID Description Score Start End Superfamily
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7991 6 259 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.795 5 267 3.40.630.40
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7839 6 259 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7787 5 267 3.40.630.40
af_A0A0P0X7D0_1_126_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.6936 123 149 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A522RW12-F1-model_v4 N-formylglutamate deformylase (EC 3.5.1.68) 0.9834 5 224 GO:0050129
AF-A0A2G2LJ21-F1-model_v4 N-formylglutamate deformylase 0.9833 5 267
AF-A0A1G3F373-F1-model_v4 N-formylglutamate deformylase 0.9833 4 228
AF-A0A4P5U8R3-F1-model_v4 N-formylglutamate deformylase 0.9825 5 264
AF-A0A656QRC5-F1-model_v4 N-formylglutamate amidohydrolase 0.9821 124 268 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.78 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map