F456457
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 506 | 247 | 501 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10044795|JGI24739J22299_100447952 |
| Length | 168 |
| Sequence | MTVLPTRSYCWCVTTTSVLAPVGGRAVPLQDVPDPVFSQGMVGYGAAIDPPRGVVDAVAPVSGKILKLLPHAYIVMTPDNVGILVHLGLDTVQLNGEGFTTHVSQGDDVTAGQVIITYDVPSVEAKGLNPIVPVVVMDEREQSNVIPSDAVTAGAEIATGASLFTANK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 3 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 4 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 5 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 6 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 174 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 179 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 185 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 186 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 187 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 227 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 235 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 236 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 239 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 243 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 245 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 246 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 247 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.22 |
| Nodule | 0 |
| Rhizoplane | 11.46 |
| Rhizosphere | 70.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1006115 | 3300000546 | Bacteria | 1307 |
| 2 | JGI24739J22299_10023732 | 3300001989 | Bacteria | 2166 |
| 3 | JGI24739J22299_10044795 | 3300001989 | Bacteria | 1455 |
| 4 | JGI24737J22298_10034638 | 3300001990 | Bacteria | 1565 |
| 5 | JGI24737J22298_10089942 | 3300001990 | Bacteria | 911 |
| 6 | JGI24735J21928_10060269 | 3300002067 | Bacteria | 1091 |
| 7 | JGI24750J21931_1005331 | 3300002070 | Bacteria | 1580 |
| 8 | JGI24745J21846_1009564 | 3300002073 | Bacteria | 1100 |
| 9 | JGI24745J21846_1013739 | 3300002073 | Bacteria | 935 |
| 10 | JGI24748J21848_1005796 | 3300002074 | Bacteria | 1436 |
| 11 | JGI24738J21930_10008008 | 3300002075 | Bacteria | 2415 |
| 12 | JGI24738J21930_10022542 | 3300002075 | Bacteria | 1302 |
| 13 | JGI24749J21850_1027757 | 3300002076 | Bacteria | 808 |
| 14 | JGI24744J21845_10001117 | 3300002077 | Bacteria | 5215 |
| 15 | JGI24744J21845_10001144 | 3300002077 | Bacteria | 5160 |
| 16 | JGI24034J26672_10016280 | 3300002239 | Bacteria | 1144 |
| 17 | JGI24742J22300_10013083 | 3300002244 | Bacteria | 1388 |
| 18 | JGI24742J22300_10022087 | 3300002244 | Bacteria | 1089 |
| 19 | JGI24742J22300_10078522 | 3300002244 | Bacteria | 622 |
| 20 | JGI24751J29686_10007668 | 3300002459 | Bacteria | 2206 |
| 21 | Ga0070676_10325065 | 3300005328 | Bacteria | 1050 |
| 22 | Ga0070690_100174449 | 3300005330 | Bacteria | 1481 |
| 23 | Ga0070677_10088145 | 3300005333 | Bacteria | 1344 |
| 24 | Ga0068869_100031741 | 3300005334 | Bacteria | 3717 |
| 25 | Ga0068869_100083514 | 3300005334 | Bacteria | 2389 |
| 26 | Ga0070666_10107811 | 3300005335 | Bacteria | 1925 |
| 27 | Ga0070682_100002087 | 3300005337 | Bacteria | 11122 |
| 28 | Ga0070682_100030688 | 3300005337 | Bacteria | 3247 |
| 29 | Ga0068868_100017677 | 3300005338 | Bacteria | 5317 |
| 30 | Ga0068868_100035192 | 3300005338 | Bacteria | 3870 |
| 31 | Ga0068868_100183082 | 3300005338 | Bacteria | 1739 |
| 32 | Ga0068868_100215738 | 3300005338 | Bacteria | 1605 |
| 33 | Ga0070660_100134631 | 3300005339 | Bacteria | 1979 |
| 34 | Ga0070660_100780242 | 3300005339 | Bacteria | 803 |
| 35 | Ga0070689_100010644 | 3300005340 | Bacteria | 6559 |
| 36 | Ga0070689_100107703 | 3300005340 | Bacteria | 2213 |
| 37 | Ga0070691_10000651 | 3300005341 | Bacteria | 13437 |
| 38 | Ga0070692_10052846 | 3300005345 | Bacteria | 2117 |
| 39 | Ga0070692_10216545 | 3300005345 | Bacteria | 1130 |
| 40 | Ga0070692_10323334 | 3300005345 | Bacteria | 949 |
| 41 | Ga0070668_100003168 | 3300005347 | Bacteria | 12124 |
| 42 | Ga0070668_100257695 | 3300005347 | Bacteria | 1450 |
| 43 | Ga0070668_100263907 | 3300005347 | Bacteria | 1433 |
| 44 | Ga0070669_100021129 | 3300005353 | Bacteria | 4651 |
| 45 | Ga0070669_100065360 | 3300005353 | Bacteria | 2680 |
| 46 | Ga0070675_100266897 | 3300005354 | Bacteria | 1501 |
| 47 | Ga0070675_100291912 | 3300005354 | Bacteria | 1435 |
| 48 | Ga0070671_100001738 | 3300005355 | Bacteria | 16533 |
| 49 | Ga0070671_100881625 | 3300005355 | Bacteria | 781 |
| 50 | Ga0070674_100004119 | 3300005356 | Bacteria | 8257 |
| 51 | Ga0070674_100237447 | 3300005356 | Bacteria | 1425 |
| 52 | Ga0070688_100028037 | 3300005365 | Bacteria | 3358 |
| 53 | Ga0070688_100090713 | 3300005365 | Bacteria | 1996 |
| 54 | Ga0070659_100108029 | 3300005366 | Bacteria | 2244 |
| 55 | Ga0070659_100752430 | 3300005366 | Bacteria | 845 |
| 56 | Ga0070667_100000109 | 3300005367 | Bacteria | 105260 |
| 57 | Ga0070667_100002710 | 3300005367 | Bacteria | 15343 |
| 58 | Ga0070667_100048456 | 3300005367 | Bacteria | 3576 |
| 59 | Ga0070667_100158628 | 3300005367 | Bacteria | 1991 |
| 60 | Ga0070709_10105885 | 3300005434 | Bacteria | 1882 |
| 61 | Ga0070710_10010347 | 3300005437 | Bacteria | 4581 |
| 62 | Ga0070701_10003505 | 3300005438 | Bacteria | 6222 |
| 63 | Ga0070711_100001045 | 3300005439 | Bacteria | 14754 |
| 64 | Ga0070711_100191476 | 3300005439 | Bacteria | 1572 |
| 65 | Ga0070705_100010867 | 3300005440 | Bacteria | 4571 |
| 66 | Ga0070700_100023077 | 3300005441 | Bacteria | 3637 |
| 67 | Ga0070700_100081063 | 3300005441 | Bacteria | 2095 |
| 68 | Ga0070694_100031039 | 3300005444 | Bacteria | 3502 |
| 69 | Ga0070708_100325102 | 3300005445 | Bacteria | 1449 |
| 70 | Ga0070708_101154813 | 3300005445 | Bacteria | 725 |
| 71 | Ga0070663_100021413 | 3300005455 | Bacteria | 4300 |
| 72 | Ga0070663_100030903 | 3300005455 | Bacteria | 3675 |
| 73 | Ga0070663_100234998 | 3300005455 | Bacteria | 1445 |
| 74 | Ga0070663_101530338 | 3300005455 | Bacteria | 593 |
| 75 | Ga0070678_100000765 | 3300005456 | Bacteria | 16105 |
| 76 | Ga0070678_100025601 | 3300005456 | Bacteria | 3973 |
| 77 | Ga0070662_100006348 | 3300005457 | Bacteria | 7616 |
| 78 | Ga0070662_100363107 | 3300005457 | Bacteria | 1188 |
| 79 | Ga0068867_100010729 | 3300005459 | Bacteria | 6461 |
| 80 | Ga0068867_100224446 | 3300005459 | Bacteria | 1515 |
| 81 | Ga0070685_10010069 | 3300005466 | Bacteria | 4905 |
| 82 | Ga0070685_10437737 | 3300005466 | Bacteria | 913 |
| 83 | Ga0068853_100005160 | 3300005539 | Bacteria | 10209 |
| 84 | Ga0068853_100142996 | 3300005539 | Bacteria | 2148 |
| 85 | Ga0070672_100236351 | 3300005543 | Bacteria | 1536 |
| 86 | Ga0070672_100421718 | 3300005543 | Bacteria | 1146 |
| 87 | Ga0070672_100451741 | 3300005543 | Bacteria | 1107 |
| 88 | Ga0070686_100128722 | 3300005544 | Bacteria | 1748 |
| 89 | Ga0070686_100158235 | 3300005544 | Bacteria | 1593 |
| 90 | Ga0070695_100001027 | 3300005545 | Bacteria | 15247 |
| 91 | Ga0070696_100059197 | 3300005546 | Bacteria | 2676 |
| 92 | Ga0070693_100197778 | 3300005547 | Bacteria | 1304 |
| 93 | Ga0070693_100435751 | 3300005547 | Bacteria | 917 |
| 94 | Ga0070665_100001277 | 3300005548 | Bacteria | 30184 |
| 95 | Ga0070665_100004708 | 3300005548 | Bacteria | 14221 |
| 96 | Ga0070665_100068012 | 3300005548 | Bacteria | 3572 |
| 97 | Ga0070665_100243819 | 3300005548 | Bacteria | 1797 |
| 98 | Ga0070665_100928124 | 3300005548 | Bacteria | 883 |
| 99 | Ga0070704_100000397 | 3300005549 | Bacteria | 20000 |
| 100 | Ga0068855_100188498 | 3300005563 | Bacteria | 2328 |
| 101 | Ga0068855_100273314 | 3300005563 | Bacteria | 1879 |
| 102 | Ga0068854_100000953 | 3300005578 | Bacteria | 17419 |
| 103 | Ga0068854_100047123 | 3300005578 | Bacteria | 3071 |
| 104 | Ga0068856_100556626 | 3300005614 | Bacteria | 1168 |
| 105 | Ga0070702_100001771 | 3300005615 | Bacteria | 8980 |
| 106 | Ga0068859_100001848 | 3300005617 | Bacteria | 21522 |
| 107 | Ga0068859_100009757 | 3300005617 | Bacteria | 9697 |
| 108 | Ga0068859_100093042 | 3300005617 | Bacteria | 3066 |
| 109 | Ga0068859_100289142 | 3300005617 | Bacteria | 1732 |
| 110 | Ga0068864_100059026 | 3300005618 | Bacteria | 3318 |
| 111 | Ga0068866_10042932 | 3300005718 | Bacteria | 2253 |
| 112 | Ga0068866_10292620 | 3300005718 | Bacteria | 1013 |
| 113 | Ga0068861_100002222 | 3300005719 | Bacteria | 12598 |
| 114 | Ga0068861_100041357 | 3300005719 | Bacteria | 3452 |
| 115 | Ga0068861_100356458 | 3300005719 | Bacteria | 1285 |
| 116 | Ga0068863_100000123 | 3300005841 | Bacteria | 80999 |
| 117 | Ga0068863_100016807 | 3300005841 | Bacteria | 7020 |
| 118 | Ga0068863_100461105 | 3300005841 | Bacteria | 1248 |
| 119 | Ga0068863_100597427 | 3300005841 | Bacteria | 1092 |
| 120 | Ga0068858_100000702 | 3300005842 | Bacteria | 34951 |
| 121 | Ga0068858_100150772 | 3300005842 | Bacteria | 2186 |
| 122 | Ga0068858_100170493 | 3300005842 | Bacteria | 2052 |
| 123 | Ga0068858_100237322 | 3300005842 | Bacteria | 1729 |
| 124 | Ga0068858_100458680 | 3300005842 | Bacteria | 1229 |
| 125 | Ga0068858_101199056 | 3300005842 | Bacteria | 746 |
| 126 | Ga0068860_100000175 | 3300005843 | Bacteria | 105260 |
| 127 | Ga0068860_100005175 | 3300005843 | Bacteria | 13262 |
| 128 | Ga0068860_100333457 | 3300005843 | Bacteria | 1490 |
| 129 | Ga0068862_100000091 | 3300005844 | Bacteria | 107015 |
| 130 | Ga0068862_100017029 | 3300005844 | Bacteria | 6046 |
| 131 | Ga0068862_100167780 | 3300005844 | Bacteria | 1963 |
| 132 | Ga0081455_10098009 | 3300005937 | Bacteria | 2361 |
| 133 | Ga0081455_10277971 | 3300005937 | Bacteria | 1211 |
| 134 | Ga0081538_10044214 | 3300005981 | Bacteria | 2782 |
| 135 | Ga0075365_10002340 | 3300006038 | Bacteria | 9234 |
| 136 | Ga0075365_10004858 | 3300006038 | Bacteria | 7179 |
| 137 | Ga0075365_10102718 | 3300006038 | Bacteria | 1959 |
| 138 | Ga0075365_10113022 | 3300006038 | Bacteria | 1868 |
| 139 | Ga0075365_10556902 | 3300006038 | Bacteria | 811 |
| 140 | Ga0075365_10729638 | 3300006038 | Bacteria | 700 |
| 141 | Ga0075363_100000148 | 3300006048 | Bacteria | 17343 |
| 142 | Ga0075363_100002407 | 3300006048 | Bacteria | 7632 |
| 143 | Ga0075363_100018604 | 3300006048 | Bacteria | 3464 |
| 144 | Ga0075363_100032947 | 3300006048 | Bacteria | 2695 |
| 145 | Ga0075363_100034577 | 3300006048 | Bacteria | 2639 |
| 146 | Ga0075363_100082771 | 3300006048 | Bacteria | 1757 |
| 147 | Ga0075363_100127977 | 3300006048 | Bacteria | 1423 |
| 148 | Ga0075363_100226287 | 3300006048 | Bacteria | 1073 |
| 149 | Ga0075363_100312295 | 3300006048 | Bacteria | 913 |
| 150 | Ga0075363_100316504 | 3300006048 | Bacteria | 907 |
| 151 | Ga0075364_10007126 | 3300006051 | Bacteria | 6614 |
| 152 | Ga0075364_10012626 | 3300006051 | Bacteria | 5174 |
| 153 | Ga0075364_10012757 | 3300006051 | Bacteria | 5153 |
| 154 | Ga0075364_10028273 | 3300006051 | Bacteria | 3588 |
| 155 | Ga0075364_10215096 | 3300006051 | Bacteria | 1303 |
| 156 | Ga0075364_10235495 | 3300006051 | Bacteria | 1243 |
| 157 | Ga0075364_10372687 | 3300006051 | Bacteria | 974 |
| 158 | Ga0070715_10010309 | 3300006163 | Bacteria | 3328 |
| 159 | Ga0070715_10040178 | 3300006163 | Bacteria | 1954 |
| 160 | Ga0070716_100002953 | 3300006173 | Bacteria | 7922 |
| 161 | Ga0070716_100021945 | 3300006173 | Bacteria | 3369 |
| 162 | Ga0070716_100036872 | 3300006173 | Bacteria | 2698 |
| 163 | Ga0070716_101098816 | 3300006173 | Bacteria | 634 |
| 164 | Ga0070712_100007460 | 3300006175 | Bacteria | 6827 |
| 165 | Ga0070712_100016423 | 3300006175 | Bacteria | 4782 |
| 166 | Ga0070712_100686709 | 3300006175 | Bacteria | 872 |
| 167 | Ga0075362_10008695 | 3300006177 | Bacteria | 3898 |
| 168 | Ga0075362_10022987 | 3300006177 | Bacteria | 2631 |
| 169 | Ga0075362_10165353 | 3300006177 | Bacteria | 1067 |
| 170 | Ga0075367_10023903 | 3300006178 | Bacteria | 3443 |
| 171 | Ga0075367_10087055 | 3300006178 | Bacteria | 1897 |
| 172 | Ga0075369_10003326 | 3300006186 | Bacteria | 5841 |
| 173 | Ga0075369_10019069 | 3300006186 | Bacteria | 2798 |
| 174 | Ga0075369_10036105 | 3300006186 | Bacteria | 2102 |
| 175 | Ga0075369_10057627 | 3300006186 | Bacteria | 1690 |
| 176 | Ga0075369_10190737 | 3300006186 | Bacteria | 944 |
| 177 | Ga0075369_10229234 | 3300006186 | Bacteria | 860 |
| 178 | Ga0097621_100016973 | 3300006237 | Bacteria | 5519 |
| 179 | Ga0097621_100641632 | 3300006237 | Bacteria | 974 |
| 180 | Ga0075370_10000207 | 3300006353 | Bacteria | 20820 |
| 181 | Ga0075370_10003007 | 3300006353 | Bacteria | 7943 |
| 182 | Ga0068871_100080831 | 3300006358 | Bacteria | 2692 |
| 183 | Ga0068871_100255428 | 3300006358 | Bacteria | 1528 |
| 184 | Ga0075430_100118179 | 3300006846 | Bacteria | 2210 |
| 185 | Ga0068865_100001071 | 3300006881 | Bacteria | 15771 |
| 186 | Ga0068865_100616793 | 3300006881 | Bacteria | 918 |
| 187 | Ga0097620_100001848 | 3300006931 | Bacteria | 21522 |
| 188 | Ga0097620_100009756 | 3300006931 | Bacteria | 9697 |
| 189 | Ga0097620_100093039 | 3300006931 | Bacteria | 3066 |
| 190 | Ga0097620_100289119 | 3300006931 | Bacteria | 1732 |
| 191 | Ga0075435_100599284 | 3300007076 | Bacteria | 955 |
| 192 | Ga0105250_10046323 | 3300009092 | Bacteria | 1743 |
| 193 | Ga0105240_10210620 | 3300009093 | Bacteria | 2272 |
| 194 | Ga0111539_10297484 | 3300009094 | Bacteria | 1878 |
| 195 | Ga0105245_10136046 | 3300009098 | Bacteria | 2309 |
| 196 | Ga0105245_10921972 | 3300009098 | Bacteria | 916 |
| 197 | Ga0105247_10000070 | 3300009101 | Bacteria | 115098 |
| 198 | Ga0105243_10091450 | 3300009148 | Bacteria | 2506 |
| 199 | Ga0105242_10058052 | 3300009176 | Bacteria | 3171 |
| 200 | Ga0105248_10000458 | 3300009177 | Bacteria | 46439 |
| 201 | Ga0105248_10205718 | 3300009177 | Bacteria | 2218 |
| 202 | Ga0105248_11356870 | 3300009177 | Bacteria | 804 |
| 203 | Ga0105237_10024525 | 3300009545 | Bacteria | 6169 |
| 204 | Ga0105237_11449064 | 3300009545 | Unclassified | 693 |
| 205 | Ga0105238_10361606 | 3300009551 | Bacteria | 1441 |
| 206 | Ga0105249_10000020 | 3300009553 | Bacteria | 260634 |
| 207 | Ga0105249_10086514 | 3300009553 | Bacteria | 2923 |
| 208 | Ga0105249_10408609 | 3300009553 | Bacteria | 1389 |
| 209 | Ga0105249_11958679 | 3300009553 | Bacteria | 659 |
| 210 | Ga0105249_12679961 | 3300009553 | Bacteria | 570 |
| 211 | Ga0105239_10103944 | 3300010375 | Bacteria | 3145 |
| 212 | Ga0105239_10339588 | 3300010375 | Bacteria | 1695 |
| 213 | Ga0105239_10653912 | 3300010375 | Bacteria | 1201 |
| 214 | Ga0157369_10247258 | 3300013105 | Bacteria | 1862 |
| 215 | Ga0157374_10256433 | 3300013296 | Bacteria | 1722 |
| 216 | Ga0163162_10072852 | 3300013306 | Bacteria | 3490 |
| 217 | Ga0163162_10082205 | 3300013306 | Bacteria | 3293 |
| 218 | Ga0163162_10084550 | 3300013306 | Bacteria | 3249 |
| 219 | Ga0157375_11047745 | 3300013308 | Bacteria | 953 |
| 220 | Ga0163163_10015155 | 3300014325 | Bacteria | 7117 |
| 221 | Ga0163163_10053670 | 3300014325 | Bacteria | 3980 |
| 222 | Ga0163163_10214818 | 3300014325 | Bacteria | 1972 |
| 223 | Ga0163163_10949025 | 3300014325 | Bacteria | 923 |
| 224 | Ga0157380_10043097 | 3300014326 | Bacteria | 3531 |
| 225 | Ga0157377_10009645 | 3300014745 | Bacteria | 4747 |
| 226 | Ga0157379_10057893 | 3300014968 | Bacteria | 3464 |
| 227 | Ga0157379_10454656 | 3300014968 | Bacteria | 1183 |
| 228 | Ga0163161_10004320 | 3300017792 | Bacteria | 9902 |
| 229 | Ga0163161_10070401 | 3300017792 | Bacteria | 2557 |
| 230 | Ga0206354_11466338 | 3300020081 | Bacteria | 675 |
| 231 | Ga0209025_1153566 | 3300025294 | Bacteria | 632 |
| 232 | Ga0209051_1000549 | 3300025303 | Bacteria | 45665 |
| 233 | Ga0209051_1000709 | 3300025303 | Bacteria | 36525 |
| 234 | Ga0207653_10054690 | 3300025885 | Bacteria | 1335 |
| 235 | Ga0207682_10044007 | 3300025893 | Bacteria | 1829 |
| 236 | Ga0207692_10005950 | 3300025898 | Bacteria | 4924 |
| 237 | Ga0207642_10006557 | 3300025899 | Bacteria | 3879 |
| 238 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 239 | Ga0207710_10000856 | 3300025900 | Bacteria | 16411 |
| 240 | Ga0207688_10001325 | 3300025901 | Bacteria | 12862 |
| 241 | Ga0207688_10009287 | 3300025901 | Bacteria | 5360 |
| 242 | Ga0207688_10118017 | 3300025901 | Bacteria | 1546 |
| 243 | Ga0207680_10105562 | 3300025903 | Bacteria | 1818 |
| 244 | Ga0207680_10173523 | 3300025903 | Bacteria | 1454 |
| 245 | Ga0207647_10100458 | 3300025904 | Bacteria | 1717 |
| 246 | Ga0207685_10007929 | 3300025905 | Bacteria | 2994 |
| 247 | Ga0207685_10031234 | 3300025905 | Bacteria | 1905 |
| 248 | Ga0207699_10002028 | 3300025906 | Bacteria | 9561 |
| 249 | Ga0207645_10046268 | 3300025907 | Bacteria | 2779 |
| 250 | Ga0207645_10099733 | 3300025907 | Bacteria | 1873 |
| 251 | Ga0207643_10441858 | 3300025908 | Bacteria | 827 |
| 252 | Ga0207643_10499485 | 3300025908 | Bacteria | 777 |
| 253 | Ga0207671_10105836 | 3300025914 | Bacteria | 2135 |
| 254 | Ga0207671_10576496 | 3300025914 | Bacteria | 897 |
| 255 | Ga0207693_10020808 | 3300025915 | Bacteria | 5217 |
| 256 | Ga0207693_10046909 | 3300025915 | Bacteria | 3395 |
| 257 | Ga0207693_10271153 | 3300025915 | Bacteria | 1330 |
| 258 | Ga0207663_10006057 | 3300025916 | Bacteria | 6149 |
| 259 | Ga0207663_10106443 | 3300025916 | Bacteria | 1895 |
| 260 | Ga0207662_10085353 | 3300025918 | Bacteria | 1933 |
| 261 | Ga0207657_10203194 | 3300025919 | Bacteria | 1593 |
| 262 | Ga0207652_10512019 | 3300025921 | Bacteria | 1080 |
| 263 | Ga0207681_10000979 | 3300025923 | Bacteria | 18652 |
| 264 | Ga0207681_10109103 | 3300025923 | Bacteria | 2010 |
| 265 | Ga0207694_10234582 | 3300025924 | Bacteria | 1499 |
| 266 | Ga0207659_10235140 | 3300025926 | Bacteria | 1480 |
| 267 | Ga0207687_10000726 | 3300025927 | Bacteria | 22378 |
| 268 | Ga0207687_10080796 | 3300025927 | Bacteria | 2348 |
| 269 | Ga0207687_10473828 | 3300025927 | Bacteria | 1041 |
| 270 | Ga0207644_10001674 | 3300025931 | Bacteria | 14293 |
| 271 | Ga0207644_10565398 | 3300025931 | Bacteria | 942 |
| 272 | Ga0207690_10585820 | 3300025932 | Bacteria | 909 |
| 273 | Ga0207706_10013084 | 3300025933 | Bacteria | 7550 |
| 274 | Ga0207706_10032166 | 3300025933 | Bacteria | 4672 |
| 275 | Ga0207706_10539073 | 3300025933 | Bacteria | 1005 |
| 276 | Ga0207686_10005430 | 3300025934 | Bacteria | 6841 |
| 277 | Ga0207686_10091375 | 3300025934 | Bacteria | 2011 |
| 278 | Ga0207709_10010239 | 3300025935 | Bacteria | 5164 |
| 279 | Ga0207670_10004115 | 3300025936 | Bacteria | 7790 |
| 280 | Ga0207670_10074703 | 3300025936 | Bacteria | 2354 |
| 281 | Ga0207669_10002515 | 3300025937 | Bacteria | 7824 |
| 282 | Ga0207669_10009818 | 3300025937 | Bacteria | 4578 |
| 283 | Ga0207704_10000940 | 3300025938 | Bacteria | 12899 |
| 284 | Ga0207704_10101636 | 3300025938 | Bacteria | 1918 |
| 285 | Ga0207665_10003509 | 3300025939 | Bacteria | 10472 |
| 286 | Ga0207665_10008675 | 3300025939 | Bacteria | 6690 |
| 287 | Ga0207691_10022514 | 3300025940 | Bacteria | 5942 |
| 288 | Ga0207691_10100575 | 3300025940 | Bacteria | 2580 |
| 289 | Ga0207711_10000422 | 3300025941 | Bacteria | 44472 |
| 290 | Ga0207711_10015465 | 3300025941 | Bacteria | 6333 |
| 291 | Ga0207711_10477434 | 3300025941 | Bacteria | 1161 |
| 292 | Ga0207711_10845916 | 3300025941 | Bacteria | 851 |
| 293 | Ga0207689_10026498 | 3300025942 | Bacteria | 4854 |
| 294 | Ga0207689_10040614 | 3300025942 | Bacteria | 3850 |
| 295 | Ga0207679_10695938 | 3300025945 | Bacteria | 922 |
| 296 | Ga0207667_10047452 | 3300025949 | Bacteria | 4546 |
| 297 | Ga0207667_10082265 | 3300025949 | Bacteria | 3335 |
| 298 | Ga0207667_10564980 | 3300025949 | Bacteria | 1150 |
| 299 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 300 | Ga0207712_10079144 | 3300025961 | Bacteria | 2387 |
| 301 | Ga0207712_10212755 | 3300025961 | Bacteria | 1541 |
| 302 | Ga0207712_10450086 | 3300025961 | Bacteria | 1092 |
| 303 | Ga0207712_10710970 | 3300025961 | Bacteria | 878 |
| 304 | Ga0207668_10047736 | 3300025972 | Bacteria | 2933 |
| 305 | Ga0207668_10367372 | 3300025972 | Bacteria | 1207 |
| 306 | Ga0207668_10620707 | 3300025972 | Bacteria | 943 |
| 307 | Ga0207640_10006104 | 3300025981 | Bacteria | 6586 |
| 308 | Ga0207640_10083935 | 3300025981 | Bacteria | 2185 |
| 309 | Ga0207658_10000257 | 3300025986 | Bacteria | 55345 |
| 310 | Ga0207658_10002336 | 3300025986 | Bacteria | 13934 |
| 311 | Ga0207658_10015885 | 3300025986 | Bacteria | 5170 |
| 312 | Ga0207658_10196665 | 3300025986 | Bacteria | 1680 |
| 313 | Ga0207658_10232064 | 3300025986 | Bacteria | 1558 |
| 314 | Ga0207677_10011540 | 3300026023 | Bacteria | 5043 |
| 315 | Ga0207677_10026067 | 3300026023 | Bacteria | 3660 |
| 316 | Ga0207677_10098171 | 3300026023 | Bacteria | 2148 |
| 317 | Ga0207703_10009971 | 3300026035 | Bacteria | 7451 |
| 318 | Ga0207703_10072092 | 3300026035 | Bacteria | 2854 |
| 319 | Ga0207703_10205933 | 3300026035 | Bacteria | 1751 |
| 320 | Ga0207703_10307136 | 3300026035 | Bacteria | 1449 |
| 321 | Ga0207703_10688102 | 3300026035 | Bacteria | 972 |
| 322 | Ga0207703_10766971 | 3300026035 | Bacteria | 919 |
| 323 | Ga0207639_10277298 | 3300026041 | Bacteria | 1473 |
| 324 | Ga0207678_10009744 | 3300026067 | Bacteria | 8447 |
| 325 | Ga0207678_10011396 | 3300026067 | Bacteria | 7803 |
| 326 | Ga0207678_10033659 | 3300026067 | Bacteria | 4464 |
| 327 | Ga0207708_10000765 | 3300026075 | Bacteria | 24175 |
| 328 | Ga0207708_10011035 | 3300026075 | Bacteria | 6718 |
| 329 | Ga0207702_10293858 | 3300026078 | Bacteria | 1540 |
| 330 | Ga0207702_11217755 | 3300026078 | Bacteria | 747 |
| 331 | Ga0207641_10002535 | 3300026088 | Bacteria | 16809 |
| 332 | Ga0207641_10009310 | 3300026088 | Bacteria | 8102 |
| 333 | Ga0207641_10175777 | 3300026088 | Bacteria | 1958 |
| 334 | Ga0207641_10655269 | 3300026088 | Bacteria | 1031 |
| 335 | Ga0207641_11309494 | 3300026088 | Bacteria | 725 |
| 336 | Ga0207648_10020206 | 3300026089 | Bacteria | 6002 |
| 337 | Ga0207648_10103348 | 3300026089 | Bacteria | 2498 |
| 338 | Ga0207676_10045218 | 3300026095 | Bacteria | 3401 |
| 339 | Ga0207676_10178784 | 3300026095 | Bacteria | 1856 |
| 340 | Ga0207676_11215028 | 3300026095 | Bacteria | 747 |
| 341 | Ga0207675_100001697 | 3300026118 | Bacteria | 22065 |
| 342 | Ga0207675_100026851 | 3300026118 | Bacteria | 5358 |
| 343 | Ga0207675_100124295 | 3300026118 | Bacteria | 2443 |
| 344 | Ga0207683_10001526 | 3300026121 | Bacteria | 20849 |
| 345 | Ga0207683_10056149 | 3300026121 | Bacteria | 3453 |
| 346 | Ga0207698_10476272 | 3300026142 | Bacteria | 1210 |
| 347 | Ga0207428_10213885 | 3300027907 | Bacteria | 1447 |
| 348 | Ga0268266_10031437 | 3300028379 | Bacteria | 4508 |
| 349 | Ga0268265_10000105 | 3300028380 | Bacteria | 105463 |
| 350 | Ga0268265_10120995 | 3300028380 | Bacteria | 2156 |
| 351 | Ga0268265_10269765 | 3300028380 | Bacteria | 1517 |
| 352 | Ga0268265_10664119 | 3300028380 | Bacteria | 1003 |
| 353 | Ga0268264_10000237 | 3300028381 | Bacteria | 105274 |
| 354 | Ga0268264_10025357 | 3300028381 | Bacteria | 4844 |
| 355 | Ga0307413_10517032 | 3300031824 | Bacteria | 962 |
| 356 | Ga0307410_11047855 | 3300031852 | Bacteria | 705 |
| 357 | Ga0307409_100462606 | 3300031995 | Bacteria | 1227 |
| 358 | Ga0307415_100598479 | 3300032126 | Bacteria | 981 |
| 359 | Ga0373958_0027423 | 3300034819 | Bacteria | 1097 |
| 360 | Ga0373959_0012019 | 3300034820 | Bacteria | 1539 |
| 361 | Ga0373941_0212575 | 3300035115 | Bacteria | 740 |
| 362 | Ga0373935_0254463 | 3300035692 | Bacteria | 1230 |
| 363 | Ga0373947_0617819 | 3300035725 | Bacteria | 739 |
| 364 | Ga0439465_0039760 | 3300041413 | Bacteria | 1519 |
| 365 | Ga0451789_1027580 | 3300041443 | Bacteria | 1512 |
| 366 | Ga0451791_1509984 | 3300041451 | Bacteria | 958 |
| 367 | Ga0451793_0823906 | 3300041452 | Bacteria | 582 |
| 368 | Ga0451797_0009327 | 3300041453 | Bacteria | 1090 |
| 369 | Ga0451807_0411397 | 3300041486 | Bacteria | 898 |
| 370 | Ga0451841_0153296 | 3300041498 | Bacteria | 737 |
| 371 | Ga0451847_0193211 | 3300041503 | Bacteria | 775 |
| 372 | Ga0451855_1110169 | 3300041511 | Bacteria | 976 |
| 373 | Ga0439435_0038111 | 3300042436 | Bacteria | 1335 |
| 374 | Ga0466972_0081447 | 3300044658 | Bacteria | 1541 |
| 375 | Ga0466965_0009934 | 3300044683 | Bacteria | 4428 |
| 376 | Ga0466968_0057597 | 3300044735 | Bacteria | 1671 |
| 377 | Ga0466960_0000507 | 3300044901 | Bacteria | 13343 |
| 378 | Ga0466960_0087458 | 3300044901 | Bacteria | 1582 |
| 379 | Ga0466960_0147086 | 3300044901 | Bacteria | 1256 |
| 380 | Ga0466967_0560930 | 3300045976 | Bacteria | 1125 |
| 381 | Ga0495603_0011829 | 3300046455 | Bacteria | 5281 |
| 382 | Ga0495629_0013340 | 3300046459 | Bacteria | 5928 |
| 383 | Ga0495582_0010870 | 3300046473 | Bacteria | 5009 |
| 384 | Ga0495662_0132436 | 3300046476 | Bacteria | 1226 |
| 385 | Ga0495664_0052525 | 3300046477 | Bacteria | 2422 |
| 386 | Ga0495664_0133829 | 3300046477 | Bacteria | 1502 |
| 387 | Ga0495608_0194731 | 3300046511 | Bacteria | 1279 |
| 388 | Ga0495666_0151529 | 3300046526 | Bacteria | 1078 |
| 389 | Ga0495665_0077194 | 3300046531 | Bacteria | 1753 |
| 390 | Ga0495665_0328207 | 3300046531 | Bacteria | 781 |
| 391 | Ga0495667_0698120 | 3300046559 | Bacteria | 629 |
| 392 | Ga0495635_0137598 | 3300046663 | Bacteria | 1664 |
| 393 | Ga0495588_0068837 | 3300046674 | Bacteria | 1839 |
| 394 | Ga0495646_0337631 | 3300046680 | Bacteria | 791 |
| 395 | Ga0495658_0406163 | 3300046683 | Bacteria | 868 |
| 396 | Ga0495624_0075510 | 3300046690 | Bacteria | 2093 |
| 397 | Ga0495581_0049336 | 3300047315 | Bacteria | 2430 |
| 398 | Ga0495672_0452707 | 3300047320 | Bacteria | 578 |
| 399 | Ga0495593_0001584 | 3300047673 | Bacteria | 13424 |
| 400 | Ga0496100_0000699 | 3300048903 | Bacteria | 16023 |
| 401 | Ga0496100_0045092 | 3300048903 | Bacteria | 2828 |
| 402 | Ga0496101_0000404 | 3300048904 | Bacteria | 28116 |
| 403 | Ga0496101_0002102 | 3300048904 | Bacteria | 12141 |
| 404 | Ga0496101_0064244 | 3300048904 | Bacteria | 2673 |
| 405 | Ga0496101_0222898 | 3300048904 | Bacteria | 1464 |
| 406 | Ga0496102_0000526 | 3300048905 | Bacteria | 41473 |
| 407 | Ga0496102_0001326 | 3300048905 | Bacteria | 22215 |
| 408 | Ga0496102_0043483 | 3300048905 | Bacteria | 4074 |
| 409 | Ga0496102_0085945 | 3300048905 | Bacteria | 2905 |
| 410 | Ga0496102_0218474 | 3300048905 | Bacteria | 1796 |
| 411 | Ga0496102_1105828 | 3300048905 | Bacteria | 712 |
| 412 | Ga0496103_0000356 | 3300048906 | Bacteria | 41484 |
| 413 | Ga0496103_0042693 | 3300048906 | Bacteria | 2791 |
| 414 | Ga0496103_0147728 | 3300048906 | Bacteria | 1505 |
| 415 | Ga0496103_0281446 | 3300048906 | Bacteria | 1070 |
| 416 | Ga0496104_0005645 | 3300048907 | Bacteria | 10956 |
| 417 | Ga0496104_0027623 | 3300048907 | Bacteria | 5253 |
| 418 | Ga0496104_0360557 | 3300048907 | Bacteria | 1366 |
| 419 | Ga0496104_0483853 | 3300048907 | Bacteria | 1149 |
| 420 | Ga0496105_0007351 | 3300048908 | Bacteria | 8518 |
| 421 | Ga0496105_0062741 | 3300048908 | Bacteria | 3067 |
| 422 | Ga0496105_0108100 | 3300048908 | Bacteria | 2296 |
| 423 | Ga0496106_0001273 | 3300048909 | Bacteria | 18904 |
| 424 | Ga0496106_0068849 | 3300048909 | Bacteria | 2700 |
| 425 | Ga0496106_0287804 | 3300048909 | Bacteria | 1317 |
| 426 | Ga0496107_0000481 | 3300048910 | Bacteria | 21897 |
| 427 | Ga0496107_0010487 | 3300048910 | Bacteria | 6440 |
| 428 | Ga0496107_0037801 | 3300048910 | Bacteria | 3465 |
| 429 | Ga0496108_0000767 | 3300048911 | Bacteria | 25031 |
| 430 | Ga0496108_0006187 | 3300048911 | Bacteria | 9688 |
| 431 | Ga0496108_0080037 | 3300048911 | Bacteria | 2767 |
| 432 | Ga0496108_0694040 | 3300048911 | Bacteria | 883 |
| 433 | Ga0496108_0707006 | 3300048911 | Bacteria | 874 |
| 434 | Ga0496109_0039201 | 3300048912 | Bacteria | 4287 |
| 435 | Ga0496109_0051118 | 3300048912 | Bacteria | 3764 |
| 436 | Ga0496109_0170873 | 3300048912 | Bacteria | 2039 |
| 437 | Ga0496109_0463275 | 3300048912 | Bacteria | 1197 |
| 438 | Ga0496109_0583329 | 3300048912 | Bacteria | 1054 |
| 439 | Ga0496109_0734596 | 3300048912 | Bacteria | 925 |
| 440 | Ga0496110_0003562 | 3300048913 | Bacteria | 11961 |
| 441 | Ga0496110_0716733 | 3300048913 | Bacteria | 902 |
| 442 | Ga0496111_0026772 | 3300048914 | Bacteria | 4074 |
| 443 | Ga0496111_0049502 | 3300048914 | Bacteria | 3030 |
| 444 | Ga0496112_0029780 | 3300048915 | Bacteria | 5282 |
| 445 | Ga0496112_0031758 | 3300048915 | Bacteria | 5123 |
| 446 | Ga0496112_0041130 | 3300048915 | Bacteria | 4521 |
| 447 | Ga0496113_0692276 | 3300048916 | Bacteria | 814 |
| 448 | Ga0496114_0000979 | 3300048917 | Bacteria | 21389 |
| 449 | Ga0496114_0341987 | 3300048917 | Bacteria | 1323 |
| 450 | Ga0496114_0351011 | 3300048917 | Bacteria | 1305 |
| 451 | Ga0496114_1507553 | 3300048917 | Bacteria | 560 |
| 452 | Ga0496115_0909940 | 3300048918 | Bacteria | 678 |
| 453 | Ga0496116_0008070 | 3300048919 | Bacteria | 9209 |
| 454 | Ga0496117_0000614 | 3300048920 | Bacteria | 57852 |
| 455 | Ga0496118_0000558 | 3300048921 | Bacteria | 61328 |
| 456 | Ga0496120_0008662 | 3300048923 | Bacteria | 7340 |
| 457 | Ga0496121_0010416 | 3300048924 | Bacteria | 10490 |
| 458 | Ga0496126_0006132 | 3300048929 | Bacteria | 13470 |
| 459 | Ga0501047_0697168 | 3300049581 | Bacteria | 833 |
| 460 | Ga0501044_0060802 | 3300049823 | Bacteria | 3867 |
| 461 | nmdc:mga03683_140641_c1 | 3300050489 | Bacteria | 1085 |
| 462 | nmdc:mga03683_20826_c1 | 3300050489 | Bacteria | 2521 |
| 463 | nmdc:mga03683_23329_c1 | 3300050489 | Bacteria | 2409 |
| 464 | nmdc:mga03683_372673_c1 | 3300050489 | Bacteria | 678 |
| 465 | nmdc:mga03683_391065_c1 | 3300050489 | Bacteria | 663 |
| 466 | nmdc:mga03n38_106362_c1 | 3300050490 | Bacteria | 1360 |
| 467 | nmdc:mga03n38_20029_c1 | 3300050490 | Bacteria | 2670 |
| 468 | nmdc:mga03n38_3403_c1 | 3300050490 | Bacteria | 5102 |
| 469 | nmdc:mga03n38_3703_c1 | 3300050490 | Bacteria | 4947 |
| 470 | nmdc:mga03n38_4031_c1 | 3300050490 | Bacteria | 4804 |
| 471 | nmdc:mga03n38_525746_c1 | 3300050490 | Bacteria | 666 |
| 472 | nmdc:mga03n38_75281_c1 | 3300050490 | Bacteria | 1572 |
| 473 | nmdc:mga00v17_19292_c1 | 3300050491 | Bacteria | 3891 |
| 474 | nmdc:mga00v17_255783_c1 | 3300050491 | Bacteria | 1136 |
| 475 | nmdc:mga00v17_395765_c1 | 3300050491 | Bacteria | 898 |
| 476 | nmdc:mga00v17_594987_c1 | 3300050491 | Bacteria | 713 |
| 477 | nmdc:mga00v17_67914_c1 | 3300050491 | Bacteria | 2203 |
| 478 | nmdc:mga00v17_7067_c1 | 3300050491 | Bacteria | 5977 |
| 479 | nmdc:mga0yw44_33635_c1 | 3300050492 | Bacteria | 2997 |
| 480 | nmdc:mga0yw44_86224_c1 | 3300050492 | Bacteria | 1977 |
| 481 | nmdc:mga06z11_1106_c1 | 3300050494 | Bacteria | 9845 |
| 482 | nmdc:mga06z11_33083_c1 | 3300050494 | Bacteria | 2526 |
| 483 | nmdc:mga06z11_505561_c1 | 3300050494 | Bacteria | 732 |
| 484 | nmdc:mga07m45_3272_c1 | 3300050496 | Bacteria | 7790 |
| 485 | nmdc:mga07m45_402188_c1 | 3300050496 | Bacteria | 795 |
| 486 | nmdc:mga07m45_444142_c1 | 3300050496 | Bacteria | 752 |
| 487 | nmdc:mga07m45_7113_c1 | 3300050496 | Bacteria | 3677 |
| 488 | nmdc:mga07m45_857272_c1 | 3300050496 | Bacteria | 520 |
| 489 | nmdc:mga08y16_286001_c1 | 3300050511 | Bacteria | 1700 |
| 490 | nmdc:mga0rr50_580457_c1 | 3300050513 | Bacteria | 955 |
| 491 | nmdc:mga0sz30_112209_c1 | 3300050516 | Bacteria | 1195 |
| 492 | nmdc:mga0sz30_195377_c1 | 3300050516 | Bacteria | 898 |
| 493 | nmdc:mga0sz30_24038_c1 | 3300050516 | Bacteria | 2485 |
| 494 | nmdc:mga0sz30_62245_c1 | 3300050516 | Bacteria | 1596 |
| 495 | nmdc:mga0sz30_7022_c1 | 3300050516 | Bacteria | 4209 |
| 496 | nmdc:mga0sz30_9208_c1 | 3300050516 | Bacteria | 2201 |
| 497 | Ga0495655_0005812 | 3300053083 | Bacteria | 2202 |
| 498 | Ga0500643_014196 | 3300053087 | Bacteria | 2779 |
| 499 | Ga0500652_005108 | 3300053131 | Bacteria | 4106 |
| 500 | Ga0500616_0035765 | 3300053153 | Bacteria | 2699 |
| 501 | Ga0500620_037311 | 3300053155 | Bacteria | 1576 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006178 | Ga0075367_10087055 | Ga0075367_100870552 | 137 |
| 2 | 3300009177 | Ga0105248_11356870 | Ga0105248_113568702 | 137 |
| 3 | 3300010375 | Ga0105239_10653912 | Ga0105239_106539122 | 137 |
| 4 | 3300041452 | Ga0451793_0823906 | Ga0451793_0823906_139_552 | 137 |
| 5 | 3300044735 | Ga0466968_0057597 | Ga0466968_0057597_37_450 | 137 |
| 6 | 3300048911 | Ga0496108_0080037 | Ga0496108_0080037_475_888 | 137 |
| 7 | 3300048915 | Ga0496112_0041130 | Ga0496112_0041130_1914_2327 | 137 |
| 8 | 3300009553 | Ga0105249_12679961 | Ga0105249_126799611 | 139 |
| 9 | 3300013308 | Ga0157375_11047745 | Ga0157375_110477452 | 139 |
| 10 | 3300020081 | Ga0206354_11466338 | Ga0206354_114663382 | 139 |
| 11 | 3300025936 | Ga0207670_10074703 | Ga0207670_100747033 | 139 |
| 12 | 3300026078 | Ga0207702_11217755 | Ga0207702_112177551 | 139 |
| 13 | 3300041453 | Ga0451797_0009327 | Ga0451797_0009327_18_437 | 139 |
| 14 | 3300041503 | Ga0451847_0193211 | Ga0451847_0193211_112_531 | 139 |
| 15 | 3300046663 | Ga0495635_0137598 | Ga0495635_0137598_1212_1631 | 139 |
| 16 | 3300048917 | Ga0496114_1507553 | Ga0496114_1507553_58_477 | 139 |
| 17 | 3300047320 | Ga0495672_0452707 | Ga0495672_0452707_104_526 | 140 |
| 18 | 3300050516 | nmdc:mga0sz30_195377_c1 | nmdc:mga0sz30_195377_c1_311_733 | 140 |
| 19 | 3300048912 | Ga0496109_0583329 | Ga0496109_0583329_599_1024 | 141 |
| 20 | 3300053087 | Ga0500643_014196 | Ga0500643_014196_1680_2150 | 141 |
| 21 | 3300049581 | Ga0501047_0697168 | Ga0501047_0697168_15_443 | 142 |
| 22 | 3300005337 | Ga0070682_100002087 | Ga0070682_1000020875 | 146 |
| 23 | 3300005366 | Ga0070659_100752430 | Ga0070659_1007524302 | 146 |
| 24 | 3300005455 | Ga0070663_100234998 | Ga0070663_1002349982 | 146 |
| 25 | 3300005543 | Ga0070672_100421718 | Ga0070672_1004217181 | 146 |
| 26 | 3300005548 | Ga0070665_100928124 | Ga0070665_1009281242 | 146 |
| 27 | 3300006048 | Ga0075363_100082771 | Ga0075363_1000827713 | 146 |
| 28 | 3300025901 | Ga0207688_10118017 | Ga0207688_101180172 | 146 |
| 29 | 3300025908 | Ga0207643_10441858 | Ga0207643_104418581 | 146 |
| 30 | 3300025924 | Ga0207694_10234582 | Ga0207694_102345822 | 146 |
| 31 | 3300025927 | Ga0207687_10473828 | Ga0207687_104738282 | 146 |
| 32 | 3300025981 | Ga0207640_10083935 | Ga0207640_100839351 | 146 |
| 33 | 3300026067 | Ga0207678_10011396 | Ga0207678_100113962 | 146 |
| 34 | 3300026095 | Ga0207676_10178784 | Ga0207676_101787842 | 146 |
| 35 | 3300050516 | nmdc:mga0sz30_7022_c1 | nmdc:mga0sz30_7022_c1_435_878 | 147 |
| 36 | 3300041443 | Ga0451789_1027580 | Ga0451789_1027580_915_1415 | 148 |
| 37 | 3300046477 | Ga0495664_0052525 | Ga0495664_0052525_1687_2136 | 149 |
| 38 | 3300005345 | Ga0070692_10323334 | Ga0070692_103233341 | 150 |
| 39 | 3300006048 | Ga0075363_100316504 | Ga0075363_1003165042 | 150 |
| 40 | 3300009098 | Ga0105245_10921972 | Ga0105245_109219722 | 150 |
| 41 | 3300009148 | Ga0105243_10091450 | Ga0105243_100914503 | 150 |
| 42 | 3300009551 | Ga0105238_10361606 | Ga0105238_103616062 | 150 |
| 43 | 3300010375 | Ga0105239_10103944 | Ga0105239_101039442 | 150 |
| 44 | 3300014325 | Ga0163163_10214818 | Ga0163163_102148182 | 150 |
| 45 | 3300025945 | Ga0207679_10695938 | Ga0207679_106959382 | 150 |
| 46 | 3300048911 | Ga0496108_0006187 | Ga0496108_0006187_5841_6311 | 150 |
| 47 | 3300048912 | Ga0496109_0051118 | Ga0496109_0051118_1083_1553 | 150 |
| 48 | 3300048915 | Ga0496112_0031758 | Ga0496112_0031758_2997_3467 | 150 |
| 49 | 3300050490 | nmdc:mga03n38_3403_c1 | nmdc:mga03n38_3403_c1_204_674 | 150 |
| 50 | 3300050490 | nmdc:mga03n38_525746_c1 | nmdc:mga03n38_525746_c1_44_517 | 150 |
| 51 | 3300050496 | nmdc:mga07m45_444142_c1 | nmdc:mga07m45_444142_c1_68_538 | 150 |
| 52 | 3300006038 | Ga0075365_10004858 | Ga0075365_100048585 | 151 |
| 53 | 3300006048 | Ga0075363_100018604 | Ga0075363_1000186042 | 151 |
| 54 | 3300006048 | Ga0075363_100312295 | Ga0075363_1003122951 | 151 |
| 55 | 3300006051 | Ga0075364_10235495 | Ga0075364_102354952 | 151 |
| 56 | 3300006177 | Ga0075362_10022987 | Ga0075362_100229872 | 151 |
| 57 | 3300006186 | Ga0075369_10036105 | Ga0075369_100361052 | 151 |
| 58 | 3300041413 | Ga0439465_0039760 | Ga0439465_0039760_285_740 | 151 |
| 59 | 3300041451 | Ga0451791_1509984 | Ga0451791_1509984_407_877 | 151 |
| 60 | 3300041486 | Ga0451807_0411397 | Ga0451807_0411397_276_746 | 151 |
| 61 | 3300042436 | Ga0439435_0038111 | Ga0439435_0038111_772_1227 | 151 |
| 62 | 3300045976 | Ga0466967_0560930 | Ga0466967_0560930_55_510 | 151 |
| 63 | 3300050489 | nmdc:mga03683_23329_c1 | nmdc:mga03683_23329_c1_1384_1839 | 151 |
| 64 | 3300050491 | nmdc:mga00v17_395765_c1 | nmdc:mga00v17_395765_c1_197_652 | 151 |
| 65 | 3300050492 | nmdc:mga0yw44_33635_c1 | nmdc:mga0yw44_33635_c1_403_858 | 151 |
| 66 | 3300050496 | nmdc:mga07m45_857272_c1 | nmdc:mga07m45_857272_c1_43_498 | 151 |
| 67 | 3300050516 | nmdc:mga0sz30_24038_c1 | nmdc:mga0sz30_24038_c1_676_1131 | 151 |
| 68 | 3300050516 | nmdc:mga0sz30_9208_c1 | nmdc:mga0sz30_9208_c1_179_634 | 151 |
| 69 | 3300005338 | Ga0068868_100215738 | Ga0068868_1002157382 | 152 |
| 70 | 3300005339 | Ga0070660_100780242 | Ga0070660_1007802422 | 152 |
| 71 | 3300026023 | Ga0207677_10098171 | Ga0207677_100981712 | 152 |
| 72 | iso_pu_bacteria | 2643221687 | 2644486750 | 152 |
| 73 | iso_pu_bacteria | 2744054611 | 2744954543 | 152 |
| 74 | iso_pu_bacteria | 2902792274 | 2902793849 | 152 |
| 75 | iso_pu_bacteria | 2902837492 | 2902842128 | 152 |
| 76 | iso_pu_bacteria | 2939582691 | 2939586220 | 152 |
| 77 | 3300002459 | JGI24751J29686_10007668 | JGI24751J29686_100076681 | 154 |
| 78 | 3300005355 | Ga0070671_100001738 | Ga0070671_10000173811 | 154 |
| 79 | 3300005544 | Ga0070686_100158235 | Ga0070686_1001582352 | 154 |
| 80 | 3300005548 | Ga0070665_100001277 | Ga0070665_10000127728 | 154 |
| 81 | 3300005617 | Ga0068859_100289142 | Ga0068859_1002891422 | 154 |
| 82 | 3300005841 | Ga0068863_100016807 | Ga0068863_1000168076 | 154 |
| 83 | 3300005842 | Ga0068858_100170493 | Ga0068858_1001704933 | 154 |
| 84 | 3300006931 | Ga0097620_100289119 | Ga0097620_1002891192 | 154 |
| 85 | 3300009553 | Ga0105249_11958679 | Ga0105249_119586791 | 154 |
| 86 | 3300014325 | Ga0163163_10053670 | Ga0163163_100536706 | 154 |
| 87 | 3300014968 | Ga0157379_10454656 | Ga0157379_104546562 | 154 |
| 88 | 3300025931 | Ga0207644_10001674 | Ga0207644_100016747 | 154 |
| 89 | 3300025986 | Ga0207658_10002336 | Ga0207658_100023368 | 154 |
| 90 | 3300025986 | Ga0207658_10232064 | Ga0207658_102320642 | 154 |
| 91 | 3300026035 | Ga0207703_10688102 | Ga0207703_106881022 | 154 |
| 92 | 3300026088 | Ga0207641_10009310 | Ga0207641_100093106 | 154 |
| 93 | 3300026095 | Ga0207676_11215028 | Ga0207676_112150281 | 154 |
| 94 | 3300048904 | Ga0496101_0064244 | Ga0496101_0064244_1554_2018 | 154 |
| 95 | 3300048905 | Ga0496102_0001326 | Ga0496102_0001326_10343_10807 | 154 |
| 96 | 3300048907 | Ga0496104_0005645 | Ga0496104_0005645_8955_9419 | 154 |
| 97 | 3300048908 | Ga0496105_0108100 | Ga0496105_0108100_452_916 | 154 |
| 98 | 3300048911 | Ga0496108_0694040 | Ga0496108_0694040_353_817 | 154 |
| 99 | 3300048912 | Ga0496109_0039201 | Ga0496109_0039201_757_1221 | 154 |
| 100 | 3300048913 | Ga0496110_0003562 | Ga0496110_0003562_8386_8850 | 154 |
| 101 | 3300048914 | Ga0496111_0049502 | Ga0496111_0049502_1508_1972 | 154 |
| 102 | 3300048916 | Ga0496113_0692276 | Ga0496113_0692276_13_477 | 154 |
| 103 | 3300050489 | nmdc:mga03683_20826_c1 | nmdc:mga03683_20826_c1_791_1255 | 154 |
| 104 | 3300050490 | nmdc:mga03n38_4031_c1 | nmdc:mga03n38_4031_c1_1921_2385 | 154 |
| 105 | 3300050491 | nmdc:mga00v17_7067_c1 | nmdc:mga00v17_7067_c1_197_661 | 154 |
| 106 | 3300050494 | nmdc:mga06z11_1106_c1 | nmdc:mga06z11_1106_c1_7503_7967 | 154 |
| 107 | 3300050496 | nmdc:mga07m45_3272_c1 | nmdc:mga07m45_3272_c1_2848_3312 | 154 |
| 108 | 3300046531 | Ga0495665_0328207 | Ga0495665_0328207_66_767 | 155 |
| 109 | 3300000546 | LJNas_1006115 | LJNas_10061152 | 156 |
| 110 | 3300001989 | JGI24739J22299_10023732 | JGI24739J22299_100237322 | 156 |
| 111 | 3300001989 | JGI24739J22299_10044795 | JGI24739J22299_100447952 | 156 |
| 112 | 3300001990 | JGI24737J22298_10034638 | JGI24737J22298_100346382 | 156 |
| 113 | 3300001990 | JGI24737J22298_10089942 | JGI24737J22298_100899422 | 156 |
| 114 | 3300002067 | JGI24735J21928_10060269 | JGI24735J21928_100602692 | 156 |
| 115 | 3300002070 | JGI24750J21931_1005331 | JGI24750J21931_10053313 | 156 |
| 116 | 3300002073 | JGI24745J21846_1009564 | JGI24745J21846_10095641 | 156 |
| 117 | 3300002073 | JGI24745J21846_1013739 | JGI24745J21846_10137392 | 156 |
| 118 | 3300002074 | JGI24748J21848_1005796 | JGI24748J21848_10057962 | 156 |
| 119 | 3300002075 | JGI24738J21930_10008008 | JGI24738J21930_100080082 | 156 |
| 120 | 3300002075 | JGI24738J21930_10022542 | JGI24738J21930_100225422 | 156 |
| 121 | 3300002076 | JGI24749J21850_1027757 | JGI24749J21850_10277572 | 156 |
| 122 | 3300002077 | JGI24744J21845_10001117 | JGI24744J21845_100011173 | 156 |
| 123 | 3300002077 | JGI24744J21845_10001144 | JGI24744J21845_100011443 | 156 |
| 124 | 3300002239 | JGI24034J26672_10016280 | JGI24034J26672_100162802 | 156 |
| 125 | 3300002244 | JGI24742J22300_10013083 | JGI24742J22300_100130832 | 156 |
| 126 | 3300002244 | JGI24742J22300_10022087 | JGI24742J22300_100220872 | 156 |
| 127 | 3300002244 | JGI24742J22300_10078522 | JGI24742J22300_100785221 | 156 |
| 128 | 3300005328 | Ga0070676_10325065 | Ga0070676_103250652 | 156 |
| 129 | 3300005330 | Ga0070690_100174449 | Ga0070690_1001744492 | 156 |
| 130 | 3300005333 | Ga0070677_10088145 | Ga0070677_100881451 | 156 |
| 131 | 3300005334 | Ga0068869_100031741 | Ga0068869_1000317414 | 156 |
| 132 | 3300005334 | Ga0068869_100083514 | Ga0068869_1000835142 | 156 |
| 133 | 3300005335 | Ga0070666_10107811 | Ga0070666_101078112 | 156 |
| 134 | 3300005337 | Ga0070682_100030688 | Ga0070682_1000306882 | 156 |
| 135 | 3300005338 | Ga0068868_100017677 | Ga0068868_1000176772 | 156 |
| 136 | 3300005338 | Ga0068868_100035192 | Ga0068868_1000351924 | 156 |
| 137 | 3300005338 | Ga0068868_100183082 | Ga0068868_1001830822 | 156 |
| 138 | 3300005339 | Ga0070660_100134631 | Ga0070660_1001346312 | 156 |
| 139 | 3300005340 | Ga0070689_100010644 | Ga0070689_1000106444 | 156 |
| 140 | 3300005340 | Ga0070689_100107703 | Ga0070689_1001077033 | 156 |
| 141 | 3300005341 | Ga0070691_10000651 | Ga0070691_100006516 | 156 |
| 142 | 3300005345 | Ga0070692_10052846 | Ga0070692_100528463 | 156 |
| 143 | 3300005345 | Ga0070692_10216545 | Ga0070692_102165452 | 156 |
| 144 | 3300005347 | Ga0070668_100003168 | Ga0070668_1000031686 | 156 |
| 145 | 3300005347 | Ga0070668_100257695 | Ga0070668_1002576951 | 156 |
| 146 | 3300005347 | Ga0070668_100263907 | Ga0070668_1002639072 | 156 |
| 147 | 3300005353 | Ga0070669_100021129 | Ga0070669_1000211293 | 156 |
| 148 | 3300005353 | Ga0070669_100065360 | Ga0070669_1000653603 | 156 |
| 149 | 3300005354 | Ga0070675_100266897 | Ga0070675_1002668972 | 156 |
| 150 | 3300005354 | Ga0070675_100291912 | Ga0070675_1002919122 | 156 |
| 151 | 3300005355 | Ga0070671_100881625 | Ga0070671_1008816251 | 156 |
| 152 | 3300005356 | Ga0070674_100004119 | Ga0070674_1000041196 | 156 |
| 153 | 3300005356 | Ga0070674_100237447 | Ga0070674_1002374472 | 156 |
| 154 | 3300005365 | Ga0070688_100028037 | Ga0070688_1000280372 | 156 |
| 155 | 3300005365 | Ga0070688_100090713 | Ga0070688_1000907132 | 156 |
| 156 | 3300005366 | Ga0070659_100108029 | Ga0070659_1001080292 | 156 |
| 157 | 3300005367 | Ga0070667_100000109 | Ga0070667_10000010944 | 156 |
| 158 | 3300005367 | Ga0070667_100002710 | Ga0070667_10000271016 | 156 |
| 159 | 3300005367 | Ga0070667_100048456 | Ga0070667_1000484562 | 156 |
| 160 | 3300005367 | Ga0070667_100158628 | Ga0070667_1001586282 | 156 |
| 161 | 3300005434 | Ga0070709_10105885 | Ga0070709_101058852 | 156 |
| 162 | 3300005437 | Ga0070710_10010347 | Ga0070710_100103475 | 156 |
| 163 | 3300005438 | Ga0070701_10003505 | Ga0070701_100035052 | 156 |
| 164 | 3300005439 | Ga0070711_100001045 | Ga0070711_1000010459 | 156 |
| 165 | 3300005439 | Ga0070711_100191476 | Ga0070711_1001914762 | 156 |
| 166 | 3300005440 | Ga0070705_100010867 | Ga0070705_1000108673 | 156 |
| 167 | 3300005441 | Ga0070700_100023077 | Ga0070700_1000230772 | 156 |
| 168 | 3300005441 | Ga0070700_100081063 | Ga0070700_1000810633 | 156 |
| 169 | 3300005444 | Ga0070694_100031039 | Ga0070694_1000310393 | 156 |
| 170 | 3300005445 | Ga0070708_100325102 | Ga0070708_1003251022 | 156 |
| 171 | 3300005445 | Ga0070708_101154813 | Ga0070708_1011548131 | 156 |
| 172 | 3300005455 | Ga0070663_100021413 | Ga0070663_1000214133 | 156 |
| 173 | 3300005455 | Ga0070663_100030903 | Ga0070663_1000309033 | 156 |
| 174 | 3300005455 | Ga0070663_101530338 | Ga0070663_1015303381 | 156 |
| 175 | 3300005456 | Ga0070678_100000765 | Ga0070678_1000007652 | 156 |
| 176 | 3300005456 | Ga0070678_100025601 | Ga0070678_1000256013 | 156 |
| 177 | 3300005457 | Ga0070662_100006348 | Ga0070662_1000063486 | 156 |
| 178 | 3300005457 | Ga0070662_100363107 | Ga0070662_1003631072 | 156 |
| 179 | 3300005459 | Ga0068867_100010729 | Ga0068867_1000107292 | 156 |
| 180 | 3300005459 | Ga0068867_100224446 | Ga0068867_1002244462 | 156 |
| 181 | 3300005466 | Ga0070685_10010069 | Ga0070685_100100693 | 156 |
| 182 | 3300005466 | Ga0070685_10437737 | Ga0070685_104377372 | 156 |
| 183 | 3300005539 | Ga0068853_100005160 | Ga0068853_10000516011 | 156 |
| 184 | 3300005539 | Ga0068853_100142996 | Ga0068853_1001429963 | 156 |
| 185 | 3300005543 | Ga0070672_100236351 | Ga0070672_1002363512 | 156 |
| 186 | 3300005543 | Ga0070672_100451741 | Ga0070672_1004517412 | 156 |
| 187 | 3300005544 | Ga0070686_100128722 | Ga0070686_1001287222 | 156 |
| 188 | 3300005545 | Ga0070695_100001027 | Ga0070695_10000102717 | 156 |
| 189 | 3300005546 | Ga0070696_100059197 | Ga0070696_1000591973 | 156 |
| 190 | 3300005547 | Ga0070693_100197778 | Ga0070693_1001977782 | 156 |
| 191 | 3300005547 | Ga0070693_100435751 | Ga0070693_1004357512 | 156 |
| 192 | 3300005548 | Ga0070665_100004708 | Ga0070665_1000047089 | 156 |
| 193 | 3300005548 | Ga0070665_100068012 | Ga0070665_1000680123 | 156 |
| 194 | 3300005548 | Ga0070665_100243819 | Ga0070665_1002438192 | 156 |
| 195 | 3300005549 | Ga0070704_100000397 | Ga0070704_1000003976 | 156 |
| 196 | 3300005563 | Ga0068855_100188498 | Ga0068855_1001884983 | 156 |
| 197 | 3300005563 | Ga0068855_100273314 | Ga0068855_1002733142 | 156 |
| 198 | 3300005578 | Ga0068854_100000953 | Ga0068854_10000095317 | 156 |
| 199 | 3300005578 | Ga0068854_100047123 | Ga0068854_1000471232 | 156 |
| 200 | 3300005614 | Ga0068856_100556626 | Ga0068856_1005566262 | 156 |
| 201 | 3300005615 | Ga0070702_100001771 | Ga0070702_1000017716 | 156 |
| 202 | 3300005617 | Ga0068859_100001848 | Ga0068859_10000184814 | 156 |
| 203 | 3300005617 | Ga0068859_100009757 | Ga0068859_1000097579 | 156 |
| 204 | 3300005617 | Ga0068859_100093042 | Ga0068859_1000930423 | 156 |
| 205 | 3300005618 | Ga0068864_100059026 | Ga0068864_1000590263 | 156 |
| 206 | 3300005718 | Ga0068866_10042932 | Ga0068866_100429323 | 156 |
| 207 | 3300005718 | Ga0068866_10292620 | Ga0068866_102926202 | 156 |
| 208 | 3300005719 | Ga0068861_100002222 | Ga0068861_10000222212 | 156 |
| 209 | 3300005719 | Ga0068861_100041357 | Ga0068861_1000413572 | 156 |
| 210 | 3300005719 | Ga0068861_100356458 | Ga0068861_1003564581 | 156 |
| 211 | 3300005841 | Ga0068863_100000123 | Ga0068863_10000012379 | 156 |
| 212 | 3300005841 | Ga0068863_100461105 | Ga0068863_1004611051 | 156 |
| 213 | 3300005841 | Ga0068863_100597427 | Ga0068863_1005974272 | 156 |
| 214 | 3300005842 | Ga0068858_100000702 | Ga0068858_10000070233 | 156 |
| 215 | 3300005842 | Ga0068858_100150772 | Ga0068858_1001507722 | 156 |
| 216 | 3300005842 | Ga0068858_100237322 | Ga0068858_1002373222 | 156 |
| 217 | 3300005842 | Ga0068858_100458680 | Ga0068858_1004586802 | 156 |
| 218 | 3300005842 | Ga0068858_101199056 | Ga0068858_1011990562 | 156 |
| 219 | 3300005843 | Ga0068860_100000175 | Ga0068860_10000017577 | 156 |
| 220 | 3300005843 | Ga0068860_100005175 | Ga0068860_1000051752 | 156 |
| 221 | 3300005843 | Ga0068860_100333457 | Ga0068860_1003334572 | 156 |
| 222 | 3300005844 | Ga0068862_100000091 | Ga0068862_10000009145 | 156 |
| 223 | 3300005844 | Ga0068862_100017029 | Ga0068862_1000170296 | 156 |
| 224 | 3300005844 | Ga0068862_100167780 | Ga0068862_1001677802 | 156 |
| 225 | 3300005937 | Ga0081455_10098009 | Ga0081455_100980093 | 156 |
| 226 | 3300005937 | Ga0081455_10277971 | Ga0081455_102779712 | 156 |
| 227 | 3300005981 | Ga0081538_10044214 | Ga0081538_100442142 | 156 |
| 228 | 3300006038 | Ga0075365_10002340 | Ga0075365_100023403 | 156 |
| 229 | 3300006038 | Ga0075365_10102718 | Ga0075365_101027183 | 156 |
| 230 | 3300006038 | Ga0075365_10113022 | Ga0075365_101130222 | 156 |
| 231 | 3300006038 | Ga0075365_10556902 | Ga0075365_105569023 | 156 |
| 232 | 3300006038 | Ga0075365_10729638 | Ga0075365_107296381 | 156 |
| 233 | 3300006048 | Ga0075363_100000148 | Ga0075363_10000014816 | 156 |
| 234 | 3300006048 | Ga0075363_100002407 | Ga0075363_1000024076 | 156 |
| 235 | 3300006048 | Ga0075363_100032947 | Ga0075363_1000329473 | 156 |
| 236 | 3300006048 | Ga0075363_100034577 | Ga0075363_1000345772 | 156 |
| 237 | 3300006048 | Ga0075363_100127977 | Ga0075363_1001279772 | 156 |
| 238 | 3300006048 | Ga0075363_100226287 | Ga0075363_1002262873 | 156 |
| 239 | 3300006051 | Ga0075364_10007126 | Ga0075364_100071264 | 156 |
| 240 | 3300006051 | Ga0075364_10012626 | Ga0075364_100126262 | 156 |
| 241 | 3300006051 | Ga0075364_10012757 | Ga0075364_100127574 | 156 |
| 242 | 3300006051 | Ga0075364_10028273 | Ga0075364_100282734 | 156 |
| 243 | 3300006051 | Ga0075364_10215096 | Ga0075364_102150962 | 156 |
| 244 | 3300006051 | Ga0075364_10372687 | Ga0075364_103726872 | 156 |
| 245 | 3300006163 | Ga0070715_10010309 | Ga0070715_100103093 | 156 |
| 246 | 3300006163 | Ga0070715_10040178 | Ga0070715_100401782 | 156 |
| 247 | 3300006173 | Ga0070716_100002953 | Ga0070716_1000029533 | 156 |
| 248 | 3300006173 | Ga0070716_100021945 | Ga0070716_1000219454 | 156 |
| 249 | 3300006173 | Ga0070716_100036872 | Ga0070716_1000368722 | 156 |
| 250 | 3300006173 | Ga0070716_101098816 | Ga0070716_1010988161 | 156 |
| 251 | 3300006175 | Ga0070712_100007460 | Ga0070712_1000074603 | 156 |
| 252 | 3300006175 | Ga0070712_100016423 | Ga0070712_1000164235 | 156 |
| 253 | 3300006175 | Ga0070712_100686709 | Ga0070712_1006867091 | 156 |
| 254 | 3300006177 | Ga0075362_10008695 | Ga0075362_100086954 | 156 |
| 255 | 3300006177 | Ga0075362_10165353 | Ga0075362_101653531 | 156 |
| 256 | 3300006178 | Ga0075367_10023903 | Ga0075367_100239034 | 156 |
| 257 | 3300006186 | Ga0075369_10003326 | Ga0075369_100033268 | 156 |
| 258 | 3300006186 | Ga0075369_10019069 | Ga0075369_100190693 | 156 |
| 259 | 3300006186 | Ga0075369_10057627 | Ga0075369_100576272 | 156 |
| 260 | 3300006186 | Ga0075369_10190737 | Ga0075369_101907372 | 156 |
| 261 | 3300006186 | Ga0075369_10229234 | Ga0075369_102292342 | 156 |
| 262 | 3300006237 | Ga0097621_100016973 | Ga0097621_1000169738 | 156 |
| 263 | 3300006237 | Ga0097621_100641632 | Ga0097621_1006416322 | 156 |
| 264 | 3300006353 | Ga0075370_10000207 | Ga0075370_1000020715 | 156 |
| 265 | 3300006353 | Ga0075370_10003007 | Ga0075370_100030074 | 156 |
| 266 | 3300006358 | Ga0068871_100080831 | Ga0068871_1000808313 | 156 |
| 267 | 3300006358 | Ga0068871_100255428 | Ga0068871_1002554282 | 156 |
| 268 | 3300006846 | Ga0075430_100118179 | Ga0075430_1001181792 | 156 |
| 269 | 3300006881 | Ga0068865_100001071 | Ga0068865_10000107116 | 156 |
| 270 | 3300006881 | Ga0068865_100616793 | Ga0068865_1006167931 | 156 |
| 271 | 3300006931 | Ga0097620_100001848 | Ga0097620_10000184814 | 156 |
| 272 | 3300006931 | Ga0097620_100009756 | Ga0097620_1000097563 | 156 |
| 273 | 3300006931 | Ga0097620_100093039 | Ga0097620_1000930393 | 156 |
| 274 | 3300007076 | Ga0075435_100599284 | Ga0075435_1005992841 | 156 |
| 275 | 3300009092 | Ga0105250_10046323 | Ga0105250_100463232 | 156 |
| 276 | 3300009093 | Ga0105240_10210620 | Ga0105240_102106202 | 156 |
| 277 | 3300009094 | Ga0111539_10297484 | Ga0111539_102974842 | 156 |
| 278 | 3300009098 | Ga0105245_10136046 | Ga0105245_101360462 | 156 |
| 279 | 3300009101 | Ga0105247_10000070 | Ga0105247_1000007071 | 156 |
| 280 | 3300009176 | Ga0105242_10058052 | Ga0105242_100580523 | 156 |
| 281 | 3300009177 | Ga0105248_10000458 | Ga0105248_1000045839 | 156 |
| 282 | 3300009177 | Ga0105248_10205718 | Ga0105248_102057183 | 156 |
| 283 | 3300009545 | Ga0105237_10024525 | Ga0105237_100245254 | 156 |
| 284 | 3300009545 | Ga0105237_11449064 | Ga0105237_114490641 | 156 |
| 285 | 3300009553 | Ga0105249_10000020 | Ga0105249_10000020191 | 156 |
| 286 | 3300009553 | Ga0105249_10086514 | Ga0105249_100865142 | 156 |
| 287 | 3300009553 | Ga0105249_10408609 | Ga0105249_104086091 | 156 |
| 288 | 3300010375 | Ga0105239_10339588 | Ga0105239_103395882 | 156 |
| 289 | 3300013105 | Ga0157369_10247258 | Ga0157369_102472582 | 156 |
| 290 | 3300013296 | Ga0157374_10256433 | Ga0157374_102564333 | 156 |
| 291 | 3300013306 | Ga0163162_10072852 | Ga0163162_100728522 | 156 |
| 292 | 3300013306 | Ga0163162_10082205 | Ga0163162_100822052 | 156 |
| 293 | 3300013306 | Ga0163162_10084550 | Ga0163162_100845504 | 156 |
| 294 | 3300014325 | Ga0163163_10015155 | Ga0163163_100151557 | 156 |
| 295 | 3300014325 | Ga0163163_10949025 | Ga0163163_109490251 | 156 |
| 296 | 3300014326 | Ga0157380_10043097 | Ga0157380_100430974 | 156 |
| 297 | 3300014745 | Ga0157377_10009645 | Ga0157377_100096452 | 156 |
| 298 | 3300014968 | Ga0157379_10057893 | Ga0157379_100578934 | 156 |
| 299 | 3300017792 | Ga0163161_10004320 | Ga0163161_100043207 | 156 |
| 300 | 3300017792 | Ga0163161_10070401 | Ga0163161_100704012 | 156 |
| 301 | 3300025294 | Ga0209025_1153566 | Ga0209025_11535661 | 156 |
| 302 | 3300025303 | Ga0209051_1000549 | Ga0209051_100054924 | 156 |
| 303 | 3300025303 | Ga0209051_1000709 | Ga0209051_100070921 | 156 |
| 304 | 3300025885 | Ga0207653_10054690 | Ga0207653_100546902 | 156 |
| 305 | 3300025893 | Ga0207682_10044007 | Ga0207682_100440072 | 156 |
| 306 | 3300025898 | Ga0207692_10005950 | Ga0207692_100059504 | 156 |
| 307 | 3300025899 | Ga0207642_10006557 | Ga0207642_100065572 | 156 |
| 308 | 3300025900 | Ga0207710_10000010 | Ga0207710_10000010321 | 156 |
| 309 | 3300025900 | Ga0207710_10000856 | Ga0207710_100008566 | 156 |
| 310 | 3300025901 | Ga0207688_10001325 | Ga0207688_1000132511 | 156 |
| 311 | 3300025901 | Ga0207688_10009287 | Ga0207688_100092875 | 156 |
| 312 | 3300025903 | Ga0207680_10105562 | Ga0207680_101055622 | 156 |
| 313 | 3300025903 | Ga0207680_10173523 | Ga0207680_101735232 | 156 |
| 314 | 3300025904 | Ga0207647_10100458 | Ga0207647_101004582 | 156 |
| 315 | 3300025905 | Ga0207685_10007929 | Ga0207685_100079292 | 156 |
| 316 | 3300025905 | Ga0207685_10031234 | Ga0207685_100312342 | 156 |
| 317 | 3300025906 | Ga0207699_10002028 | Ga0207699_100020286 | 156 |
| 318 | 3300025907 | Ga0207645_10046268 | Ga0207645_100462682 | 156 |
| 319 | 3300025907 | Ga0207645_10099733 | Ga0207645_100997332 | 156 |
| 320 | 3300025908 | Ga0207643_10499485 | Ga0207643_104994852 | 156 |
| 321 | 3300025914 | Ga0207671_10105836 | Ga0207671_101058363 | 156 |
| 322 | 3300025914 | Ga0207671_10576496 | Ga0207671_105764962 | 156 |
| 323 | 3300025915 | Ga0207693_10020808 | Ga0207693_100208081 | 156 |
| 324 | 3300025915 | Ga0207693_10046909 | Ga0207693_100469092 | 156 |
| 325 | 3300025915 | Ga0207693_10271153 | Ga0207693_102711531 | 156 |
| 326 | 3300025916 | Ga0207663_10006057 | Ga0207663_100060577 | 156 |
| 327 | 3300025916 | Ga0207663_10106443 | Ga0207663_101064431 | 156 |
| 328 | 3300025918 | Ga0207662_10085353 | Ga0207662_100853532 | 156 |
| 329 | 3300025919 | Ga0207657_10203194 | Ga0207657_102031942 | 156 |
| 330 | 3300025921 | Ga0207652_10512019 | Ga0207652_105120192 | 156 |
| 331 | 3300025923 | Ga0207681_10000979 | Ga0207681_1000097916 | 156 |
| 332 | 3300025923 | Ga0207681_10109103 | Ga0207681_101091032 | 156 |
| 333 | 3300025926 | Ga0207659_10235140 | Ga0207659_102351402 | 156 |
| 334 | 3300025927 | Ga0207687_10000726 | Ga0207687_1000072619 | 156 |
| 335 | 3300025927 | Ga0207687_10080796 | Ga0207687_100807962 | 156 |
| 336 | 3300025931 | Ga0207644_10565398 | Ga0207644_105653982 | 156 |
| 337 | 3300025932 | Ga0207690_10585820 | Ga0207690_105858202 | 156 |
| 338 | 3300025933 | Ga0207706_10013084 | Ga0207706_100130843 | 156 |
| 339 | 3300025933 | Ga0207706_10032166 | Ga0207706_100321662 | 156 |
| 340 | 3300025933 | Ga0207706_10539073 | Ga0207706_105390732 | 156 |
| 341 | 3300025934 | Ga0207686_10005430 | Ga0207686_100054303 | 156 |
| 342 | 3300025934 | Ga0207686_10091375 | Ga0207686_100913753 | 156 |
| 343 | 3300025935 | Ga0207709_10010239 | Ga0207709_100102392 | 156 |
| 344 | 3300025936 | Ga0207670_10004115 | Ga0207670_100041156 | 156 |
| 345 | 3300025937 | Ga0207669_10002515 | Ga0207669_100025156 | 156 |
| 346 | 3300025937 | Ga0207669_10009818 | Ga0207669_100098183 | 156 |
| 347 | 3300025938 | Ga0207704_10000940 | Ga0207704_1000094013 | 156 |
| 348 | 3300025938 | Ga0207704_10101636 | Ga0207704_101016361 | 156 |
| 349 | 3300025939 | Ga0207665_10003509 | Ga0207665_100035097 | 156 |
| 350 | 3300025939 | Ga0207665_10008675 | Ga0207665_100086754 | 156 |
| 351 | 3300025940 | Ga0207691_10022514 | Ga0207691_100225142 | 156 |
| 352 | 3300025940 | Ga0207691_10100575 | Ga0207691_101005752 | 156 |
| 353 | 3300025941 | Ga0207711_10000422 | Ga0207711_1000042239 | 156 |
| 354 | 3300025941 | Ga0207711_10015465 | Ga0207711_100154655 | 156 |
| 355 | 3300025941 | Ga0207711_10477434 | Ga0207711_104774342 | 156 |
| 356 | 3300025941 | Ga0207711_10845916 | Ga0207711_108459162 | 156 |
| 357 | 3300025942 | Ga0207689_10026498 | Ga0207689_100264983 | 156 |
| 358 | 3300025942 | Ga0207689_10040614 | Ga0207689_100406142 | 156 |
| 359 | 3300025949 | Ga0207667_10047452 | Ga0207667_100474523 | 156 |
| 360 | 3300025949 | Ga0207667_10082265 | Ga0207667_100822653 | 156 |
| 361 | 3300025949 | Ga0207667_10564980 | Ga0207667_105649802 | 156 |
| 362 | 3300025961 | Ga0207712_10000010 | Ga0207712_1000001073 | 156 |
| 363 | 3300025961 | Ga0207712_10079144 | Ga0207712_100791442 | 156 |
| 364 | 3300025961 | Ga0207712_10212755 | Ga0207712_102127552 | 156 |
| 365 | 3300025961 | Ga0207712_10450086 | Ga0207712_104500862 | 156 |
| 366 | 3300025961 | Ga0207712_10710970 | Ga0207712_107109701 | 156 |
| 367 | 3300025972 | Ga0207668_10047736 | Ga0207668_100477362 | 156 |
| 368 | 3300025972 | Ga0207668_10367372 | Ga0207668_103673721 | 156 |
| 369 | 3300025972 | Ga0207668_10620707 | Ga0207668_106207072 | 156 |
| 370 | 3300025981 | Ga0207640_10006104 | Ga0207640_100061044 | 156 |
| 371 | 3300025986 | Ga0207658_10000257 | Ga0207658_1000025757 | 156 |
| 372 | 3300025986 | Ga0207658_10015885 | Ga0207658_100158854 | 156 |
| 373 | 3300025986 | Ga0207658_10196665 | Ga0207658_101966651 | 156 |
| 374 | 3300026023 | Ga0207677_10011540 | Ga0207677_100115406 | 156 |
| 375 | 3300026023 | Ga0207677_10026067 | Ga0207677_100260674 | 156 |
| 376 | 3300026035 | Ga0207703_10009971 | Ga0207703_100099716 | 156 |
| 377 | 3300026035 | Ga0207703_10072092 | Ga0207703_100720922 | 156 |
| 378 | 3300026035 | Ga0207703_10205933 | Ga0207703_102059332 | 156 |
| 379 | 3300026035 | Ga0207703_10307136 | Ga0207703_103071362 | 156 |
| 380 | 3300026035 | Ga0207703_10766971 | Ga0207703_107669712 | 156 |
| 381 | 3300026041 | Ga0207639_10277298 | Ga0207639_102772982 | 156 |
| 382 | 3300026067 | Ga0207678_10009744 | Ga0207678_100097443 | 156 |
| 383 | 3300026067 | Ga0207678_10033659 | Ga0207678_100336593 | 156 |
| 384 | 3300026075 | Ga0207708_10000765 | Ga0207708_1000076517 | 156 |
| 385 | 3300026075 | Ga0207708_10011035 | Ga0207708_100110355 | 156 |
| 386 | 3300026078 | Ga0207702_10293858 | Ga0207702_102938582 | 156 |
| 387 | 3300026088 | Ga0207641_10002535 | Ga0207641_100025354 | 156 |
| 388 | 3300026088 | Ga0207641_10175777 | Ga0207641_101757772 | 156 |
| 389 | 3300026088 | Ga0207641_10655269 | Ga0207641_106552691 | 156 |
| 390 | 3300026088 | Ga0207641_11309494 | Ga0207641_113094942 | 156 |
| 391 | 3300026089 | Ga0207648_10020206 | Ga0207648_100202062 | 156 |
| 392 | 3300026089 | Ga0207648_10103348 | Ga0207648_101033483 | 156 |
| 393 | 3300026095 | Ga0207676_10045218 | Ga0207676_100452182 | 156 |
| 394 | 3300026118 | Ga0207675_100001697 | Ga0207675_1000016977 | 156 |
| 395 | 3300026118 | Ga0207675_100026851 | Ga0207675_1000268514 | 156 |
| 396 | 3300026118 | Ga0207675_100124295 | Ga0207675_1001242953 | 156 |
| 397 | 3300026121 | Ga0207683_10001526 | Ga0207683_1000152617 | 156 |
| 398 | 3300026121 | Ga0207683_10056149 | Ga0207683_100561492 | 156 |
| 399 | 3300026142 | Ga0207698_10476272 | Ga0207698_104762722 | 156 |
| 400 | 3300027907 | Ga0207428_10213885 | Ga0207428_102138852 | 156 |
| 401 | 3300028379 | Ga0268266_10031437 | Ga0268266_100314373 | 156 |
| 402 | 3300028380 | Ga0268265_10000105 | Ga0268265_1000010572 | 156 |
| 403 | 3300028380 | Ga0268265_10120995 | Ga0268265_101209952 | 156 |
| 404 | 3300028380 | Ga0268265_10269765 | Ga0268265_102697652 | 156 |
| 405 | 3300028380 | Ga0268265_10664119 | Ga0268265_106641192 | 156 |
| 406 | 3300028381 | Ga0268264_10000237 | Ga0268264_1000023745 | 156 |
| 407 | 3300028381 | Ga0268264_10025357 | Ga0268264_100253574 | 156 |
| 408 | 3300031824 | Ga0307413_10517032 | Ga0307413_105170322 | 156 |
| 409 | 3300031852 | Ga0307410_11047855 | Ga0307410_110478551 | 156 |
| 410 | 3300031995 | Ga0307409_100462606 | Ga0307409_1004626062 | 156 |
| 411 | 3300032126 | Ga0307415_100598479 | Ga0307415_1005984791 | 156 |
| 412 | 3300034819 | Ga0373958_0027423 | Ga0373958_0027423_587_1084 | 156 |
| 413 | 3300034820 | Ga0373959_0012019 | Ga0373959_0012019_494_991 | 156 |
| 414 | 3300035115 | Ga0373941_0212575 | Ga0373941_0212575_132_602 | 156 |
| 415 | 3300035692 | Ga0373935_0254463 | Ga0373935_0254463_509_979 | 156 |
| 416 | 3300035725 | Ga0373947_0617819 | Ga0373947_0617819_175_645 | 156 |
| 417 | 3300041498 | Ga0451841_0153296 | Ga0451841_0153296_36_506 | 156 |
| 418 | 3300041511 | Ga0451855_1110169 | Ga0451855_1110169_19_489 | 156 |
| 419 | 3300044658 | Ga0466972_0081447 | Ga0466972_0081447_1059_1529 | 156 |
| 420 | 3300044683 | Ga0466965_0009934 | Ga0466965_0009934_2237_2707 | 156 |
| 421 | 3300044901 | Ga0466960_0000507 | Ga0466960_0000507_11503_11973 | 156 |
| 422 | 3300044901 | Ga0466960_0087458 | Ga0466960_0087458_57_527 | 156 |
| 423 | 3300044901 | Ga0466960_0147086 | Ga0466960_0147086_331_801 | 156 |
| 424 | 3300046455 | Ga0495603_0011829 | Ga0495603_0011829_871_1341 | 156 |
| 425 | 3300046459 | Ga0495629_0013340 | Ga0495629_0013340_3902_4372 | 156 |
| 426 | 3300046473 | Ga0495582_0010870 | Ga0495582_0010870_2640_3110 | 156 |
| 427 | 3300046476 | Ga0495662_0132436 | Ga0495662_0132436_145_615 | 156 |
| 428 | 3300046477 | Ga0495664_0133829 | Ga0495664_0133829_99_569 | 156 |
| 429 | 3300046511 | Ga0495608_0194731 | Ga0495608_0194731_458_928 | 156 |
| 430 | 3300046526 | Ga0495666_0151529 | Ga0495666_0151529_221_691 | 156 |
| 431 | 3300046531 | Ga0495665_0077194 | Ga0495665_0077194_325_795 | 156 |
| 432 | 3300046559 | Ga0495667_0698120 | Ga0495667_0698120_114_584 | 156 |
| 433 | 3300046674 | Ga0495588_0068837 | Ga0495588_0068837_1128_1598 | 156 |
| 434 | 3300046680 | Ga0495646_0337631 | Ga0495646_0337631_28_498 | 156 |
| 435 | 3300046683 | Ga0495658_0406163 | Ga0495658_0406163_329_799 | 156 |
| 436 | 3300046690 | Ga0495624_0075510 | Ga0495624_0075510_984_1454 | 156 |
| 437 | 3300047315 | Ga0495581_0049336 | Ga0495581_0049336_1400_1870 | 156 |
| 438 | 3300047673 | Ga0495593_0001584 | Ga0495593_0001584_10174_10644 | 156 |
| 439 | 3300048903 | Ga0496100_0000699 | Ga0496100_0000699_2557_3027 | 156 |
| 440 | 3300048903 | Ga0496100_0045092 | Ga0496100_0045092_2132_2602 | 156 |
| 441 | 3300048904 | Ga0496101_0000404 | Ga0496101_0000404_15707_16177 | 156 |
| 442 | 3300048904 | Ga0496101_0002102 | Ga0496101_0002102_496_966 | 156 |
| 443 | 3300048904 | Ga0496101_0222898 | Ga0496101_0222898_171_641 | 156 |
| 444 | 3300048905 | Ga0496102_0000526 | Ga0496102_0000526_16455_16925 | 156 |
| 445 | 3300048905 | Ga0496102_0043483 | Ga0496102_0043483_3089_3559 | 156 |
| 446 | 3300048905 | Ga0496102_0085945 | Ga0496102_0085945_1725_2195 | 156 |
| 447 | 3300048905 | Ga0496102_0218474 | Ga0496102_0218474_1229_1726 | 156 |
| 448 | 3300048905 | Ga0496102_1105828 | Ga0496102_1105828_143_613 | 156 |
| 449 | 3300048906 | Ga0496103_0000356 | Ga0496103_0000356_36249_36719 | 156 |
| 450 | 3300048906 | Ga0496103_0042693 | Ga0496103_0042693_2202_2699 | 156 |
| 451 | 3300048906 | Ga0496103_0147728 | Ga0496103_0147728_440_910 | 156 |
| 452 | 3300048906 | Ga0496103_0281446 | Ga0496103_0281446_440_910 | 156 |
| 453 | 3300048907 | Ga0496104_0027623 | Ga0496104_0027623_2992_3462 | 156 |
| 454 | 3300048907 | Ga0496104_0360557 | Ga0496104_0360557_841_1338 | 156 |
| 455 | 3300048907 | Ga0496104_0483853 | Ga0496104_0483853_560_1030 | 156 |
| 456 | 3300048908 | Ga0496105_0007351 | Ga0496105_0007351_5222_5692 | 156 |
| 457 | 3300048908 | Ga0496105_0062741 | Ga0496105_0062741_2482_2979 | 156 |
| 458 | 3300048909 | Ga0496106_0001273 | Ga0496106_0001273_15660_16130 | 156 |
| 459 | 3300048909 | Ga0496106_0068849 | Ga0496106_0068849_1834_2304 | 156 |
| 460 | 3300048909 | Ga0496106_0287804 | Ga0496106_0287804_277_747 | 156 |
| 461 | 3300048910 | Ga0496107_0000481 | Ga0496107_0000481_16554_17024 | 156 |
| 462 | 3300048910 | Ga0496107_0010487 | Ga0496107_0010487_647_1117 | 156 |
| 463 | 3300048910 | Ga0496107_0037801 | Ga0496107_0037801_811_1281 | 156 |
| 464 | 3300048911 | Ga0496108_0000767 | Ga0496108_0000767_596_1093 | 156 |
| 465 | 3300048911 | Ga0496108_0707006 | Ga0496108_0707006_263_733 | 156 |
| 466 | 3300048912 | Ga0496109_0170873 | Ga0496109_0170873_496_993 | 156 |
| 467 | 3300048912 | Ga0496109_0463275 | Ga0496109_0463275_532_1002 | 156 |
| 468 | 3300048912 | Ga0496109_0734596 | Ga0496109_0734596_215_685 | 156 |
| 469 | 3300048913 | Ga0496110_0716733 | Ga0496110_0716733_12_509 | 156 |
| 470 | 3300048914 | Ga0496111_0026772 | Ga0496111_0026772_2006_2503 | 156 |
| 471 | 3300048915 | Ga0496112_0029780 | Ga0496112_0029780_2841_3338 | 156 |
| 472 | 3300048917 | Ga0496114_0000979 | Ga0496114_0000979_15978_16448 | 156 |
| 473 | 3300048917 | Ga0496114_0341987 | Ga0496114_0341987_16_513 | 156 |
| 474 | 3300048917 | Ga0496114_0351011 | Ga0496114_0351011_364_834 | 156 |
| 475 | 3300048918 | Ga0496115_0909940 | Ga0496115_0909940_86_556 | 156 |
| 476 | 3300048919 | Ga0496116_0008070 | Ga0496116_0008070_370_840 | 156 |
| 477 | 3300048920 | Ga0496117_0000614 | Ga0496117_0000614_25291_25761 | 156 |
| 478 | 3300048921 | Ga0496118_0000558 | Ga0496118_0000558_37601_38071 | 156 |
| 479 | 3300048923 | Ga0496120_0008662 | Ga0496120_0008662_333_803 | 156 |
| 480 | 3300048924 | Ga0496121_0010416 | Ga0496121_0010416_9624_10094 | 156 |
| 481 | 3300048929 | Ga0496126_0006132 | Ga0496126_0006132_11689_12159 | 156 |
| 482 | 3300049823 | Ga0501044_0060802 | Ga0501044_0060802_2533_3009 | 156 |
| 483 | 3300050489 | nmdc:mga03683_140641_c1 | nmdc:mga03683_140641_c1_311_781 | 156 |
| 484 | 3300050489 | nmdc:mga03683_372673_c1 | nmdc:mga03683_372673_c1_134_604 | 156 |
| 485 | 3300050489 | nmdc:mga03683_391065_c1 | nmdc:mga03683_391065_c1_95_565 | 156 |
| 486 | 3300050490 | nmdc:mga03n38_106362_c1 | nmdc:mga03n38_106362_c1_113_583 | 156 |
| 487 | 3300050490 | nmdc:mga03n38_20029_c1 | nmdc:mga03n38_20029_c1_2171_2641 | 156 |
| 488 | 3300050490 | nmdc:mga03n38_3703_c1 | nmdc:mga03n38_3703_c1_1846_2316 | 156 |
| 489 | 3300050490 | nmdc:mga03n38_75281_c1 | nmdc:mga03n38_75281_c1_16_486 | 156 |
| 490 | 3300050491 | nmdc:mga00v17_19292_c1 | nmdc:mga00v17_19292_c1_3292_3762 | 156 |
| 491 | 3300050491 | nmdc:mga00v17_255783_c1 | nmdc:mga00v17_255783_c1_648_1118 | 156 |
| 492 | 3300050491 | nmdc:mga00v17_594987_c1 | nmdc:mga00v17_594987_c1_226_696 | 156 |
| 493 | 3300050491 | nmdc:mga00v17_67914_c1 | nmdc:mga00v17_67914_c1_827_1297 | 156 |
| 494 | 3300050492 | nmdc:mga0yw44_86224_c1 | nmdc:mga0yw44_86224_c1_872_1342 | 156 |
| 495 | 3300050494 | nmdc:mga06z11_33083_c1 | nmdc:mga06z11_33083_c1_138_608 | 156 |
| 496 | 3300050494 | nmdc:mga06z11_505561_c1 | nmdc:mga06z11_505561_c1_15_485 | 156 |
| 497 | 3300050496 | nmdc:mga07m45_402188_c1 | nmdc:mga07m45_402188_c1_176_646 | 156 |
| 498 | 3300050496 | nmdc:mga07m45_7113_c1 | nmdc:mga07m45_7113_c1_2999_3469 | 156 |
| 499 | 3300050511 | nmdc:mga08y16_286001_c1 | nmdc:mga08y16_286001_c1_544_1014 | 156 |
| 500 | 3300050513 | nmdc:mga0rr50_580457_c1 | nmdc:mga0rr50_580457_c1_134_604 | 156 |
| 501 | 3300050516 | nmdc:mga0sz30_112209_c1 | nmdc:mga0sz30_112209_c1_317_787 | 156 |
| 502 | 3300050516 | nmdc:mga0sz30_62245_c1 | nmdc:mga0sz30_62245_c1_1011_1481 | 156 |
| 503 | 3300053083 | Ga0495655_0005812 | Ga0495655_0005812_1540_2010 | 156 |
| 504 | 3300053131 | Ga0500652_005108 | Ga0500652_005108_2785_3255 | 156 |
| 505 | 3300053153 | Ga0500616_0035765 | Ga0500616_0035765_1027_1497 | 156 |
| 506 | 3300053155 | Ga0500620_037311 | Ga0500620_037311_127_597 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00358
PTS_EIIA_1
phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1
16
142
0.96
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3our-assembly3.cif.gz_F | crystal structure of complex between eiia and a novel pyruvate decarboxylase | 0.9142 | 4 | 156 |
| 3our-assembly3.cif.gz_F | crystal structure of complex between eiia and a novel pyruvate decarboxylase | 0.9026 | 4 | 156 |
| 1gla-assembly1.cif.gz_F | structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase | 0.9005 | 1 | 152 |
| 1gpr-assembly1.cif.gz_A-2 | refined crystal structure of iia domain of the glucose permease of bacillus subtilis at 1.9 angstroms resolution | 0.8988 | 6 | 156 |
| 4jbw-assembly1.cif.gz_M | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8978 | 4 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYL0_6_165_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9234 | 3 | 156 | 2.70.70.10 |
| af_P08722_474_624_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9151 | 4 | 152 | 2.70.70.10 |
| af_Q2FV87_535_686_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.915 | 1 | 152 | 2.70.70.10 |
| 1gprA00 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8988 | 6 | 156 | 2.70.70.10 |
| 2gprA00 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8971 | 1 | 153 | 2.70.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I7SR88-F1-model_v4 | PTS glucose transporter subunit IIA | 0.9954 | 25 | 156 |
GO:0005737
GO:0009401 GO:0016301 |
| AF-A0A6H3JXJ1-F1-model_v4 | deleted | 0.9822 | 4 | 156 |
|
| AF-A0A7I7SR88-F1-model_v4 | PTS glucose transporter subunit IIA | 0.9806 | 25 | 156 |
GO:0005737
GO:0009401 GO:0016301 |
| AF-A0A4V3IKL1-F1-model_v4 | deleted | 0.9795 | 1 | 156 |
|
| AF-A0A645DDI8-F1-model_v4 | PTS system glucose-specific EIICBA component (EC 2.7.1.199) | 0.9786 | 1 | 155 |
GO:0005886
GO:0008982 GO:0009401 GO:0016301 GO:0090563 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar