F456457

General Info

Members Datasets Scaffolds Average Seq Length
506 247 501 158

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10044795|JGI24739J22299_100447952
Length 168
Sequence MTVLPTRSYCWCVTTTSVLAPVGGRAVPLQDVPDPVFSQGMVGYGAAIDPPRGVVDAVAPVSGKILKLLPHAYIVMTPDNVGILVHLGLDTVQLNGEGFTTHVSQGDDVTAGQVIITYDVPSVEAKGLNPIVPVVVMDEREQSNVIPSDAVTAGAEIATGASLFTANK

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
3 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
4 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
5 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
6 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
185 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
186 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
245 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.2
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.22
Nodule 0
Rhizoplane 11.46
Rhizosphere 70.95
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006115 3300000546 Bacteria 1307
2 JGI24739J22299_10023732 3300001989 Bacteria 2166
3 JGI24739J22299_10044795 3300001989 Bacteria 1455
4 JGI24737J22298_10034638 3300001990 Bacteria 1565
5 JGI24737J22298_10089942 3300001990 Bacteria 911
6 JGI24735J21928_10060269 3300002067 Bacteria 1091
7 JGI24750J21931_1005331 3300002070 Bacteria 1580
8 JGI24745J21846_1009564 3300002073 Bacteria 1100
9 JGI24745J21846_1013739 3300002073 Bacteria 935
10 JGI24748J21848_1005796 3300002074 Bacteria 1436
11 JGI24738J21930_10008008 3300002075 Bacteria 2415
12 JGI24738J21930_10022542 3300002075 Bacteria 1302
13 JGI24749J21850_1027757 3300002076 Bacteria 808
14 JGI24744J21845_10001117 3300002077 Bacteria 5215
15 JGI24744J21845_10001144 3300002077 Bacteria 5160
16 JGI24034J26672_10016280 3300002239 Bacteria 1144
17 JGI24742J22300_10013083 3300002244 Bacteria 1388
18 JGI24742J22300_10022087 3300002244 Bacteria 1089
19 JGI24742J22300_10078522 3300002244 Bacteria 622
20 JGI24751J29686_10007668 3300002459 Bacteria 2206
21 Ga0070676_10325065 3300005328 Bacteria 1050
22 Ga0070690_100174449 3300005330 Bacteria 1481
23 Ga0070677_10088145 3300005333 Bacteria 1344
24 Ga0068869_100031741 3300005334 Bacteria 3717
25 Ga0068869_100083514 3300005334 Bacteria 2389
26 Ga0070666_10107811 3300005335 Bacteria 1925
27 Ga0070682_100002087 3300005337 Bacteria 11122
28 Ga0070682_100030688 3300005337 Bacteria 3247
29 Ga0068868_100017677 3300005338 Bacteria 5317
30 Ga0068868_100035192 3300005338 Bacteria 3870
31 Ga0068868_100183082 3300005338 Bacteria 1739
32 Ga0068868_100215738 3300005338 Bacteria 1605
33 Ga0070660_100134631 3300005339 Bacteria 1979
34 Ga0070660_100780242 3300005339 Bacteria 803
35 Ga0070689_100010644 3300005340 Bacteria 6559
36 Ga0070689_100107703 3300005340 Bacteria 2213
37 Ga0070691_10000651 3300005341 Bacteria 13437
38 Ga0070692_10052846 3300005345 Bacteria 2117
39 Ga0070692_10216545 3300005345 Bacteria 1130
40 Ga0070692_10323334 3300005345 Bacteria 949
41 Ga0070668_100003168 3300005347 Bacteria 12124
42 Ga0070668_100257695 3300005347 Bacteria 1450
43 Ga0070668_100263907 3300005347 Bacteria 1433
44 Ga0070669_100021129 3300005353 Bacteria 4651
45 Ga0070669_100065360 3300005353 Bacteria 2680
46 Ga0070675_100266897 3300005354 Bacteria 1501
47 Ga0070675_100291912 3300005354 Bacteria 1435
48 Ga0070671_100001738 3300005355 Bacteria 16533
49 Ga0070671_100881625 3300005355 Bacteria 781
50 Ga0070674_100004119 3300005356 Bacteria 8257
51 Ga0070674_100237447 3300005356 Bacteria 1425
52 Ga0070688_100028037 3300005365 Bacteria 3358
53 Ga0070688_100090713 3300005365 Bacteria 1996
54 Ga0070659_100108029 3300005366 Bacteria 2244
55 Ga0070659_100752430 3300005366 Bacteria 845
56 Ga0070667_100000109 3300005367 Bacteria 105260
57 Ga0070667_100002710 3300005367 Bacteria 15343
58 Ga0070667_100048456 3300005367 Bacteria 3576
59 Ga0070667_100158628 3300005367 Bacteria 1991
60 Ga0070709_10105885 3300005434 Bacteria 1882
61 Ga0070710_10010347 3300005437 Bacteria 4581
62 Ga0070701_10003505 3300005438 Bacteria 6222
63 Ga0070711_100001045 3300005439 Bacteria 14754
64 Ga0070711_100191476 3300005439 Bacteria 1572
65 Ga0070705_100010867 3300005440 Bacteria 4571
66 Ga0070700_100023077 3300005441 Bacteria 3637
67 Ga0070700_100081063 3300005441 Bacteria 2095
68 Ga0070694_100031039 3300005444 Bacteria 3502
69 Ga0070708_100325102 3300005445 Bacteria 1449
70 Ga0070708_101154813 3300005445 Bacteria 725
71 Ga0070663_100021413 3300005455 Bacteria 4300
72 Ga0070663_100030903 3300005455 Bacteria 3675
73 Ga0070663_100234998 3300005455 Bacteria 1445
74 Ga0070663_101530338 3300005455 Bacteria 593
75 Ga0070678_100000765 3300005456 Bacteria 16105
76 Ga0070678_100025601 3300005456 Bacteria 3973
77 Ga0070662_100006348 3300005457 Bacteria 7616
78 Ga0070662_100363107 3300005457 Bacteria 1188
79 Ga0068867_100010729 3300005459 Bacteria 6461
80 Ga0068867_100224446 3300005459 Bacteria 1515
81 Ga0070685_10010069 3300005466 Bacteria 4905
82 Ga0070685_10437737 3300005466 Bacteria 913
83 Ga0068853_100005160 3300005539 Bacteria 10209
84 Ga0068853_100142996 3300005539 Bacteria 2148
85 Ga0070672_100236351 3300005543 Bacteria 1536
86 Ga0070672_100421718 3300005543 Bacteria 1146
87 Ga0070672_100451741 3300005543 Bacteria 1107
88 Ga0070686_100128722 3300005544 Bacteria 1748
89 Ga0070686_100158235 3300005544 Bacteria 1593
90 Ga0070695_100001027 3300005545 Bacteria 15247
91 Ga0070696_100059197 3300005546 Bacteria 2676
92 Ga0070693_100197778 3300005547 Bacteria 1304
93 Ga0070693_100435751 3300005547 Bacteria 917
94 Ga0070665_100001277 3300005548 Bacteria 30184
95 Ga0070665_100004708 3300005548 Bacteria 14221
96 Ga0070665_100068012 3300005548 Bacteria 3572
97 Ga0070665_100243819 3300005548 Bacteria 1797
98 Ga0070665_100928124 3300005548 Bacteria 883
99 Ga0070704_100000397 3300005549 Bacteria 20000
100 Ga0068855_100188498 3300005563 Bacteria 2328
101 Ga0068855_100273314 3300005563 Bacteria 1879
102 Ga0068854_100000953 3300005578 Bacteria 17419
103 Ga0068854_100047123 3300005578 Bacteria 3071
104 Ga0068856_100556626 3300005614 Bacteria 1168
105 Ga0070702_100001771 3300005615 Bacteria 8980
106 Ga0068859_100001848 3300005617 Bacteria 21522
107 Ga0068859_100009757 3300005617 Bacteria 9697
108 Ga0068859_100093042 3300005617 Bacteria 3066
109 Ga0068859_100289142 3300005617 Bacteria 1732
110 Ga0068864_100059026 3300005618 Bacteria 3318
111 Ga0068866_10042932 3300005718 Bacteria 2253
112 Ga0068866_10292620 3300005718 Bacteria 1013
113 Ga0068861_100002222 3300005719 Bacteria 12598
114 Ga0068861_100041357 3300005719 Bacteria 3452
115 Ga0068861_100356458 3300005719 Bacteria 1285
116 Ga0068863_100000123 3300005841 Bacteria 80999
117 Ga0068863_100016807 3300005841 Bacteria 7020
118 Ga0068863_100461105 3300005841 Bacteria 1248
119 Ga0068863_100597427 3300005841 Bacteria 1092
120 Ga0068858_100000702 3300005842 Bacteria 34951
121 Ga0068858_100150772 3300005842 Bacteria 2186
122 Ga0068858_100170493 3300005842 Bacteria 2052
123 Ga0068858_100237322 3300005842 Bacteria 1729
124 Ga0068858_100458680 3300005842 Bacteria 1229
125 Ga0068858_101199056 3300005842 Bacteria 746
126 Ga0068860_100000175 3300005843 Bacteria 105260
127 Ga0068860_100005175 3300005843 Bacteria 13262
128 Ga0068860_100333457 3300005843 Bacteria 1490
129 Ga0068862_100000091 3300005844 Bacteria 107015
130 Ga0068862_100017029 3300005844 Bacteria 6046
131 Ga0068862_100167780 3300005844 Bacteria 1963
132 Ga0081455_10098009 3300005937 Bacteria 2361
133 Ga0081455_10277971 3300005937 Bacteria 1211
134 Ga0081538_10044214 3300005981 Bacteria 2782
135 Ga0075365_10002340 3300006038 Bacteria 9234
136 Ga0075365_10004858 3300006038 Bacteria 7179
137 Ga0075365_10102718 3300006038 Bacteria 1959
138 Ga0075365_10113022 3300006038 Bacteria 1868
139 Ga0075365_10556902 3300006038 Bacteria 811
140 Ga0075365_10729638 3300006038 Bacteria 700
141 Ga0075363_100000148 3300006048 Bacteria 17343
142 Ga0075363_100002407 3300006048 Bacteria 7632
143 Ga0075363_100018604 3300006048 Bacteria 3464
144 Ga0075363_100032947 3300006048 Bacteria 2695
145 Ga0075363_100034577 3300006048 Bacteria 2639
146 Ga0075363_100082771 3300006048 Bacteria 1757
147 Ga0075363_100127977 3300006048 Bacteria 1423
148 Ga0075363_100226287 3300006048 Bacteria 1073
149 Ga0075363_100312295 3300006048 Bacteria 913
150 Ga0075363_100316504 3300006048 Bacteria 907
151 Ga0075364_10007126 3300006051 Bacteria 6614
152 Ga0075364_10012626 3300006051 Bacteria 5174
153 Ga0075364_10012757 3300006051 Bacteria 5153
154 Ga0075364_10028273 3300006051 Bacteria 3588
155 Ga0075364_10215096 3300006051 Bacteria 1303
156 Ga0075364_10235495 3300006051 Bacteria 1243
157 Ga0075364_10372687 3300006051 Bacteria 974
158 Ga0070715_10010309 3300006163 Bacteria 3328
159 Ga0070715_10040178 3300006163 Bacteria 1954
160 Ga0070716_100002953 3300006173 Bacteria 7922
161 Ga0070716_100021945 3300006173 Bacteria 3369
162 Ga0070716_100036872 3300006173 Bacteria 2698
163 Ga0070716_101098816 3300006173 Bacteria 634
164 Ga0070712_100007460 3300006175 Bacteria 6827
165 Ga0070712_100016423 3300006175 Bacteria 4782
166 Ga0070712_100686709 3300006175 Bacteria 872
167 Ga0075362_10008695 3300006177 Bacteria 3898
168 Ga0075362_10022987 3300006177 Bacteria 2631
169 Ga0075362_10165353 3300006177 Bacteria 1067
170 Ga0075367_10023903 3300006178 Bacteria 3443
171 Ga0075367_10087055 3300006178 Bacteria 1897
172 Ga0075369_10003326 3300006186 Bacteria 5841
173 Ga0075369_10019069 3300006186 Bacteria 2798
174 Ga0075369_10036105 3300006186 Bacteria 2102
175 Ga0075369_10057627 3300006186 Bacteria 1690
176 Ga0075369_10190737 3300006186 Bacteria 944
177 Ga0075369_10229234 3300006186 Bacteria 860
178 Ga0097621_100016973 3300006237 Bacteria 5519
179 Ga0097621_100641632 3300006237 Bacteria 974
180 Ga0075370_10000207 3300006353 Bacteria 20820
181 Ga0075370_10003007 3300006353 Bacteria 7943
182 Ga0068871_100080831 3300006358 Bacteria 2692
183 Ga0068871_100255428 3300006358 Bacteria 1528
184 Ga0075430_100118179 3300006846 Bacteria 2210
185 Ga0068865_100001071 3300006881 Bacteria 15771
186 Ga0068865_100616793 3300006881 Bacteria 918
187 Ga0097620_100001848 3300006931 Bacteria 21522
188 Ga0097620_100009756 3300006931 Bacteria 9697
189 Ga0097620_100093039 3300006931 Bacteria 3066
190 Ga0097620_100289119 3300006931 Bacteria 1732
191 Ga0075435_100599284 3300007076 Bacteria 955
192 Ga0105250_10046323 3300009092 Bacteria 1743
193 Ga0105240_10210620 3300009093 Bacteria 2272
194 Ga0111539_10297484 3300009094 Bacteria 1878
195 Ga0105245_10136046 3300009098 Bacteria 2309
196 Ga0105245_10921972 3300009098 Bacteria 916
197 Ga0105247_10000070 3300009101 Bacteria 115098
198 Ga0105243_10091450 3300009148 Bacteria 2506
199 Ga0105242_10058052 3300009176 Bacteria 3171
200 Ga0105248_10000458 3300009177 Bacteria 46439
201 Ga0105248_10205718 3300009177 Bacteria 2218
202 Ga0105248_11356870 3300009177 Bacteria 804
203 Ga0105237_10024525 3300009545 Bacteria 6169
204 Ga0105237_11449064 3300009545 Unclassified 693
205 Ga0105238_10361606 3300009551 Bacteria 1441
206 Ga0105249_10000020 3300009553 Bacteria 260634
207 Ga0105249_10086514 3300009553 Bacteria 2923
208 Ga0105249_10408609 3300009553 Bacteria 1389
209 Ga0105249_11958679 3300009553 Bacteria 659
210 Ga0105249_12679961 3300009553 Bacteria 570
211 Ga0105239_10103944 3300010375 Bacteria 3145
212 Ga0105239_10339588 3300010375 Bacteria 1695
213 Ga0105239_10653912 3300010375 Bacteria 1201
214 Ga0157369_10247258 3300013105 Bacteria 1862
215 Ga0157374_10256433 3300013296 Bacteria 1722
216 Ga0163162_10072852 3300013306 Bacteria 3490
217 Ga0163162_10082205 3300013306 Bacteria 3293
218 Ga0163162_10084550 3300013306 Bacteria 3249
219 Ga0157375_11047745 3300013308 Bacteria 953
220 Ga0163163_10015155 3300014325 Bacteria 7117
221 Ga0163163_10053670 3300014325 Bacteria 3980
222 Ga0163163_10214818 3300014325 Bacteria 1972
223 Ga0163163_10949025 3300014325 Bacteria 923
224 Ga0157380_10043097 3300014326 Bacteria 3531
225 Ga0157377_10009645 3300014745 Bacteria 4747
226 Ga0157379_10057893 3300014968 Bacteria 3464
227 Ga0157379_10454656 3300014968 Bacteria 1183
228 Ga0163161_10004320 3300017792 Bacteria 9902
229 Ga0163161_10070401 3300017792 Bacteria 2557
230 Ga0206354_11466338 3300020081 Bacteria 675
231 Ga0209025_1153566 3300025294 Bacteria 632
232 Ga0209051_1000549 3300025303 Bacteria 45665
233 Ga0209051_1000709 3300025303 Bacteria 36525
234 Ga0207653_10054690 3300025885 Bacteria 1335
235 Ga0207682_10044007 3300025893 Bacteria 1829
236 Ga0207692_10005950 3300025898 Bacteria 4924
237 Ga0207642_10006557 3300025899 Bacteria 3879
238 Ga0207710_10000010 3300025900 Bacteria 482087
239 Ga0207710_10000856 3300025900 Bacteria 16411
240 Ga0207688_10001325 3300025901 Bacteria 12862
241 Ga0207688_10009287 3300025901 Bacteria 5360
242 Ga0207688_10118017 3300025901 Bacteria 1546
243 Ga0207680_10105562 3300025903 Bacteria 1818
244 Ga0207680_10173523 3300025903 Bacteria 1454
245 Ga0207647_10100458 3300025904 Bacteria 1717
246 Ga0207685_10007929 3300025905 Bacteria 2994
247 Ga0207685_10031234 3300025905 Bacteria 1905
248 Ga0207699_10002028 3300025906 Bacteria 9561
249 Ga0207645_10046268 3300025907 Bacteria 2779
250 Ga0207645_10099733 3300025907 Bacteria 1873
251 Ga0207643_10441858 3300025908 Bacteria 827
252 Ga0207643_10499485 3300025908 Bacteria 777
253 Ga0207671_10105836 3300025914 Bacteria 2135
254 Ga0207671_10576496 3300025914 Bacteria 897
255 Ga0207693_10020808 3300025915 Bacteria 5217
256 Ga0207693_10046909 3300025915 Bacteria 3395
257 Ga0207693_10271153 3300025915 Bacteria 1330
258 Ga0207663_10006057 3300025916 Bacteria 6149
259 Ga0207663_10106443 3300025916 Bacteria 1895
260 Ga0207662_10085353 3300025918 Bacteria 1933
261 Ga0207657_10203194 3300025919 Bacteria 1593
262 Ga0207652_10512019 3300025921 Bacteria 1080
263 Ga0207681_10000979 3300025923 Bacteria 18652
264 Ga0207681_10109103 3300025923 Bacteria 2010
265 Ga0207694_10234582 3300025924 Bacteria 1499
266 Ga0207659_10235140 3300025926 Bacteria 1480
267 Ga0207687_10000726 3300025927 Bacteria 22378
268 Ga0207687_10080796 3300025927 Bacteria 2348
269 Ga0207687_10473828 3300025927 Bacteria 1041
270 Ga0207644_10001674 3300025931 Bacteria 14293
271 Ga0207644_10565398 3300025931 Bacteria 942
272 Ga0207690_10585820 3300025932 Bacteria 909
273 Ga0207706_10013084 3300025933 Bacteria 7550
274 Ga0207706_10032166 3300025933 Bacteria 4672
275 Ga0207706_10539073 3300025933 Bacteria 1005
276 Ga0207686_10005430 3300025934 Bacteria 6841
277 Ga0207686_10091375 3300025934 Bacteria 2011
278 Ga0207709_10010239 3300025935 Bacteria 5164
279 Ga0207670_10004115 3300025936 Bacteria 7790
280 Ga0207670_10074703 3300025936 Bacteria 2354
281 Ga0207669_10002515 3300025937 Bacteria 7824
282 Ga0207669_10009818 3300025937 Bacteria 4578
283 Ga0207704_10000940 3300025938 Bacteria 12899
284 Ga0207704_10101636 3300025938 Bacteria 1918
285 Ga0207665_10003509 3300025939 Bacteria 10472
286 Ga0207665_10008675 3300025939 Bacteria 6690
287 Ga0207691_10022514 3300025940 Bacteria 5942
288 Ga0207691_10100575 3300025940 Bacteria 2580
289 Ga0207711_10000422 3300025941 Bacteria 44472
290 Ga0207711_10015465 3300025941 Bacteria 6333
291 Ga0207711_10477434 3300025941 Bacteria 1161
292 Ga0207711_10845916 3300025941 Bacteria 851
293 Ga0207689_10026498 3300025942 Bacteria 4854
294 Ga0207689_10040614 3300025942 Bacteria 3850
295 Ga0207679_10695938 3300025945 Bacteria 922
296 Ga0207667_10047452 3300025949 Bacteria 4546
297 Ga0207667_10082265 3300025949 Bacteria 3335
298 Ga0207667_10564980 3300025949 Bacteria 1150
299 Ga0207712_10000010 3300025961 Bacteria 455972
300 Ga0207712_10079144 3300025961 Bacteria 2387
301 Ga0207712_10212755 3300025961 Bacteria 1541
302 Ga0207712_10450086 3300025961 Bacteria 1092
303 Ga0207712_10710970 3300025961 Bacteria 878
304 Ga0207668_10047736 3300025972 Bacteria 2933
305 Ga0207668_10367372 3300025972 Bacteria 1207
306 Ga0207668_10620707 3300025972 Bacteria 943
307 Ga0207640_10006104 3300025981 Bacteria 6586
308 Ga0207640_10083935 3300025981 Bacteria 2185
309 Ga0207658_10000257 3300025986 Bacteria 55345
310 Ga0207658_10002336 3300025986 Bacteria 13934
311 Ga0207658_10015885 3300025986 Bacteria 5170
312 Ga0207658_10196665 3300025986 Bacteria 1680
313 Ga0207658_10232064 3300025986 Bacteria 1558
314 Ga0207677_10011540 3300026023 Bacteria 5043
315 Ga0207677_10026067 3300026023 Bacteria 3660
316 Ga0207677_10098171 3300026023 Bacteria 2148
317 Ga0207703_10009971 3300026035 Bacteria 7451
318 Ga0207703_10072092 3300026035 Bacteria 2854
319 Ga0207703_10205933 3300026035 Bacteria 1751
320 Ga0207703_10307136 3300026035 Bacteria 1449
321 Ga0207703_10688102 3300026035 Bacteria 972
322 Ga0207703_10766971 3300026035 Bacteria 919
323 Ga0207639_10277298 3300026041 Bacteria 1473
324 Ga0207678_10009744 3300026067 Bacteria 8447
325 Ga0207678_10011396 3300026067 Bacteria 7803
326 Ga0207678_10033659 3300026067 Bacteria 4464
327 Ga0207708_10000765 3300026075 Bacteria 24175
328 Ga0207708_10011035 3300026075 Bacteria 6718
329 Ga0207702_10293858 3300026078 Bacteria 1540
330 Ga0207702_11217755 3300026078 Bacteria 747
331 Ga0207641_10002535 3300026088 Bacteria 16809
332 Ga0207641_10009310 3300026088 Bacteria 8102
333 Ga0207641_10175777 3300026088 Bacteria 1958
334 Ga0207641_10655269 3300026088 Bacteria 1031
335 Ga0207641_11309494 3300026088 Bacteria 725
336 Ga0207648_10020206 3300026089 Bacteria 6002
337 Ga0207648_10103348 3300026089 Bacteria 2498
338 Ga0207676_10045218 3300026095 Bacteria 3401
339 Ga0207676_10178784 3300026095 Bacteria 1856
340 Ga0207676_11215028 3300026095 Bacteria 747
341 Ga0207675_100001697 3300026118 Bacteria 22065
342 Ga0207675_100026851 3300026118 Bacteria 5358
343 Ga0207675_100124295 3300026118 Bacteria 2443
344 Ga0207683_10001526 3300026121 Bacteria 20849
345 Ga0207683_10056149 3300026121 Bacteria 3453
346 Ga0207698_10476272 3300026142 Bacteria 1210
347 Ga0207428_10213885 3300027907 Bacteria 1447
348 Ga0268266_10031437 3300028379 Bacteria 4508
349 Ga0268265_10000105 3300028380 Bacteria 105463
350 Ga0268265_10120995 3300028380 Bacteria 2156
351 Ga0268265_10269765 3300028380 Bacteria 1517
352 Ga0268265_10664119 3300028380 Bacteria 1003
353 Ga0268264_10000237 3300028381 Bacteria 105274
354 Ga0268264_10025357 3300028381 Bacteria 4844
355 Ga0307413_10517032 3300031824 Bacteria 962
356 Ga0307410_11047855 3300031852 Bacteria 705
357 Ga0307409_100462606 3300031995 Bacteria 1227
358 Ga0307415_100598479 3300032126 Bacteria 981
359 Ga0373958_0027423 3300034819 Bacteria 1097
360 Ga0373959_0012019 3300034820 Bacteria 1539
361 Ga0373941_0212575 3300035115 Bacteria 740
362 Ga0373935_0254463 3300035692 Bacteria 1230
363 Ga0373947_0617819 3300035725 Bacteria 739
364 Ga0439465_0039760 3300041413 Bacteria 1519
365 Ga0451789_1027580 3300041443 Bacteria 1512
366 Ga0451791_1509984 3300041451 Bacteria 958
367 Ga0451793_0823906 3300041452 Bacteria 582
368 Ga0451797_0009327 3300041453 Bacteria 1090
369 Ga0451807_0411397 3300041486 Bacteria 898
370 Ga0451841_0153296 3300041498 Bacteria 737
371 Ga0451847_0193211 3300041503 Bacteria 775
372 Ga0451855_1110169 3300041511 Bacteria 976
373 Ga0439435_0038111 3300042436 Bacteria 1335
374 Ga0466972_0081447 3300044658 Bacteria 1541
375 Ga0466965_0009934 3300044683 Bacteria 4428
376 Ga0466968_0057597 3300044735 Bacteria 1671
377 Ga0466960_0000507 3300044901 Bacteria 13343
378 Ga0466960_0087458 3300044901 Bacteria 1582
379 Ga0466960_0147086 3300044901 Bacteria 1256
380 Ga0466967_0560930 3300045976 Bacteria 1125
381 Ga0495603_0011829 3300046455 Bacteria 5281
382 Ga0495629_0013340 3300046459 Bacteria 5928
383 Ga0495582_0010870 3300046473 Bacteria 5009
384 Ga0495662_0132436 3300046476 Bacteria 1226
385 Ga0495664_0052525 3300046477 Bacteria 2422
386 Ga0495664_0133829 3300046477 Bacteria 1502
387 Ga0495608_0194731 3300046511 Bacteria 1279
388 Ga0495666_0151529 3300046526 Bacteria 1078
389 Ga0495665_0077194 3300046531 Bacteria 1753
390 Ga0495665_0328207 3300046531 Bacteria 781
391 Ga0495667_0698120 3300046559 Bacteria 629
392 Ga0495635_0137598 3300046663 Bacteria 1664
393 Ga0495588_0068837 3300046674 Bacteria 1839
394 Ga0495646_0337631 3300046680 Bacteria 791
395 Ga0495658_0406163 3300046683 Bacteria 868
396 Ga0495624_0075510 3300046690 Bacteria 2093
397 Ga0495581_0049336 3300047315 Bacteria 2430
398 Ga0495672_0452707 3300047320 Bacteria 578
399 Ga0495593_0001584 3300047673 Bacteria 13424
400 Ga0496100_0000699 3300048903 Bacteria 16023
401 Ga0496100_0045092 3300048903 Bacteria 2828
402 Ga0496101_0000404 3300048904 Bacteria 28116
403 Ga0496101_0002102 3300048904 Bacteria 12141
404 Ga0496101_0064244 3300048904 Bacteria 2673
405 Ga0496101_0222898 3300048904 Bacteria 1464
406 Ga0496102_0000526 3300048905 Bacteria 41473
407 Ga0496102_0001326 3300048905 Bacteria 22215
408 Ga0496102_0043483 3300048905 Bacteria 4074
409 Ga0496102_0085945 3300048905 Bacteria 2905
410 Ga0496102_0218474 3300048905 Bacteria 1796
411 Ga0496102_1105828 3300048905 Bacteria 712
412 Ga0496103_0000356 3300048906 Bacteria 41484
413 Ga0496103_0042693 3300048906 Bacteria 2791
414 Ga0496103_0147728 3300048906 Bacteria 1505
415 Ga0496103_0281446 3300048906 Bacteria 1070
416 Ga0496104_0005645 3300048907 Bacteria 10956
417 Ga0496104_0027623 3300048907 Bacteria 5253
418 Ga0496104_0360557 3300048907 Bacteria 1366
419 Ga0496104_0483853 3300048907 Bacteria 1149
420 Ga0496105_0007351 3300048908 Bacteria 8518
421 Ga0496105_0062741 3300048908 Bacteria 3067
422 Ga0496105_0108100 3300048908 Bacteria 2296
423 Ga0496106_0001273 3300048909 Bacteria 18904
424 Ga0496106_0068849 3300048909 Bacteria 2700
425 Ga0496106_0287804 3300048909 Bacteria 1317
426 Ga0496107_0000481 3300048910 Bacteria 21897
427 Ga0496107_0010487 3300048910 Bacteria 6440
428 Ga0496107_0037801 3300048910 Bacteria 3465
429 Ga0496108_0000767 3300048911 Bacteria 25031
430 Ga0496108_0006187 3300048911 Bacteria 9688
431 Ga0496108_0080037 3300048911 Bacteria 2767
432 Ga0496108_0694040 3300048911 Bacteria 883
433 Ga0496108_0707006 3300048911 Bacteria 874
434 Ga0496109_0039201 3300048912 Bacteria 4287
435 Ga0496109_0051118 3300048912 Bacteria 3764
436 Ga0496109_0170873 3300048912 Bacteria 2039
437 Ga0496109_0463275 3300048912 Bacteria 1197
438 Ga0496109_0583329 3300048912 Bacteria 1054
439 Ga0496109_0734596 3300048912 Bacteria 925
440 Ga0496110_0003562 3300048913 Bacteria 11961
441 Ga0496110_0716733 3300048913 Bacteria 902
442 Ga0496111_0026772 3300048914 Bacteria 4074
443 Ga0496111_0049502 3300048914 Bacteria 3030
444 Ga0496112_0029780 3300048915 Bacteria 5282
445 Ga0496112_0031758 3300048915 Bacteria 5123
446 Ga0496112_0041130 3300048915 Bacteria 4521
447 Ga0496113_0692276 3300048916 Bacteria 814
448 Ga0496114_0000979 3300048917 Bacteria 21389
449 Ga0496114_0341987 3300048917 Bacteria 1323
450 Ga0496114_0351011 3300048917 Bacteria 1305
451 Ga0496114_1507553 3300048917 Bacteria 560
452 Ga0496115_0909940 3300048918 Bacteria 678
453 Ga0496116_0008070 3300048919 Bacteria 9209
454 Ga0496117_0000614 3300048920 Bacteria 57852
455 Ga0496118_0000558 3300048921 Bacteria 61328
456 Ga0496120_0008662 3300048923 Bacteria 7340
457 Ga0496121_0010416 3300048924 Bacteria 10490
458 Ga0496126_0006132 3300048929 Bacteria 13470
459 Ga0501047_0697168 3300049581 Bacteria 833
460 Ga0501044_0060802 3300049823 Bacteria 3867
461 nmdc:mga03683_140641_c1 3300050489 Bacteria 1085
462 nmdc:mga03683_20826_c1 3300050489 Bacteria 2521
463 nmdc:mga03683_23329_c1 3300050489 Bacteria 2409
464 nmdc:mga03683_372673_c1 3300050489 Bacteria 678
465 nmdc:mga03683_391065_c1 3300050489 Bacteria 663
466 nmdc:mga03n38_106362_c1 3300050490 Bacteria 1360
467 nmdc:mga03n38_20029_c1 3300050490 Bacteria 2670
468 nmdc:mga03n38_3403_c1 3300050490 Bacteria 5102
469 nmdc:mga03n38_3703_c1 3300050490 Bacteria 4947
470 nmdc:mga03n38_4031_c1 3300050490 Bacteria 4804
471 nmdc:mga03n38_525746_c1 3300050490 Bacteria 666
472 nmdc:mga03n38_75281_c1 3300050490 Bacteria 1572
473 nmdc:mga00v17_19292_c1 3300050491 Bacteria 3891
474 nmdc:mga00v17_255783_c1 3300050491 Bacteria 1136
475 nmdc:mga00v17_395765_c1 3300050491 Bacteria 898
476 nmdc:mga00v17_594987_c1 3300050491 Bacteria 713
477 nmdc:mga00v17_67914_c1 3300050491 Bacteria 2203
478 nmdc:mga00v17_7067_c1 3300050491 Bacteria 5977
479 nmdc:mga0yw44_33635_c1 3300050492 Bacteria 2997
480 nmdc:mga0yw44_86224_c1 3300050492 Bacteria 1977
481 nmdc:mga06z11_1106_c1 3300050494 Bacteria 9845
482 nmdc:mga06z11_33083_c1 3300050494 Bacteria 2526
483 nmdc:mga06z11_505561_c1 3300050494 Bacteria 732
484 nmdc:mga07m45_3272_c1 3300050496 Bacteria 7790
485 nmdc:mga07m45_402188_c1 3300050496 Bacteria 795
486 nmdc:mga07m45_444142_c1 3300050496 Bacteria 752
487 nmdc:mga07m45_7113_c1 3300050496 Bacteria 3677
488 nmdc:mga07m45_857272_c1 3300050496 Bacteria 520
489 nmdc:mga08y16_286001_c1 3300050511 Bacteria 1700
490 nmdc:mga0rr50_580457_c1 3300050513 Bacteria 955
491 nmdc:mga0sz30_112209_c1 3300050516 Bacteria 1195
492 nmdc:mga0sz30_195377_c1 3300050516 Bacteria 898
493 nmdc:mga0sz30_24038_c1 3300050516 Bacteria 2485
494 nmdc:mga0sz30_62245_c1 3300050516 Bacteria 1596
495 nmdc:mga0sz30_7022_c1 3300050516 Bacteria 4209
496 nmdc:mga0sz30_9208_c1 3300050516 Bacteria 2201
497 Ga0495655_0005812 3300053083 Bacteria 2202
498 Ga0500643_014196 3300053087 Bacteria 2779
499 Ga0500652_005108 3300053131 Bacteria 4106
500 Ga0500616_0035765 3300053153 Bacteria 2699
501 Ga0500620_037311 3300053155 Bacteria 1576

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10087055 Ga0075367_100870552 137
2 3300009177 Ga0105248_11356870 Ga0105248_113568702 137
3 3300010375 Ga0105239_10653912 Ga0105239_106539122 137
4 3300041452 Ga0451793_0823906 Ga0451793_0823906_139_552 137
5 3300044735 Ga0466968_0057597 Ga0466968_0057597_37_450 137
6 3300048911 Ga0496108_0080037 Ga0496108_0080037_475_888 137
7 3300048915 Ga0496112_0041130 Ga0496112_0041130_1914_2327 137
8 3300009553 Ga0105249_12679961 Ga0105249_126799611 139
9 3300013308 Ga0157375_11047745 Ga0157375_110477452 139
10 3300020081 Ga0206354_11466338 Ga0206354_114663382 139
11 3300025936 Ga0207670_10074703 Ga0207670_100747033 139
12 3300026078 Ga0207702_11217755 Ga0207702_112177551 139
13 3300041453 Ga0451797_0009327 Ga0451797_0009327_18_437 139
14 3300041503 Ga0451847_0193211 Ga0451847_0193211_112_531 139
15 3300046663 Ga0495635_0137598 Ga0495635_0137598_1212_1631 139
16 3300048917 Ga0496114_1507553 Ga0496114_1507553_58_477 139
17 3300047320 Ga0495672_0452707 Ga0495672_0452707_104_526 140
18 3300050516 nmdc:mga0sz30_195377_c1 nmdc:mga0sz30_195377_c1_311_733 140
19 3300048912 Ga0496109_0583329 Ga0496109_0583329_599_1024 141
20 3300053087 Ga0500643_014196 Ga0500643_014196_1680_2150 141
21 3300049581 Ga0501047_0697168 Ga0501047_0697168_15_443 142
22 3300005337 Ga0070682_100002087 Ga0070682_1000020875 146
23 3300005366 Ga0070659_100752430 Ga0070659_1007524302 146
24 3300005455 Ga0070663_100234998 Ga0070663_1002349982 146
25 3300005543 Ga0070672_100421718 Ga0070672_1004217181 146
26 3300005548 Ga0070665_100928124 Ga0070665_1009281242 146
27 3300006048 Ga0075363_100082771 Ga0075363_1000827713 146
28 3300025901 Ga0207688_10118017 Ga0207688_101180172 146
29 3300025908 Ga0207643_10441858 Ga0207643_104418581 146
30 3300025924 Ga0207694_10234582 Ga0207694_102345822 146
31 3300025927 Ga0207687_10473828 Ga0207687_104738282 146
32 3300025981 Ga0207640_10083935 Ga0207640_100839351 146
33 3300026067 Ga0207678_10011396 Ga0207678_100113962 146
34 3300026095 Ga0207676_10178784 Ga0207676_101787842 146
35 3300050516 nmdc:mga0sz30_7022_c1 nmdc:mga0sz30_7022_c1_435_878 147
36 3300041443 Ga0451789_1027580 Ga0451789_1027580_915_1415 148
37 3300046477 Ga0495664_0052525 Ga0495664_0052525_1687_2136 149
38 3300005345 Ga0070692_10323334 Ga0070692_103233341 150
39 3300006048 Ga0075363_100316504 Ga0075363_1003165042 150
40 3300009098 Ga0105245_10921972 Ga0105245_109219722 150
41 3300009148 Ga0105243_10091450 Ga0105243_100914503 150
42 3300009551 Ga0105238_10361606 Ga0105238_103616062 150
43 3300010375 Ga0105239_10103944 Ga0105239_101039442 150
44 3300014325 Ga0163163_10214818 Ga0163163_102148182 150
45 3300025945 Ga0207679_10695938 Ga0207679_106959382 150
46 3300048911 Ga0496108_0006187 Ga0496108_0006187_5841_6311 150
47 3300048912 Ga0496109_0051118 Ga0496109_0051118_1083_1553 150
48 3300048915 Ga0496112_0031758 Ga0496112_0031758_2997_3467 150
49 3300050490 nmdc:mga03n38_3403_c1 nmdc:mga03n38_3403_c1_204_674 150
50 3300050490 nmdc:mga03n38_525746_c1 nmdc:mga03n38_525746_c1_44_517 150
51 3300050496 nmdc:mga07m45_444142_c1 nmdc:mga07m45_444142_c1_68_538 150
52 3300006038 Ga0075365_10004858 Ga0075365_100048585 151
53 3300006048 Ga0075363_100018604 Ga0075363_1000186042 151
54 3300006048 Ga0075363_100312295 Ga0075363_1003122951 151
55 3300006051 Ga0075364_10235495 Ga0075364_102354952 151
56 3300006177 Ga0075362_10022987 Ga0075362_100229872 151
57 3300006186 Ga0075369_10036105 Ga0075369_100361052 151
58 3300041413 Ga0439465_0039760 Ga0439465_0039760_285_740 151
59 3300041451 Ga0451791_1509984 Ga0451791_1509984_407_877 151
60 3300041486 Ga0451807_0411397 Ga0451807_0411397_276_746 151
61 3300042436 Ga0439435_0038111 Ga0439435_0038111_772_1227 151
62 3300045976 Ga0466967_0560930 Ga0466967_0560930_55_510 151
63 3300050489 nmdc:mga03683_23329_c1 nmdc:mga03683_23329_c1_1384_1839 151
64 3300050491 nmdc:mga00v17_395765_c1 nmdc:mga00v17_395765_c1_197_652 151
65 3300050492 nmdc:mga0yw44_33635_c1 nmdc:mga0yw44_33635_c1_403_858 151
66 3300050496 nmdc:mga07m45_857272_c1 nmdc:mga07m45_857272_c1_43_498 151
67 3300050516 nmdc:mga0sz30_24038_c1 nmdc:mga0sz30_24038_c1_676_1131 151
68 3300050516 nmdc:mga0sz30_9208_c1 nmdc:mga0sz30_9208_c1_179_634 151
69 3300005338 Ga0068868_100215738 Ga0068868_1002157382 152
70 3300005339 Ga0070660_100780242 Ga0070660_1007802422 152
71 3300026023 Ga0207677_10098171 Ga0207677_100981712 152
72 iso_pu_bacteria 2643221687 2644486750 152
73 iso_pu_bacteria 2744054611 2744954543 152
74 iso_pu_bacteria 2902792274 2902793849 152
75 iso_pu_bacteria 2902837492 2902842128 152
76 iso_pu_bacteria 2939582691 2939586220 152
77 3300002459 JGI24751J29686_10007668 JGI24751J29686_100076681 154
78 3300005355 Ga0070671_100001738 Ga0070671_10000173811 154
79 3300005544 Ga0070686_100158235 Ga0070686_1001582352 154
80 3300005548 Ga0070665_100001277 Ga0070665_10000127728 154
81 3300005617 Ga0068859_100289142 Ga0068859_1002891422 154
82 3300005841 Ga0068863_100016807 Ga0068863_1000168076 154
83 3300005842 Ga0068858_100170493 Ga0068858_1001704933 154
84 3300006931 Ga0097620_100289119 Ga0097620_1002891192 154
85 3300009553 Ga0105249_11958679 Ga0105249_119586791 154
86 3300014325 Ga0163163_10053670 Ga0163163_100536706 154
87 3300014968 Ga0157379_10454656 Ga0157379_104546562 154
88 3300025931 Ga0207644_10001674 Ga0207644_100016747 154
89 3300025986 Ga0207658_10002336 Ga0207658_100023368 154
90 3300025986 Ga0207658_10232064 Ga0207658_102320642 154
91 3300026035 Ga0207703_10688102 Ga0207703_106881022 154
92 3300026088 Ga0207641_10009310 Ga0207641_100093106 154
93 3300026095 Ga0207676_11215028 Ga0207676_112150281 154
94 3300048904 Ga0496101_0064244 Ga0496101_0064244_1554_2018 154
95 3300048905 Ga0496102_0001326 Ga0496102_0001326_10343_10807 154
96 3300048907 Ga0496104_0005645 Ga0496104_0005645_8955_9419 154
97 3300048908 Ga0496105_0108100 Ga0496105_0108100_452_916 154
98 3300048911 Ga0496108_0694040 Ga0496108_0694040_353_817 154
99 3300048912 Ga0496109_0039201 Ga0496109_0039201_757_1221 154
100 3300048913 Ga0496110_0003562 Ga0496110_0003562_8386_8850 154
101 3300048914 Ga0496111_0049502 Ga0496111_0049502_1508_1972 154
102 3300048916 Ga0496113_0692276 Ga0496113_0692276_13_477 154
103 3300050489 nmdc:mga03683_20826_c1 nmdc:mga03683_20826_c1_791_1255 154
104 3300050490 nmdc:mga03n38_4031_c1 nmdc:mga03n38_4031_c1_1921_2385 154
105 3300050491 nmdc:mga00v17_7067_c1 nmdc:mga00v17_7067_c1_197_661 154
106 3300050494 nmdc:mga06z11_1106_c1 nmdc:mga06z11_1106_c1_7503_7967 154
107 3300050496 nmdc:mga07m45_3272_c1 nmdc:mga07m45_3272_c1_2848_3312 154
108 3300046531 Ga0495665_0328207 Ga0495665_0328207_66_767 155
109 3300000546 LJNas_1006115 LJNas_10061152 156
110 3300001989 JGI24739J22299_10023732 JGI24739J22299_100237322 156
111 3300001989 JGI24739J22299_10044795 JGI24739J22299_100447952 156
112 3300001990 JGI24737J22298_10034638 JGI24737J22298_100346382 156
113 3300001990 JGI24737J22298_10089942 JGI24737J22298_100899422 156
114 3300002067 JGI24735J21928_10060269 JGI24735J21928_100602692 156
115 3300002070 JGI24750J21931_1005331 JGI24750J21931_10053313 156
116 3300002073 JGI24745J21846_1009564 JGI24745J21846_10095641 156
117 3300002073 JGI24745J21846_1013739 JGI24745J21846_10137392 156
118 3300002074 JGI24748J21848_1005796 JGI24748J21848_10057962 156
119 3300002075 JGI24738J21930_10008008 JGI24738J21930_100080082 156
120 3300002075 JGI24738J21930_10022542 JGI24738J21930_100225422 156
121 3300002076 JGI24749J21850_1027757 JGI24749J21850_10277572 156
122 3300002077 JGI24744J21845_10001117 JGI24744J21845_100011173 156
123 3300002077 JGI24744J21845_10001144 JGI24744J21845_100011443 156
124 3300002239 JGI24034J26672_10016280 JGI24034J26672_100162802 156
125 3300002244 JGI24742J22300_10013083 JGI24742J22300_100130832 156
126 3300002244 JGI24742J22300_10022087 JGI24742J22300_100220872 156
127 3300002244 JGI24742J22300_10078522 JGI24742J22300_100785221 156
128 3300005328 Ga0070676_10325065 Ga0070676_103250652 156
129 3300005330 Ga0070690_100174449 Ga0070690_1001744492 156
130 3300005333 Ga0070677_10088145 Ga0070677_100881451 156
131 3300005334 Ga0068869_100031741 Ga0068869_1000317414 156
132 3300005334 Ga0068869_100083514 Ga0068869_1000835142 156
133 3300005335 Ga0070666_10107811 Ga0070666_101078112 156
134 3300005337 Ga0070682_100030688 Ga0070682_1000306882 156
135 3300005338 Ga0068868_100017677 Ga0068868_1000176772 156
136 3300005338 Ga0068868_100035192 Ga0068868_1000351924 156
137 3300005338 Ga0068868_100183082 Ga0068868_1001830822 156
138 3300005339 Ga0070660_100134631 Ga0070660_1001346312 156
139 3300005340 Ga0070689_100010644 Ga0070689_1000106444 156
140 3300005340 Ga0070689_100107703 Ga0070689_1001077033 156
141 3300005341 Ga0070691_10000651 Ga0070691_100006516 156
142 3300005345 Ga0070692_10052846 Ga0070692_100528463 156
143 3300005345 Ga0070692_10216545 Ga0070692_102165452 156
144 3300005347 Ga0070668_100003168 Ga0070668_1000031686 156
145 3300005347 Ga0070668_100257695 Ga0070668_1002576951 156
146 3300005347 Ga0070668_100263907 Ga0070668_1002639072 156
147 3300005353 Ga0070669_100021129 Ga0070669_1000211293 156
148 3300005353 Ga0070669_100065360 Ga0070669_1000653603 156
149 3300005354 Ga0070675_100266897 Ga0070675_1002668972 156
150 3300005354 Ga0070675_100291912 Ga0070675_1002919122 156
151 3300005355 Ga0070671_100881625 Ga0070671_1008816251 156
152 3300005356 Ga0070674_100004119 Ga0070674_1000041196 156
153 3300005356 Ga0070674_100237447 Ga0070674_1002374472 156
154 3300005365 Ga0070688_100028037 Ga0070688_1000280372 156
155 3300005365 Ga0070688_100090713 Ga0070688_1000907132 156
156 3300005366 Ga0070659_100108029 Ga0070659_1001080292 156
157 3300005367 Ga0070667_100000109 Ga0070667_10000010944 156
158 3300005367 Ga0070667_100002710 Ga0070667_10000271016 156
159 3300005367 Ga0070667_100048456 Ga0070667_1000484562 156
160 3300005367 Ga0070667_100158628 Ga0070667_1001586282 156
161 3300005434 Ga0070709_10105885 Ga0070709_101058852 156
162 3300005437 Ga0070710_10010347 Ga0070710_100103475 156
163 3300005438 Ga0070701_10003505 Ga0070701_100035052 156
164 3300005439 Ga0070711_100001045 Ga0070711_1000010459 156
165 3300005439 Ga0070711_100191476 Ga0070711_1001914762 156
166 3300005440 Ga0070705_100010867 Ga0070705_1000108673 156
167 3300005441 Ga0070700_100023077 Ga0070700_1000230772 156
168 3300005441 Ga0070700_100081063 Ga0070700_1000810633 156
169 3300005444 Ga0070694_100031039 Ga0070694_1000310393 156
170 3300005445 Ga0070708_100325102 Ga0070708_1003251022 156
171 3300005445 Ga0070708_101154813 Ga0070708_1011548131 156
172 3300005455 Ga0070663_100021413 Ga0070663_1000214133 156
173 3300005455 Ga0070663_100030903 Ga0070663_1000309033 156
174 3300005455 Ga0070663_101530338 Ga0070663_1015303381 156
175 3300005456 Ga0070678_100000765 Ga0070678_1000007652 156
176 3300005456 Ga0070678_100025601 Ga0070678_1000256013 156
177 3300005457 Ga0070662_100006348 Ga0070662_1000063486 156
178 3300005457 Ga0070662_100363107 Ga0070662_1003631072 156
179 3300005459 Ga0068867_100010729 Ga0068867_1000107292 156
180 3300005459 Ga0068867_100224446 Ga0068867_1002244462 156
181 3300005466 Ga0070685_10010069 Ga0070685_100100693 156
182 3300005466 Ga0070685_10437737 Ga0070685_104377372 156
183 3300005539 Ga0068853_100005160 Ga0068853_10000516011 156
184 3300005539 Ga0068853_100142996 Ga0068853_1001429963 156
185 3300005543 Ga0070672_100236351 Ga0070672_1002363512 156
186 3300005543 Ga0070672_100451741 Ga0070672_1004517412 156
187 3300005544 Ga0070686_100128722 Ga0070686_1001287222 156
188 3300005545 Ga0070695_100001027 Ga0070695_10000102717 156
189 3300005546 Ga0070696_100059197 Ga0070696_1000591973 156
190 3300005547 Ga0070693_100197778 Ga0070693_1001977782 156
191 3300005547 Ga0070693_100435751 Ga0070693_1004357512 156
192 3300005548 Ga0070665_100004708 Ga0070665_1000047089 156
193 3300005548 Ga0070665_100068012 Ga0070665_1000680123 156
194 3300005548 Ga0070665_100243819 Ga0070665_1002438192 156
195 3300005549 Ga0070704_100000397 Ga0070704_1000003976 156
196 3300005563 Ga0068855_100188498 Ga0068855_1001884983 156
197 3300005563 Ga0068855_100273314 Ga0068855_1002733142 156
198 3300005578 Ga0068854_100000953 Ga0068854_10000095317 156
199 3300005578 Ga0068854_100047123 Ga0068854_1000471232 156
200 3300005614 Ga0068856_100556626 Ga0068856_1005566262 156
201 3300005615 Ga0070702_100001771 Ga0070702_1000017716 156
202 3300005617 Ga0068859_100001848 Ga0068859_10000184814 156
203 3300005617 Ga0068859_100009757 Ga0068859_1000097579 156
204 3300005617 Ga0068859_100093042 Ga0068859_1000930423 156
205 3300005618 Ga0068864_100059026 Ga0068864_1000590263 156
206 3300005718 Ga0068866_10042932 Ga0068866_100429323 156
207 3300005718 Ga0068866_10292620 Ga0068866_102926202 156
208 3300005719 Ga0068861_100002222 Ga0068861_10000222212 156
209 3300005719 Ga0068861_100041357 Ga0068861_1000413572 156
210 3300005719 Ga0068861_100356458 Ga0068861_1003564581 156
211 3300005841 Ga0068863_100000123 Ga0068863_10000012379 156
212 3300005841 Ga0068863_100461105 Ga0068863_1004611051 156
213 3300005841 Ga0068863_100597427 Ga0068863_1005974272 156
214 3300005842 Ga0068858_100000702 Ga0068858_10000070233 156
215 3300005842 Ga0068858_100150772 Ga0068858_1001507722 156
216 3300005842 Ga0068858_100237322 Ga0068858_1002373222 156
217 3300005842 Ga0068858_100458680 Ga0068858_1004586802 156
218 3300005842 Ga0068858_101199056 Ga0068858_1011990562 156
219 3300005843 Ga0068860_100000175 Ga0068860_10000017577 156
220 3300005843 Ga0068860_100005175 Ga0068860_1000051752 156
221 3300005843 Ga0068860_100333457 Ga0068860_1003334572 156
222 3300005844 Ga0068862_100000091 Ga0068862_10000009145 156
223 3300005844 Ga0068862_100017029 Ga0068862_1000170296 156
224 3300005844 Ga0068862_100167780 Ga0068862_1001677802 156
225 3300005937 Ga0081455_10098009 Ga0081455_100980093 156
226 3300005937 Ga0081455_10277971 Ga0081455_102779712 156
227 3300005981 Ga0081538_10044214 Ga0081538_100442142 156
228 3300006038 Ga0075365_10002340 Ga0075365_100023403 156
229 3300006038 Ga0075365_10102718 Ga0075365_101027183 156
230 3300006038 Ga0075365_10113022 Ga0075365_101130222 156
231 3300006038 Ga0075365_10556902 Ga0075365_105569023 156
232 3300006038 Ga0075365_10729638 Ga0075365_107296381 156
233 3300006048 Ga0075363_100000148 Ga0075363_10000014816 156
234 3300006048 Ga0075363_100002407 Ga0075363_1000024076 156
235 3300006048 Ga0075363_100032947 Ga0075363_1000329473 156
236 3300006048 Ga0075363_100034577 Ga0075363_1000345772 156
237 3300006048 Ga0075363_100127977 Ga0075363_1001279772 156
238 3300006048 Ga0075363_100226287 Ga0075363_1002262873 156
239 3300006051 Ga0075364_10007126 Ga0075364_100071264 156
240 3300006051 Ga0075364_10012626 Ga0075364_100126262 156
241 3300006051 Ga0075364_10012757 Ga0075364_100127574 156
242 3300006051 Ga0075364_10028273 Ga0075364_100282734 156
243 3300006051 Ga0075364_10215096 Ga0075364_102150962 156
244 3300006051 Ga0075364_10372687 Ga0075364_103726872 156
245 3300006163 Ga0070715_10010309 Ga0070715_100103093 156
246 3300006163 Ga0070715_10040178 Ga0070715_100401782 156
247 3300006173 Ga0070716_100002953 Ga0070716_1000029533 156
248 3300006173 Ga0070716_100021945 Ga0070716_1000219454 156
249 3300006173 Ga0070716_100036872 Ga0070716_1000368722 156
250 3300006173 Ga0070716_101098816 Ga0070716_1010988161 156
251 3300006175 Ga0070712_100007460 Ga0070712_1000074603 156
252 3300006175 Ga0070712_100016423 Ga0070712_1000164235 156
253 3300006175 Ga0070712_100686709 Ga0070712_1006867091 156
254 3300006177 Ga0075362_10008695 Ga0075362_100086954 156
255 3300006177 Ga0075362_10165353 Ga0075362_101653531 156
256 3300006178 Ga0075367_10023903 Ga0075367_100239034 156
257 3300006186 Ga0075369_10003326 Ga0075369_100033268 156
258 3300006186 Ga0075369_10019069 Ga0075369_100190693 156
259 3300006186 Ga0075369_10057627 Ga0075369_100576272 156
260 3300006186 Ga0075369_10190737 Ga0075369_101907372 156
261 3300006186 Ga0075369_10229234 Ga0075369_102292342 156
262 3300006237 Ga0097621_100016973 Ga0097621_1000169738 156
263 3300006237 Ga0097621_100641632 Ga0097621_1006416322 156
264 3300006353 Ga0075370_10000207 Ga0075370_1000020715 156
265 3300006353 Ga0075370_10003007 Ga0075370_100030074 156
266 3300006358 Ga0068871_100080831 Ga0068871_1000808313 156
267 3300006358 Ga0068871_100255428 Ga0068871_1002554282 156
268 3300006846 Ga0075430_100118179 Ga0075430_1001181792 156
269 3300006881 Ga0068865_100001071 Ga0068865_10000107116 156
270 3300006881 Ga0068865_100616793 Ga0068865_1006167931 156
271 3300006931 Ga0097620_100001848 Ga0097620_10000184814 156
272 3300006931 Ga0097620_100009756 Ga0097620_1000097563 156
273 3300006931 Ga0097620_100093039 Ga0097620_1000930393 156
274 3300007076 Ga0075435_100599284 Ga0075435_1005992841 156
275 3300009092 Ga0105250_10046323 Ga0105250_100463232 156
276 3300009093 Ga0105240_10210620 Ga0105240_102106202 156
277 3300009094 Ga0111539_10297484 Ga0111539_102974842 156
278 3300009098 Ga0105245_10136046 Ga0105245_101360462 156
279 3300009101 Ga0105247_10000070 Ga0105247_1000007071 156
280 3300009176 Ga0105242_10058052 Ga0105242_100580523 156
281 3300009177 Ga0105248_10000458 Ga0105248_1000045839 156
282 3300009177 Ga0105248_10205718 Ga0105248_102057183 156
283 3300009545 Ga0105237_10024525 Ga0105237_100245254 156
284 3300009545 Ga0105237_11449064 Ga0105237_114490641 156
285 3300009553 Ga0105249_10000020 Ga0105249_10000020191 156
286 3300009553 Ga0105249_10086514 Ga0105249_100865142 156
287 3300009553 Ga0105249_10408609 Ga0105249_104086091 156
288 3300010375 Ga0105239_10339588 Ga0105239_103395882 156
289 3300013105 Ga0157369_10247258 Ga0157369_102472582 156
290 3300013296 Ga0157374_10256433 Ga0157374_102564333 156
291 3300013306 Ga0163162_10072852 Ga0163162_100728522 156
292 3300013306 Ga0163162_10082205 Ga0163162_100822052 156
293 3300013306 Ga0163162_10084550 Ga0163162_100845504 156
294 3300014325 Ga0163163_10015155 Ga0163163_100151557 156
295 3300014325 Ga0163163_10949025 Ga0163163_109490251 156
296 3300014326 Ga0157380_10043097 Ga0157380_100430974 156
297 3300014745 Ga0157377_10009645 Ga0157377_100096452 156
298 3300014968 Ga0157379_10057893 Ga0157379_100578934 156
299 3300017792 Ga0163161_10004320 Ga0163161_100043207 156
300 3300017792 Ga0163161_10070401 Ga0163161_100704012 156
301 3300025294 Ga0209025_1153566 Ga0209025_11535661 156
302 3300025303 Ga0209051_1000549 Ga0209051_100054924 156
303 3300025303 Ga0209051_1000709 Ga0209051_100070921 156
304 3300025885 Ga0207653_10054690 Ga0207653_100546902 156
305 3300025893 Ga0207682_10044007 Ga0207682_100440072 156
306 3300025898 Ga0207692_10005950 Ga0207692_100059504 156
307 3300025899 Ga0207642_10006557 Ga0207642_100065572 156
308 3300025900 Ga0207710_10000010 Ga0207710_10000010321 156
309 3300025900 Ga0207710_10000856 Ga0207710_100008566 156
310 3300025901 Ga0207688_10001325 Ga0207688_1000132511 156
311 3300025901 Ga0207688_10009287 Ga0207688_100092875 156
312 3300025903 Ga0207680_10105562 Ga0207680_101055622 156
313 3300025903 Ga0207680_10173523 Ga0207680_101735232 156
314 3300025904 Ga0207647_10100458 Ga0207647_101004582 156
315 3300025905 Ga0207685_10007929 Ga0207685_100079292 156
316 3300025905 Ga0207685_10031234 Ga0207685_100312342 156
317 3300025906 Ga0207699_10002028 Ga0207699_100020286 156
318 3300025907 Ga0207645_10046268 Ga0207645_100462682 156
319 3300025907 Ga0207645_10099733 Ga0207645_100997332 156
320 3300025908 Ga0207643_10499485 Ga0207643_104994852 156
321 3300025914 Ga0207671_10105836 Ga0207671_101058363 156
322 3300025914 Ga0207671_10576496 Ga0207671_105764962 156
323 3300025915 Ga0207693_10020808 Ga0207693_100208081 156
324 3300025915 Ga0207693_10046909 Ga0207693_100469092 156
325 3300025915 Ga0207693_10271153 Ga0207693_102711531 156
326 3300025916 Ga0207663_10006057 Ga0207663_100060577 156
327 3300025916 Ga0207663_10106443 Ga0207663_101064431 156
328 3300025918 Ga0207662_10085353 Ga0207662_100853532 156
329 3300025919 Ga0207657_10203194 Ga0207657_102031942 156
330 3300025921 Ga0207652_10512019 Ga0207652_105120192 156
331 3300025923 Ga0207681_10000979 Ga0207681_1000097916 156
332 3300025923 Ga0207681_10109103 Ga0207681_101091032 156
333 3300025926 Ga0207659_10235140 Ga0207659_102351402 156
334 3300025927 Ga0207687_10000726 Ga0207687_1000072619 156
335 3300025927 Ga0207687_10080796 Ga0207687_100807962 156
336 3300025931 Ga0207644_10565398 Ga0207644_105653982 156
337 3300025932 Ga0207690_10585820 Ga0207690_105858202 156
338 3300025933 Ga0207706_10013084 Ga0207706_100130843 156
339 3300025933 Ga0207706_10032166 Ga0207706_100321662 156
340 3300025933 Ga0207706_10539073 Ga0207706_105390732 156
341 3300025934 Ga0207686_10005430 Ga0207686_100054303 156
342 3300025934 Ga0207686_10091375 Ga0207686_100913753 156
343 3300025935 Ga0207709_10010239 Ga0207709_100102392 156
344 3300025936 Ga0207670_10004115 Ga0207670_100041156 156
345 3300025937 Ga0207669_10002515 Ga0207669_100025156 156
346 3300025937 Ga0207669_10009818 Ga0207669_100098183 156
347 3300025938 Ga0207704_10000940 Ga0207704_1000094013 156
348 3300025938 Ga0207704_10101636 Ga0207704_101016361 156
349 3300025939 Ga0207665_10003509 Ga0207665_100035097 156
350 3300025939 Ga0207665_10008675 Ga0207665_100086754 156
351 3300025940 Ga0207691_10022514 Ga0207691_100225142 156
352 3300025940 Ga0207691_10100575 Ga0207691_101005752 156
353 3300025941 Ga0207711_10000422 Ga0207711_1000042239 156
354 3300025941 Ga0207711_10015465 Ga0207711_100154655 156
355 3300025941 Ga0207711_10477434 Ga0207711_104774342 156
356 3300025941 Ga0207711_10845916 Ga0207711_108459162 156
357 3300025942 Ga0207689_10026498 Ga0207689_100264983 156
358 3300025942 Ga0207689_10040614 Ga0207689_100406142 156
359 3300025949 Ga0207667_10047452 Ga0207667_100474523 156
360 3300025949 Ga0207667_10082265 Ga0207667_100822653 156
361 3300025949 Ga0207667_10564980 Ga0207667_105649802 156
362 3300025961 Ga0207712_10000010 Ga0207712_1000001073 156
363 3300025961 Ga0207712_10079144 Ga0207712_100791442 156
364 3300025961 Ga0207712_10212755 Ga0207712_102127552 156
365 3300025961 Ga0207712_10450086 Ga0207712_104500862 156
366 3300025961 Ga0207712_10710970 Ga0207712_107109701 156
367 3300025972 Ga0207668_10047736 Ga0207668_100477362 156
368 3300025972 Ga0207668_10367372 Ga0207668_103673721 156
369 3300025972 Ga0207668_10620707 Ga0207668_106207072 156
370 3300025981 Ga0207640_10006104 Ga0207640_100061044 156
371 3300025986 Ga0207658_10000257 Ga0207658_1000025757 156
372 3300025986 Ga0207658_10015885 Ga0207658_100158854 156
373 3300025986 Ga0207658_10196665 Ga0207658_101966651 156
374 3300026023 Ga0207677_10011540 Ga0207677_100115406 156
375 3300026023 Ga0207677_10026067 Ga0207677_100260674 156
376 3300026035 Ga0207703_10009971 Ga0207703_100099716 156
377 3300026035 Ga0207703_10072092 Ga0207703_100720922 156
378 3300026035 Ga0207703_10205933 Ga0207703_102059332 156
379 3300026035 Ga0207703_10307136 Ga0207703_103071362 156
380 3300026035 Ga0207703_10766971 Ga0207703_107669712 156
381 3300026041 Ga0207639_10277298 Ga0207639_102772982 156
382 3300026067 Ga0207678_10009744 Ga0207678_100097443 156
383 3300026067 Ga0207678_10033659 Ga0207678_100336593 156
384 3300026075 Ga0207708_10000765 Ga0207708_1000076517 156
385 3300026075 Ga0207708_10011035 Ga0207708_100110355 156
386 3300026078 Ga0207702_10293858 Ga0207702_102938582 156
387 3300026088 Ga0207641_10002535 Ga0207641_100025354 156
388 3300026088 Ga0207641_10175777 Ga0207641_101757772 156
389 3300026088 Ga0207641_10655269 Ga0207641_106552691 156
390 3300026088 Ga0207641_11309494 Ga0207641_113094942 156
391 3300026089 Ga0207648_10020206 Ga0207648_100202062 156
392 3300026089 Ga0207648_10103348 Ga0207648_101033483 156
393 3300026095 Ga0207676_10045218 Ga0207676_100452182 156
394 3300026118 Ga0207675_100001697 Ga0207675_1000016977 156
395 3300026118 Ga0207675_100026851 Ga0207675_1000268514 156
396 3300026118 Ga0207675_100124295 Ga0207675_1001242953 156
397 3300026121 Ga0207683_10001526 Ga0207683_1000152617 156
398 3300026121 Ga0207683_10056149 Ga0207683_100561492 156
399 3300026142 Ga0207698_10476272 Ga0207698_104762722 156
400 3300027907 Ga0207428_10213885 Ga0207428_102138852 156
401 3300028379 Ga0268266_10031437 Ga0268266_100314373 156
402 3300028380 Ga0268265_10000105 Ga0268265_1000010572 156
403 3300028380 Ga0268265_10120995 Ga0268265_101209952 156
404 3300028380 Ga0268265_10269765 Ga0268265_102697652 156
405 3300028380 Ga0268265_10664119 Ga0268265_106641192 156
406 3300028381 Ga0268264_10000237 Ga0268264_1000023745 156
407 3300028381 Ga0268264_10025357 Ga0268264_100253574 156
408 3300031824 Ga0307413_10517032 Ga0307413_105170322 156
409 3300031852 Ga0307410_11047855 Ga0307410_110478551 156
410 3300031995 Ga0307409_100462606 Ga0307409_1004626062 156
411 3300032126 Ga0307415_100598479 Ga0307415_1005984791 156
412 3300034819 Ga0373958_0027423 Ga0373958_0027423_587_1084 156
413 3300034820 Ga0373959_0012019 Ga0373959_0012019_494_991 156
414 3300035115 Ga0373941_0212575 Ga0373941_0212575_132_602 156
415 3300035692 Ga0373935_0254463 Ga0373935_0254463_509_979 156
416 3300035725 Ga0373947_0617819 Ga0373947_0617819_175_645 156
417 3300041498 Ga0451841_0153296 Ga0451841_0153296_36_506 156
418 3300041511 Ga0451855_1110169 Ga0451855_1110169_19_489 156
419 3300044658 Ga0466972_0081447 Ga0466972_0081447_1059_1529 156
420 3300044683 Ga0466965_0009934 Ga0466965_0009934_2237_2707 156
421 3300044901 Ga0466960_0000507 Ga0466960_0000507_11503_11973 156
422 3300044901 Ga0466960_0087458 Ga0466960_0087458_57_527 156
423 3300044901 Ga0466960_0147086 Ga0466960_0147086_331_801 156
424 3300046455 Ga0495603_0011829 Ga0495603_0011829_871_1341 156
425 3300046459 Ga0495629_0013340 Ga0495629_0013340_3902_4372 156
426 3300046473 Ga0495582_0010870 Ga0495582_0010870_2640_3110 156
427 3300046476 Ga0495662_0132436 Ga0495662_0132436_145_615 156
428 3300046477 Ga0495664_0133829 Ga0495664_0133829_99_569 156
429 3300046511 Ga0495608_0194731 Ga0495608_0194731_458_928 156
430 3300046526 Ga0495666_0151529 Ga0495666_0151529_221_691 156
431 3300046531 Ga0495665_0077194 Ga0495665_0077194_325_795 156
432 3300046559 Ga0495667_0698120 Ga0495667_0698120_114_584 156
433 3300046674 Ga0495588_0068837 Ga0495588_0068837_1128_1598 156
434 3300046680 Ga0495646_0337631 Ga0495646_0337631_28_498 156
435 3300046683 Ga0495658_0406163 Ga0495658_0406163_329_799 156
436 3300046690 Ga0495624_0075510 Ga0495624_0075510_984_1454 156
437 3300047315 Ga0495581_0049336 Ga0495581_0049336_1400_1870 156
438 3300047673 Ga0495593_0001584 Ga0495593_0001584_10174_10644 156
439 3300048903 Ga0496100_0000699 Ga0496100_0000699_2557_3027 156
440 3300048903 Ga0496100_0045092 Ga0496100_0045092_2132_2602 156
441 3300048904 Ga0496101_0000404 Ga0496101_0000404_15707_16177 156
442 3300048904 Ga0496101_0002102 Ga0496101_0002102_496_966 156
443 3300048904 Ga0496101_0222898 Ga0496101_0222898_171_641 156
444 3300048905 Ga0496102_0000526 Ga0496102_0000526_16455_16925 156
445 3300048905 Ga0496102_0043483 Ga0496102_0043483_3089_3559 156
446 3300048905 Ga0496102_0085945 Ga0496102_0085945_1725_2195 156
447 3300048905 Ga0496102_0218474 Ga0496102_0218474_1229_1726 156
448 3300048905 Ga0496102_1105828 Ga0496102_1105828_143_613 156
449 3300048906 Ga0496103_0000356 Ga0496103_0000356_36249_36719 156
450 3300048906 Ga0496103_0042693 Ga0496103_0042693_2202_2699 156
451 3300048906 Ga0496103_0147728 Ga0496103_0147728_440_910 156
452 3300048906 Ga0496103_0281446 Ga0496103_0281446_440_910 156
453 3300048907 Ga0496104_0027623 Ga0496104_0027623_2992_3462 156
454 3300048907 Ga0496104_0360557 Ga0496104_0360557_841_1338 156
455 3300048907 Ga0496104_0483853 Ga0496104_0483853_560_1030 156
456 3300048908 Ga0496105_0007351 Ga0496105_0007351_5222_5692 156
457 3300048908 Ga0496105_0062741 Ga0496105_0062741_2482_2979 156
458 3300048909 Ga0496106_0001273 Ga0496106_0001273_15660_16130 156
459 3300048909 Ga0496106_0068849 Ga0496106_0068849_1834_2304 156
460 3300048909 Ga0496106_0287804 Ga0496106_0287804_277_747 156
461 3300048910 Ga0496107_0000481 Ga0496107_0000481_16554_17024 156
462 3300048910 Ga0496107_0010487 Ga0496107_0010487_647_1117 156
463 3300048910 Ga0496107_0037801 Ga0496107_0037801_811_1281 156
464 3300048911 Ga0496108_0000767 Ga0496108_0000767_596_1093 156
465 3300048911 Ga0496108_0707006 Ga0496108_0707006_263_733 156
466 3300048912 Ga0496109_0170873 Ga0496109_0170873_496_993 156
467 3300048912 Ga0496109_0463275 Ga0496109_0463275_532_1002 156
468 3300048912 Ga0496109_0734596 Ga0496109_0734596_215_685 156
469 3300048913 Ga0496110_0716733 Ga0496110_0716733_12_509 156
470 3300048914 Ga0496111_0026772 Ga0496111_0026772_2006_2503 156
471 3300048915 Ga0496112_0029780 Ga0496112_0029780_2841_3338 156
472 3300048917 Ga0496114_0000979 Ga0496114_0000979_15978_16448 156
473 3300048917 Ga0496114_0341987 Ga0496114_0341987_16_513 156
474 3300048917 Ga0496114_0351011 Ga0496114_0351011_364_834 156
475 3300048918 Ga0496115_0909940 Ga0496115_0909940_86_556 156
476 3300048919 Ga0496116_0008070 Ga0496116_0008070_370_840 156
477 3300048920 Ga0496117_0000614 Ga0496117_0000614_25291_25761 156
478 3300048921 Ga0496118_0000558 Ga0496118_0000558_37601_38071 156
479 3300048923 Ga0496120_0008662 Ga0496120_0008662_333_803 156
480 3300048924 Ga0496121_0010416 Ga0496121_0010416_9624_10094 156
481 3300048929 Ga0496126_0006132 Ga0496126_0006132_11689_12159 156
482 3300049823 Ga0501044_0060802 Ga0501044_0060802_2533_3009 156
483 3300050489 nmdc:mga03683_140641_c1 nmdc:mga03683_140641_c1_311_781 156
484 3300050489 nmdc:mga03683_372673_c1 nmdc:mga03683_372673_c1_134_604 156
485 3300050489 nmdc:mga03683_391065_c1 nmdc:mga03683_391065_c1_95_565 156
486 3300050490 nmdc:mga03n38_106362_c1 nmdc:mga03n38_106362_c1_113_583 156
487 3300050490 nmdc:mga03n38_20029_c1 nmdc:mga03n38_20029_c1_2171_2641 156
488 3300050490 nmdc:mga03n38_3703_c1 nmdc:mga03n38_3703_c1_1846_2316 156
489 3300050490 nmdc:mga03n38_75281_c1 nmdc:mga03n38_75281_c1_16_486 156
490 3300050491 nmdc:mga00v17_19292_c1 nmdc:mga00v17_19292_c1_3292_3762 156
491 3300050491 nmdc:mga00v17_255783_c1 nmdc:mga00v17_255783_c1_648_1118 156
492 3300050491 nmdc:mga00v17_594987_c1 nmdc:mga00v17_594987_c1_226_696 156
493 3300050491 nmdc:mga00v17_67914_c1 nmdc:mga00v17_67914_c1_827_1297 156
494 3300050492 nmdc:mga0yw44_86224_c1 nmdc:mga0yw44_86224_c1_872_1342 156
495 3300050494 nmdc:mga06z11_33083_c1 nmdc:mga06z11_33083_c1_138_608 156
496 3300050494 nmdc:mga06z11_505561_c1 nmdc:mga06z11_505561_c1_15_485 156
497 3300050496 nmdc:mga07m45_402188_c1 nmdc:mga07m45_402188_c1_176_646 156
498 3300050496 nmdc:mga07m45_7113_c1 nmdc:mga07m45_7113_c1_2999_3469 156
499 3300050511 nmdc:mga08y16_286001_c1 nmdc:mga08y16_286001_c1_544_1014 156
500 3300050513 nmdc:mga0rr50_580457_c1 nmdc:mga0rr50_580457_c1_134_604 156
501 3300050516 nmdc:mga0sz30_112209_c1 nmdc:mga0sz30_112209_c1_317_787 156
502 3300050516 nmdc:mga0sz30_62245_c1 nmdc:mga0sz30_62245_c1_1011_1481 156
503 3300053083 Ga0495655_0005812 Ga0495655_0005812_1540_2010 156
504 3300053131 Ga0500652_005108 Ga0500652_005108_2785_3255 156
505 3300053153 Ga0500616_0035765 Ga0500616_0035765_1027_1497 156
506 3300053155 Ga0500620_037311 Ga0500620_037311_127_597 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00358

PTS_EIIA_1

phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1

16

142

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3our-assembly3.cif.gz_F crystal structure of complex between eiia and a novel pyruvate decarboxylase 0.9142 4 156
3our-assembly3.cif.gz_F crystal structure of complex between eiia and a novel pyruvate decarboxylase 0.9026 4 156
1gla-assembly1.cif.gz_F structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase 0.9005 1 152
1gpr-assembly1.cif.gz_A-2 refined crystal structure of iia domain of the glucose permease of bacillus subtilis at 1.9 angstroms resolution 0.8988 6 156
4jbw-assembly1.cif.gz_M crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8978 4 156
ID Description Score Start End Superfamily
af_Q2FYL0_6_165_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9234 3 156 2.70.70.10
af_P08722_474_624_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9151 4 152 2.70.70.10
af_Q2FV87_535_686_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.915 1 152 2.70.70.10
1gprA00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8988 6 156 2.70.70.10
2gprA00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8971 1 153 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A7I7SR88-F1-model_v4 PTS glucose transporter subunit IIA 0.9954 25 156 GO:0005737
GO:0009401
GO:0016301
AF-A0A6H3JXJ1-F1-model_v4 deleted 0.9822 4 156
AF-A0A7I7SR88-F1-model_v4 PTS glucose transporter subunit IIA 0.9806 25 156 GO:0005737
GO:0009401
GO:0016301
AF-A0A4V3IKL1-F1-model_v4 deleted 0.9795 1 156
AF-A0A645DDI8-F1-model_v4 PTS system glucose-specific EIICBA component (EC 2.7.1.199) 0.9786 1 155 GO:0005886
GO:0008982
GO:0009401
GO:0016301
GO:0090563

Feature Viewer

pLDDT pTM Quality
95.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map