F456325

General Info

Members Datasets Scaffolds Average Seq Length
505 212 1010 110

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100240822|Ga0070697_1002408222
Length 118
Sequence MRKHLVSGLLIVDLLAIAMLAAAQGQRTFTGVITDSMCATADHSRMRMGPTDAECTIACVLAHGALYVLYDGKEVYTLSDQQKPEKFAGKKVTVRGTLDAKTKTIRMDNSGDSITAAK

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 1.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.19
Rhizosphere 97.82
Stem 0
Stem Tuber 0
Unclassified 36.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100240822 3300005536 Bacteria 1545
2 MRS1b_contig_4789590 2162886011 Unclassified 1847
3 Ga0065712_10070746 3300005290 Bacteria 5745
4 Ga0070658_11453102 3300005327 Unclassified 595
5 Ga0070683_100000301 3300005329 Bacteria 33790
6 Ga0070683_100000322 3300005329 Bacteria 33033
7 Ga0070683_100010076 3300005329 Bacteria 8107
8 Ga0070683_100181740 3300005329 Bacteria 1996
9 Ga0070683_100228195 3300005329 Bacteria 1770
10 Ga0070683_100235153 3300005329 Unclassified 1742
11 Ga0070683_100842761 3300005329 Bacteria 879
12 Ga0070690_101366167 3300005330 Unclassified 569
13 Ga0068869_100036042 3300005334 Bacteria 3510
14 Ga0068869_100061874 3300005334 Bacteria 2746
15 Ga0068869_100636377 3300005334 Unclassified 904
16 Ga0070666_11335938 3300005335 Unclassified 535
17 Ga0070682_100488733 3300005337 Bacteria 951
18 Ga0068868_100269837 3300005338 Unclassified 1437
19 Ga0068868_101251099 3300005338 Unclassified 688
20 Ga0070660_100111883 3300005339 Bacteria 2173
21 Ga0070689_100545500 3300005340 Unclassified 998
22 Ga0070661_101387303 3300005344 Unclassified 591
23 Ga0070669_101460829 3300005353 Unclassified 594
24 Ga0070688_100207411 3300005365 Unclassified 1374
25 Ga0070659_100088807 3300005366 Bacteria 2476
26 Ga0070659_101002208 3300005366 Unclassified 733
27 Ga0070709_10014001 3300005434 Bacteria 4526
28 Ga0070714_100159959 3300005435 Bacteria 2037
29 Ga0070713_100197498 3300005436 Bacteria 1815
30 Ga0070713_101158596 3300005436 Unclassified 748
31 Ga0070710_10465365 3300005437 Bacteria 860
32 Ga0070710_10914694 3300005437 Unclassified 634
33 Ga0070711_100006148 3300005439 Bacteria 7216
34 Ga0070711_100059432 3300005439 Bacteria 2654
35 Ga0070711_100136965 3300005439 Bacteria 1831
36 Ga0070711_100684666 3300005439 Unclassified 862
37 Ga0070711_101245614 3300005439 Unclassified 644
38 Ga0070708_100010686 3300005445 Bacteria 7449
39 Ga0070708_100891811 3300005445 Unclassified 835
40 Ga0070678_100100224 3300005456 Bacteria 2243
41 Ga0070678_100928380 3300005456 Unclassified 797
42 Ga0070662_101488820 3300005457 Bacteria 584
43 Ga0070681_10121829 3300005458 Unclassified 2542
44 Ga0070681_10743039 3300005458 Unclassified 898
45 Ga0070681_11131641 3300005458 Unclassified 704
46 Ga0068867_100070693 3300005459 Bacteria 2609
47 Ga0068867_101902941 3300005459 Unclassified 561
48 Ga0070707_100110694 3300005468 Bacteria 2663
49 Ga0070699_100013163 3300005518 Bacteria 7133
50 Ga0070699_100550431 3300005518 Unclassified 1050
51 Ga0070679_100139418 3300005530 Bacteria 2405
52 Ga0070679_102026070 3300005530 Unclassified 525
53 Ga0070684_100005837 3300005535 Bacteria 9471
54 Ga0070684_100174523 3300005535 Bacteria 1953
55 Ga0070697_100056408 3300005536 Bacteria 3196
56 Ga0070695_100186820 3300005545 Unclassified 1472
57 Ga0070696_100339190 3300005546 Bacteria 1161
58 Ga0070693_100036539 3300005547 Bacteria 2732
59 Ga0070665_100488352 3300005548 Unclassified 1242
60 Ga0068855_100005296 3300005563 Bacteria 15752
61 Ga0068855_100234896 3300005563 Unclassified 2051
62 Ga0068855_100743709 3300005563 Unclassified 1046
63 Ga0070664_100097103 3300005564 Bacteria 2558
64 Ga0070664_100146834 3300005564 Bacteria 2080
65 Ga0068857_100006360 3300005577 Bacteria 10114
66 Ga0068857_100058196 3300005577 Unclassified 3431
67 Ga0068857_100567248 3300005577 Unclassified 1070
68 Ga0068857_101699015 3300005577 Unclassified 617
69 Ga0068854_100092633 3300005578 Bacteria 2251
70 Ga0068856_100001168 3300005614 Bacteria 27615
71 Ga0068856_100019210 3300005614 Bacteria 6635
72 Ga0068856_100124555 3300005614 Bacteria 2580
73 Ga0068856_100130937 3300005614 Unclassified 2513
74 Ga0068856_100158300 3300005614 Bacteria 2275
75 Ga0068856_100170502 3300005614 Bacteria 2188
76 Ga0068856_100207491 3300005614 Bacteria 1974
77 Ga0068856_101270824 3300005614 Unclassified 752
78 Ga0068852_100837215 3300005616 Bacteria 935
79 Ga0068859_100150144 3300005617 Bacteria 2406
80 Ga0068864_100238168 3300005618 Unclassified 1685
81 Ga0068864_100318127 3300005618 Bacteria 1461
82 Ga0068864_100624944 3300005618 Bacteria 1047
83 Ga0068864_100932191 3300005618 Unclassified 859
84 Ga0068866_11182868 3300005718 Unclassified 551
85 Ga0068861_100678186 3300005719 Unclassified 955
86 Ga0068861_102122522 3300005719 Unclassified 562
87 Ga0068863_100054204 3300005841 Bacteria 3800
88 Ga0068863_100888369 3300005841 Unclassified 891
89 Ga0068863_101811742 3300005841 Unclassified 620
90 Ga0068863_101842668 3300005841 Unclassified 615
91 Ga0068860_100052936 3300005843 Bacteria 3860
92 Ga0068860_100193632 3300005843 Bacteria 1968
93 Ga0068862_102480719 3300005844 Unclassified 530
94 Ga0070716_100184572 3300006173 Bacteria 1373
95 Ga0070716_100203852 3300006173 Unclassified 1317
96 Ga0070716_101064623 3300006173 Unclassified 643
97 Ga0097621_100026422 3300006237 Bacteria 4554
98 Ga0097621_100038898 3300006237 Bacteria 3819
99 Ga0097621_100063559 3300006237 Bacteria 3034
100 Ga0097621_101537731 3300006237 Bacteria 632
101 Ga0068871_100083742 3300006358 Bacteria 2646
102 Ga0068871_100090833 3300006358 Bacteria 2544
103 Ga0068871_100105736 3300006358 Unclassified 2362
104 Ga0068871_100132052 3300006358 Bacteria 2118
105 Ga0068871_101725362 3300006358 Bacteria 594
106 Ga0068871_102240812 3300006358 Unclassified 521
107 Ga0075428_101023539 3300006844 Unclassified 874
108 Ga0075430_100116603 3300006846 Bacteria 2226
109 Ga0075431_100048956 3300006847 Bacteria 4359
110 Ga0075433_10481973 3300006852 Bacteria 1093
111 Ga0075434_100132381 3300006871 Bacteria 2513
112 Ga0075434_100249912 3300006871 Bacteria 1793
113 Ga0075434_101248807 3300006871 Unclassified 754
114 Ga0068865_100119849 3300006881 Bacteria 1954
115 Ga0068865_100284916 3300006881 Bacteria 1317
116 Ga0068865_101685475 3300006881 Unclassified 571
117 Ga0075436_100552844 3300006914 Unclassified 845
118 Ga0075436_100906329 3300006914 Archaea 659
119 Ga0097620_100150152 3300006931 Bacteria 2406
120 Ga0097620_100563993 3300006931 Bacteria 1233
121 Ga0075435_100093332 3300007076 Bacteria 2487
122 Ga0099794_10118523 3300007265 Bacteria 1330
123 Ga0105240_10004258 3300009093 Bacteria 21882
124 Ga0105240_10031381 3300009093 Bacteria 6891
125 Ga0105240_10183794 3300009093 Bacteria 2465
126 Ga0105240_10219632 3300009093 Bacteria 2215
127 Ga0105240_11095644 3300009093 Unclassified 848
128 Ga0105240_11841754 3300009093 Unclassified 630
129 Ga0111539_10442277 3300009094 Bacteria 1514
130 Ga0105245_10001232 3300009098 Bacteria 23083
131 Ga0105245_10001357 3300009098 Bacteria 22154
132 Ga0105245_10003490 3300009098 Bacteria 14078
133 Ga0105245_10106227 3300009098 Unclassified 2605
134 Ga0105245_10349809 3300009098 Bacteria 1464
135 Ga0105245_10762342 3300009098 Unclassified 1004
136 Ga0105245_11166591 3300009098 Unclassified 818
137 Ga0105245_11687347 3300009098 Unclassified 686
138 Ga0105247_10725112 3300009101 Bacteria 751
139 Ga0105247_11402132 3300009101 Bacteria 565
140 Ga0114129_10176709 3300009147 Bacteria 2908
141 Ga0114129_10644110 3300009147 Bacteria 1368
142 Ga0114129_11211053 3300009147 Bacteria 940
143 Ga0105243_10086566 3300009148 Bacteria 2570
144 Ga0105243_10522240 3300009148 Bacteria 1129
145 Ga0105243_10685005 3300009148 Unclassified 997
146 Ga0105243_12154443 3300009148 Unclassified 594
147 Ga0105241_10025024 3300009174 Bacteria 4435
148 Ga0105241_10067745 3300009174 Bacteria 2763
149 Ga0105241_10273147 3300009174 Bacteria 1441
150 Ga0105241_11028014 3300009174 Unclassified 772
151 Ga0105242_10016652 3300009176 Bacteria 5719
152 Ga0105242_10033855 3300009176 Unclassified 4094
153 Ga0105242_10054397 3300009176 Bacteria 3271
154 Ga0105242_10075150 3300009176 Unclassified 2812
155 Ga0105242_10087441 3300009176 Unclassified 2616
156 Ga0105242_10090039 3300009176 Bacteria 2580
157 Ga0105242_10387387 3300009176 Unclassified 1301
158 Ga0105242_10697859 3300009176 Bacteria 992
159 Ga0105242_10703359 3300009176 Bacteria 989
160 Ga0105242_10726272 3300009176 Unclassified 975
161 Ga0105242_11435427 3300009176 Bacteria 719
162 Ga0105242_11832060 3300009176 Bacteria 646
163 Ga0105248_10003760 3300009177 Bacteria 16819
164 Ga0105248_10024026 3300009177 Bacteria 6774
165 Ga0105248_10202264 3300009177 Bacteria 2238
166 Ga0105248_10244965 3300009177 Bacteria 2018
167 Ga0105248_10484390 3300009177 Bacteria 1394
168 Ga0105248_12123343 3300009177 Bacteria 639
169 Ga0105237_10011512 3300009545 Bacteria 9359
170 Ga0105237_10011725 3300009545 Bacteria 9271
171 Ga0105237_10094028 3300009545 Bacteria 2987
172 Ga0105237_10455322 3300009545 Bacteria 1285
173 Ga0105237_10764291 3300009545 Bacteria 973
174 Ga0105238_10002029 3300009551 Bacteria 20442
175 Ga0105238_10003498 3300009551 Bacteria 15635
176 Ga0105238_10019404 3300009551 Bacteria 6924
177 Ga0105238_10039898 3300009551 Bacteria 4758
178 Ga0105238_10099408 3300009551 Bacteria 2892
179 Ga0105238_11392734 3300009551 Bacteria 728
180 Ga0105249_10032352 3300009553 Bacteria 4731
181 Ga0105249_10135442 3300009553 Bacteria 2356
182 Ga0105249_10463919 3300009553 Bacteria 1307
183 Ga0105239_10002231 3300010375 Bacteria 24794
184 Ga0105239_10031315 3300010375 Bacteria 5850
185 Ga0105239_10138165 3300010375 Bacteria 2714
186 Ga0105239_10265745 3300010375 Bacteria 1929
187 Ga0105239_11587637 3300010375 Bacteria 756
188 Ga0105246_10005560 3300011119 Bacteria 7683
189 Ga0105246_10101824 3300011119 Bacteria 2093
190 Ga0105246_10985195 3300011119 Bacteria 762
191 Ga0105246_11793514 3300011119 Unclassified 586
192 Ga0157373_10662480 3300013100 Bacteria 763
193 Ga0157371_10106575 3300013102 Bacteria 1989
194 Ga0157370_10005280 3300013104 Bacteria 14513
195 Ga0157370_10005951 3300013104 Bacteria 13582
196 Ga0157370_10159389 3300013104 Bacteria 2100
197 Ga0157370_10572167 3300013104 Unclassified 1035
198 Ga0157369_10002434 3300013105 Bacteria 22363
199 Ga0157369_10005041 3300013105 Bacteria 15457
200 Ga0157369_10030934 3300013105 Bacteria 5899
201 Ga0157369_10490339 3300013105 Bacteria 1271
202 Ga0157369_10612117 3300013105 Unclassified 1124
203 Ga0157369_10757811 3300013105 Unclassified 998
204 Ga0157374_10016401 3300013296 Bacteria 6510
205 Ga0157374_10142485 3300013296 Bacteria 2327
206 Ga0157378_10004821 3300013297 Bacteria 11821
207 Ga0157378_10092662 3300013297 Unclassified 2749
208 Ga0157378_10259517 3300013297 Bacteria 1666
209 Ga0157378_10304740 3300013297 Bacteria 1543
210 Ga0157378_11381165 3300013297 Unclassified 747
211 Ga0157378_11627047 3300013297 Unclassified 692
212 Ga0157378_11916808 3300013297 Unclassified 642
213 Ga0163162_10206286 3300013306 Bacteria 2095
214 Ga0163162_10288329 3300013306 Bacteria 1773
215 Ga0163162_10703382 3300013306 Bacteria 1132
216 Ga0163162_10836701 3300013306 Bacteria 1036
217 Ga0163162_12251748 3300013306 Unclassified 626
218 Ga0157372_10040545 3300013307 Bacteria 5144
219 Ga0157372_10057288 3300013307 Unclassified 4356
220 Ga0157372_10174869 3300013307 Bacteria 2485
221 Ga0157372_10321048 3300013307 Bacteria 1803
222 Ga0157372_10487768 3300013307 Bacteria 1437
223 Ga0157372_10655478 3300013307 Bacteria 1222
224 Ga0157375_10048447 3300013308 Bacteria 4157
225 Ga0157375_10071075 3300013308 Bacteria 3492
226 Ga0157375_11129381 3300013308 Unclassified 918
227 Ga0163163_10035419 3300014325 Bacteria 4842
228 Ga0163163_10063346 3300014325 Bacteria 3666
229 Ga0163163_10476328 3300014325 Unclassified 1309
230 Ga0163163_10791039 3300014325 Unclassified 1012
231 Ga0163163_10866736 3300014325 Bacteria 966
232 Ga0163163_10904091 3300014325 Unclassified 946
233 Ga0163163_11078390 3300014325 Unclassified 866
234 Ga0163163_11320579 3300014325 Unclassified 783
235 Ga0157380_10231592 3300014326 Unclassified 1660
236 Ga0157377_10419132 3300014745 Unclassified 916
237 Ga0157379_10029212 3300014968 Unclassified 4903
238 Ga0157379_10854763 3300014968 Bacteria 861
239 Ga0157379_11751932 3300014968 Unclassified 609
240 Ga0157376_10035155 3300014969 Unclassified 4052
241 Ga0157376_10119162 3300014969 Unclassified 2336
242 Ga0157376_10353470 3300014969 Bacteria 1407
243 Ga0157376_11253289 3300014969 Unclassified 771
244 Ga0157376_11774207 3300014969 Bacteria 653
245 Ga0163161_10214137 3300017792 Bacteria 1489
246 Ga0197907_10941983 3300020069 Bacteria 1624
247 Ga0206356_11270769 3300020070 Bacteria 1097
248 Ga0206349_1330173 3300020075 Bacteria 1106
249 Ga0206350_11043932 3300020080 Bacteria 1255
250 Ga0213875_10027409 3300021388 Bacteria 2710
251 Ga0224712_10050058 3300022467 Bacteria 1621
252 Ga0224712_10101185 3300022467 Bacteria 1222
253 Ga0207642_10528863 3300025899 Unclassified 725
254 Ga0207680_10335485 3300025903 Bacteria 1060
255 Ga0207699_10106109 3300025906 Unclassified 1792
256 Ga0207645_10332830 3300025907 Bacteria 1014
257 Ga0207645_11014833 3300025907 Unclassified 562
258 Ga0207654_10015698 3300025911 Bacteria 3935
259 Ga0207654_10034751 3300025911 Bacteria 2802
260 Ga0207654_10066714 3300025911 Bacteria 2123
261 Ga0207654_10570893 3300025911 Unclassified 805
262 Ga0207654_10587728 3300025911 Bacteria 794
263 Ga0207707_10000565 3300025912 Bacteria 37586
264 Ga0207707_10077877 3300025912 Bacteria 2894
265 Ga0207707_10849220 3300025912 Unclassified 758
266 Ga0207707_11037743 3300025912 Unclassified 671
267 Ga0207695_10007763 3300025913 Bacteria 13584
268 Ga0207695_10305910 3300025913 Bacteria 1480
269 Ga0207695_10729631 3300025913 Unclassified 871
270 Ga0207695_11336061 3300025913 Unclassified 597
271 Ga0207671_10021282 3300025914 Bacteria 4921
272 Ga0207671_10269840 3300025914 Bacteria 1340
273 Ga0207671_10379654 3300025914 Bacteria 1123
274 Ga0207671_10888226 3300025914 Unclassified 705
275 Ga0207663_10244982 3300025916 Unclassified 1316
276 Ga0207663_10359146 3300025916 Unclassified 1105
277 Ga0207663_10528394 3300025916 Unclassified 920
278 Ga0207663_10559773 3300025916 Unclassified 895
279 Ga0207660_11178766 3300025917 Unclassified 623
280 Ga0207657_10122631 3300025919 Bacteria 2137
281 Ga0207657_10160262 3300025919 Bacteria 1828
282 Ga0207649_10128675 3300025920 Bacteria 1717
283 Ga0207652_10104322 3300025921 Bacteria 2508
284 Ga0207652_10126928 3300025921 Bacteria 2273
285 Ga0207652_11398101 3300025921 Unclassified 603
286 Ga0207646_10013857 3300025922 Bacteria 7689
287 Ga0207694_10002729 3300025924 Bacteria 14280
288 Ga0207694_10018009 3300025924 Bacteria 5339
289 Ga0207694_10019068 3300025924 Bacteria 5184
290 Ga0207694_10356343 3300025924 Bacteria 1212
291 Ga0207694_10401147 3300025924 Unclassified 1140
292 Ga0207694_11056411 3300025924 Unclassified 687
293 Ga0207687_10000258 3300025927 Bacteria 36056
294 Ga0207687_10000662 3300025927 Bacteria 23202
295 Ga0207687_10329192 3300025927 Unclassified 1239
296 Ga0207687_10427072 3300025927 Bacteria 1095
297 Ga0207687_10597242 3300025927 Unclassified 930
298 Ga0207687_10731451 3300025927 Unclassified 841
299 Ga0207687_10782177 3300025927 Unclassified 813
300 Ga0207687_10787431 3300025927 Unclassified 811
301 Ga0207687_10797286 3300025927 Unclassified 805
302 Ga0207700_10068995 3300025928 Bacteria 2711
303 Ga0207664_10423767 3300025929 Bacteria 1186
304 Ga0207690_10124232 3300025932 Bacteria 1879
305 Ga0207690_10445478 3300025932 Unclassified 1040
306 Ga0207706_11301577 3300025933 Bacteria 601
307 Ga0207686_10044947 3300025934 Bacteria 2715
308 Ga0207686_10069475 3300025934 Bacteria 2260
309 Ga0207686_10102873 3300025934 Bacteria 1910
310 Ga0207686_10127159 3300025934 Bacteria 1743
311 Ga0207686_10364781 3300025934 Bacteria 1091
312 Ga0207686_10971631 3300025934 Unclassified 688
313 Ga0207709_10089623 3300025935 Bacteria 2006
314 Ga0207709_10160604 3300025935 Bacteria 1567
315 Ga0207709_10259234 3300025935 Bacteria 1274
316 Ga0207709_11596679 3300025935 Unclassified 542
317 Ga0207704_10136570 3300025938 Bacteria 1708
318 Ga0207704_10159741 3300025938 Bacteria 1602
319 Ga0207704_11463165 3300025938 Unclassified 586
320 Ga0207665_10056742 3300025939 Bacteria 2644
321 Ga0207665_10202548 3300025939 Bacteria 1447
322 Ga0207711_10000618 3300025941 Bacteria 35771
323 Ga0207711_10028438 3300025941 Bacteria 4704
324 Ga0207711_10096599 3300025941 Bacteria 2608
325 Ga0207711_10453733 3300025941 Bacteria 1193
326 Ga0207711_11538145 3300025941 Unclassified 608
327 Ga0207689_10039928 3300025942 Bacteria 3885
328 Ga0207689_10200119 3300025942 Bacteria 1648
329 Ga0207689_10550289 3300025942 Unclassified 969
330 Ga0207689_10828790 3300025942 Bacteria 781
331 Ga0207661_10014771 3300025944 Bacteria 5729
332 Ga0207661_10021246 3300025944 Bacteria 4862
333 Ga0207661_10025170 3300025944 Bacteria 4522
334 Ga0207661_10081256 3300025944 Unclassified 2677
335 Ga0207661_10090755 3300025944 Bacteria 2544
336 Ga0207661_10349477 3300025944 Bacteria 1334
337 Ga0207661_10677416 3300025944 Bacteria 948
338 Ga0207661_11322542 3300025944 Unclassified 662
339 Ga0207679_10015047 3300025945 Bacteria 5101
340 Ga0207679_11360624 3300025945 Bacteria 651
341 Ga0207667_10003166 3300025949 Bacteria 20359
342 Ga0207667_10017775 3300025949 Bacteria 7997
343 Ga0207667_10136655 3300025949 Bacteria 2524
344 Ga0207667_10503842 3300025949 Unclassified 1228
345 Ga0207651_10004593 3300025960 Bacteria 6992
346 Ga0207651_10184944 3300025960 Bacteria 1657
347 Ga0207712_10022176 3300025961 Bacteria 4178
348 Ga0207712_10569519 3300025961 Bacteria 976
349 Ga0207712_10716867 3300025961 Bacteria 874
350 Ga0207712_10990145 3300025961 Bacteria 746
351 Ga0207668_10166285 3300025972 Unclassified 1725
352 Ga0207640_10142978 3300025981 Bacteria 1746
353 Ga0207658_11233579 3300025986 Bacteria 684
354 Ga0207677_10757589 3300026023 Unclassified 866
355 Ga0207677_10941965 3300026023 Unclassified 780
356 Ga0207677_12306475 3300026023 Unclassified 501
357 Ga0207703_10398233 3300026035 Bacteria 1277
358 Ga0207703_10405491 3300026035 Unclassified 1266
359 Ga0207702_10016951 3300026078 Bacteria 6029
360 Ga0207702_10115501 3300026078 Unclassified 2394
361 Ga0207702_10124972 3300026078 Bacteria 2308
362 Ga0207702_10199043 3300026078 Bacteria 1856
363 Ga0207702_10233084 3300026078 Bacteria 1722
364 Ga0207702_11214036 3300026078 Unclassified 748
365 Ga0207641_10213634 3300026088 Bacteria 1785
366 Ga0207641_10974337 3300026088 Unclassified 844
367 Ga0207641_11817213 3300026088 Unclassified 611
368 Ga0207648_10036287 3300026089 Bacteria 4342
369 Ga0207648_10080324 3300026089 Unclassified 2845
370 Ga0207648_10218208 3300026089 Bacteria 1695
371 Ga0207648_10566555 3300026089 Bacteria 1045
372 Ga0207676_10138474 3300026095 Unclassified 2080
373 Ga0207676_10158677 3300026095 Bacteria 1957
374 Ga0207676_10254724 3300026095 Bacteria 1582
375 Ga0207676_10477884 3300026095 Unclassified 1180
376 Ga0207674_10003538 3300026116 Bacteria 19078
377 Ga0207674_10058874 3300026116 Unclassified 3890
378 Ga0207674_10061166 3300026116 Bacteria 3806
379 Ga0207674_10072259 3300026116 Unclassified 3466
380 Ga0207675_100493423 3300026118 Bacteria 1218
381 Ga0207675_101733131 3300026118 Unclassified 644
382 Ga0207675_101874412 3300026118 Bacteria 618
383 Ga0207683_10066886 3300026121 Bacteria 3169
384 Ga0207698_10309744 3300026142 Bacteria 1474
385 Ga0207698_12026078 3300026142 Unclassified 590
386 Ga0210002_1017578 3300027617 Bacteria 1138
387 Ga0268266_10364250 3300028379 Bacteria 1361
388 Ga0268264_10076098 3300028381 Bacteria 2855
389 Ga0268264_10284080 3300028381 Bacteria 1551
390 Ga0268264_10621904 3300028381 Bacteria 1066
391 Ga0268264_10842936 3300028381 Bacteria 918
392 Ga0265340_10255880 3300031247 Unclassified 780
393 Ga0265339_10221987 3300031249 Bacteria 924
394 Ga0265314_10001181 3300031711 Bacteria 29983
395 Ga0307410_10586303 3300031852 Unclassified 928
396 Ga0307409_102267791 3300031995 Bacteria 572
397 Ga0307416_100153544 3300032002 Unclassified 2116
398 Ga0307411_10417044 3300032005 Unclassified 1114
399 Ga0373926_0263629 3300035083 Bacteria 669
400 Ga0373926_0289953 3300035083 Unclassified 638
401 Ga0373934_0004554 3300035086 Bacteria 5121
402 Ga0373934_0025188 3300035086 Bacteria 2303
403 Ga0373923_0014666 3300035111 Bacteria 2949
404 Ga0373923_0671888 3300035111 Unclassified 513
405 Ga0373936_0264657 3300035113 Unclassified 770
406 Ga0373954_0037286 3300035118 Bacteria 2259
407 Ga0373956_0037708 3300035119 Bacteria 2137
408 Ga0373957_0123849 3300035120 Unclassified 1048
409 Ga0373943_0023826 3300035170 Bacteria 2849
410 Ga0373943_0822302 3300035170 Unclassified 553
411 Ga0373946_0364073 3300035171 Unclassified 725
412 Ga0373955_0017311 3300035172 Bacteria 3565
413 Ga0373955_0069020 3300035172 Bacteria 1971
414 Ga0373955_0149012 3300035172 Bacteria 1376
415 Ga0373924_0098570 3300035410 Bacteria 1256
416 Ga0373935_0070174 3300035692 Bacteria 2258
417 Ga0373935_0186151 3300035692 Bacteria 1428
418 Ga0373927_0549060 3300035695 Unclassified 764
419 Ga0373927_0813955 3300035695 Bacteria 617
420 Ga0373933_0192418 3300035724 Unclassified 1303
421 Ga0373933_0311029 3300035724 Bacteria 1021
422 Ga0373933_0347393 3300035724 Unclassified 963
423 Ga0373933_0401238 3300035724 Bacteria 894
424 Ga0373933_0535870 3300035724 Bacteria 768
425 Ga0373933_1142251 3300035724 Unclassified 513
426 Ga0373947_0004793 3300035725 Bacteria 7919
427 Ga0373947_0207209 3300035725 Bacteria 1285
428 Ga0373937_0007723 3300036401 Bacteria 9321
429 Ga0373937_0031744 3300036401 Bacteria 4787
430 Ga0373937_0031887 3300036401 Unclassified 4777
431 Ga0373937_0056820 3300036401 Bacteria 3594
432 Ga0373937_1984591 3300036401 Unclassified 528
433 Ga0373925_0049234 3300037068 Bacteria 3141
434 Ga0373925_0090565 3300037068 Bacteria 2338
435 Ga0373925_0462047 3300037068 Bacteria 1040
436 Ga0373925_0618701 3300037068 Unclassified 892
437 Ga0373925_0668227 3300037068 Bacteria 856
438 Ga0436364_0185732 3300037853 Bacteria 15651
439 Ga0436365_0199959 3300039437 Bacteria 2991
440 Ga0436365_1162899 3300039437 Bacteria 872
441 Ga0436360_1141110 3300039438 Bacteria 816
442 Ga0451839_0592651 3300041496 Unclassified 550
443 Ga0495592_0008313 3300046454 Bacteria 7786
444 Ga0495629_0270619 3300046459 Bacteria 1167
445 Ga0495653_0373120 3300046463 Unclassified 913
446 Ga0495653_0622133 3300046463 Unclassified 662
447 Ga0495580_0038496 3300046472 Unclassified 3425
448 Ga0495580_0095014 3300046472 Unclassified 2074
449 Ga0495580_0108420 3300046472 Bacteria 1928
450 Ga0495580_0163846 3300046472 Bacteria 1538
451 Ga0495580_0889904 3300046472 Unclassified 573
452 Ga0495582_0008611 3300046473 Bacteria 5625
453 Ga0495582_0106375 3300046473 Bacteria 1574
454 Ga0495608_0698923 3300046511 Unclassified 603
455 Ga0495628_0603389 3300046516 Unclassified 784
456 Ga0495666_0380429 3300046526 Unclassified 635
457 Ga0495652_0409515 3300046529 Unclassified 958
458 Ga0495652_0679227 3300046529 Bacteria 695
459 Ga0495665_0138617 3300046531 Bacteria 1272
460 Ga0495586_0090442 3300046535 Bacteria 1690
461 Ga0495586_0215752 3300046535 Unclassified 1090
462 Ga0495587_0001830 3300046536 Bacteria 14181
463 Ga0495587_0059640 3300046536 Unclassified 2239
464 Ga0495587_0109273 3300046536 Bacteria 1589
465 Ga0495645_0488923 3300046543 Bacteria 771
466 Ga0495645_0807477 3300046543 Unclassified 562
467 Ga0495667_0015327 3300046559 Bacteria 5178
468 Ga0495634_0237024 3300046642 Bacteria 1120
469 Ga0495635_0760427 3300046663 Unclassified 626
470 Ga0495599_0117119 3300046678 Bacteria 1657
471 Ga0495599_0190397 3300046678 Unclassified 1262
472 Ga0495623_0146851 3300046679 Unclassified 1397
473 Ga0495669_0035831 3300046684 Unclassified 2192
474 Ga0495581_0123421 3300047315 Unclassified 1508
475 Ga0495581_0779603 3300047315 Unclassified 549
476 Ga0495636_0034489 3300047318 Bacteria 2083
477 Ga0495636_0175245 3300047318 Unclassified 971
478 Ga0495674_0357499 3300047319 Bacteria 1185
479 Ga0495674_0377742 3300047319 Bacteria 1147
480 Ga0495674_0430061 3300047319 Unclassified 1063
481 Ga0495675_0311030 3300047444 Bacteria 934
482 Ga0495684_0107667 3300047471 Bacteria 2105
483 Ga0495684_0467363 3300047471 Unclassified 873
484 Ga0495602_0056248 3300048088 Unclassified 3460
485 Ga0495602_0370968 3300048088 Bacteria 1028
486 Ga0496101_0969764 3300048904 Unclassified 669
487 Ga0496104_0151859 3300048907 Bacteria 2223
488 Ga0496104_0254566 3300048907 Bacteria 1668
489 Ga0496110_0561205 3300048913 Unclassified 1037
490 Ga0496112_0264343 3300048915 Bacteria 1670
491 Ga0496112_1320349 3300048915 Unclassified 637
492 nmdc:mga05p37_54758_c1 3300050507 Unclassified 4907
493 nmdc:mga0qj67_132573_c1 3300050509 Bacteria 2018
494 nmdc:mga06r32_46556_c1 3300050510 Bacteria 4139
495 nmdc:mga08y16_1888668_c1 3300050511 Bacteria 548
496 nmdc:mga0n895_125068_c1 3300050512 Bacteria 2595
497 nmdc:mga0rr50_87650_c1 3300050513 Bacteria 2416
498 nmdc:mga08x19_512975_c1 3300050514 Unclassified 847
499 nmdc:mga0a205_775740_c1 3300050515 Unclassified 807
500 Ga0495601_0329144 3300053077 Bacteria 994
501 Ga0495612_0041392 3300053078 Bacteria 1879
502 Ga0495619_0356834 3300053085 Unclassified 1011
503 Ga0495619_0868191 3300053085 Bacteria 608
504 Ga0587079_049869 3300059647 Unclassified 875
505 Ga0587111_0057834 3300060346 Unclassified 873
506 Ga0070697_100240822
507 MRS1b_contig_4789590
508 Ga0065712_10070746
509 Ga0070658_11453102
510 Ga0070683_100000301
511 Ga0070683_100000322
512 Ga0070683_100010076
513 Ga0070683_100181740
514 Ga0070683_100228195
515 Ga0070683_100235153
516 Ga0070683_100842761
517 Ga0070690_101366167
518 Ga0068869_100036042
519 Ga0068869_100061874
520 Ga0068869_100636377
521 Ga0070666_11335938
522 Ga0070682_100488733
523 Ga0068868_100269837
524 Ga0068868_101251099
525 Ga0070660_100111883
526 Ga0070689_100545500
527 Ga0070661_101387303
528 Ga0070669_101460829
529 Ga0070688_100207411
530 Ga0070659_100088807
531 Ga0070659_101002208
532 Ga0070709_10014001
533 Ga0070714_100159959
534 Ga0070713_100197498
535 Ga0070713_101158596
536 Ga0070710_10465365
537 Ga0070710_10914694
538 Ga0070711_100006148
539 Ga0070711_100059432
540 Ga0070711_100136965
541 Ga0070711_100684666
542 Ga0070711_101245614
543 Ga0070708_100010686
544 Ga0070708_100891811
545 Ga0070678_100100224
546 Ga0070678_100928380
547 Ga0070662_101488820
548 Ga0070681_10121829
549 Ga0070681_10743039
550 Ga0070681_11131641
551 Ga0068867_100070693
552 Ga0068867_101902941
553 Ga0070707_100110694
554 Ga0070699_100013163
555 Ga0070699_100550431
556 Ga0070679_100139418
557 Ga0070679_102026070
558 Ga0070684_100005837
559 Ga0070684_100174523
560 Ga0070697_100056408
561 Ga0070695_100186820
562 Ga0070696_100339190
563 Ga0070693_100036539
564 Ga0070665_100488352
565 Ga0068855_100005296
566 Ga0068855_100234896
567 Ga0068855_100743709
568 Ga0070664_100097103
569 Ga0070664_100146834
570 Ga0068857_100006360
571 Ga0068857_100058196
572 Ga0068857_100567248
573 Ga0068857_101699015
574 Ga0068854_100092633
575 Ga0068856_100001168
576 Ga0068856_100019210
577 Ga0068856_100124555
578 Ga0068856_100130937
579 Ga0068856_100158300
580 Ga0068856_100170502
581 Ga0068856_100207491
582 Ga0068856_101270824
583 Ga0068852_100837215
584 Ga0068859_100150144
585 Ga0068864_100238168
586 Ga0068864_100318127
587 Ga0068864_100624944
588 Ga0068864_100932191
589 Ga0068866_11182868
590 Ga0068861_100678186
591 Ga0068861_102122522
592 Ga0068863_100054204
593 Ga0068863_100888369
594 Ga0068863_101811742
595 Ga0068863_101842668
596 Ga0068860_100052936
597 Ga0068860_100193632
598 Ga0068862_102480719
599 Ga0070716_100184572
600 Ga0070716_100203852
601 Ga0070716_101064623
602 Ga0097621_100026422
603 Ga0097621_100038898
604 Ga0097621_100063559
605 Ga0097621_101537731
606 Ga0068871_100083742
607 Ga0068871_100090833
608 Ga0068871_100105736
609 Ga0068871_100132052
610 Ga0068871_101725362
611 Ga0068871_102240812
612 Ga0075428_101023539
613 Ga0075430_100116603
614 Ga0075431_100048956
615 Ga0075433_10481973
616 Ga0075434_100132381
617 Ga0075434_100249912
618 Ga0075434_101248807
619 Ga0068865_100119849
620 Ga0068865_100284916
621 Ga0068865_101685475
622 Ga0075436_100552844
623 Ga0075436_100906329
624 Ga0097620_100150152
625 Ga0097620_100563993
626 Ga0075435_100093332
627 Ga0099794_10118523
628 Ga0105240_10004258
629 Ga0105240_10031381
630 Ga0105240_10183794
631 Ga0105240_10219632
632 Ga0105240_11095644
633 Ga0105240_11841754
634 Ga0111539_10442277
635 Ga0105245_10001232
636 Ga0105245_10001357
637 Ga0105245_10003490
638 Ga0105245_10106227
639 Ga0105245_10349809
640 Ga0105245_10762342
641 Ga0105245_11166591
642 Ga0105245_11687347
643 Ga0105247_10725112
644 Ga0105247_11402132
645 Ga0114129_10176709
646 Ga0114129_10644110
647 Ga0114129_11211053
648 Ga0105243_10086566
649 Ga0105243_10522240
650 Ga0105243_10685005
651 Ga0105243_12154443
652 Ga0105241_10025024
653 Ga0105241_10067745
654 Ga0105241_10273147
655 Ga0105241_11028014
656 Ga0105242_10016652
657 Ga0105242_10033855
658 Ga0105242_10054397
659 Ga0105242_10075150
660 Ga0105242_10087441
661 Ga0105242_10090039
662 Ga0105242_10387387
663 Ga0105242_10697859
664 Ga0105242_10703359
665 Ga0105242_10726272
666 Ga0105242_11435427
667 Ga0105242_11832060
668 Ga0105248_10003760
669 Ga0105248_10024026
670 Ga0105248_10202264
671 Ga0105248_10244965
672 Ga0105248_10484390
673 Ga0105248_12123343
674 Ga0105237_10011512
675 Ga0105237_10011725
676 Ga0105237_10094028
677 Ga0105237_10455322
678 Ga0105237_10764291
679 Ga0105238_10002029
680 Ga0105238_10003498
681 Ga0105238_10019404
682 Ga0105238_10039898
683 Ga0105238_10099408
684 Ga0105238_11392734
685 Ga0105249_10032352
686 Ga0105249_10135442
687 Ga0105249_10463919
688 Ga0105239_10002231
689 Ga0105239_10031315
690 Ga0105239_10138165
691 Ga0105239_10265745
692 Ga0105239_11587637
693 Ga0105246_10005560
694 Ga0105246_10101824
695 Ga0105246_10985195
696 Ga0105246_11793514
697 Ga0157373_10662480
698 Ga0157371_10106575
699 Ga0157370_10005280
700 Ga0157370_10005951
701 Ga0157370_10159389
702 Ga0157370_10572167
703 Ga0157369_10002434
704 Ga0157369_10005041
705 Ga0157369_10030934
706 Ga0157369_10490339
707 Ga0157369_10612117
708 Ga0157369_10757811
709 Ga0157374_10016401
710 Ga0157374_10142485
711 Ga0157378_10004821
712 Ga0157378_10092662
713 Ga0157378_10259517
714 Ga0157378_10304740
715 Ga0157378_11381165
716 Ga0157378_11627047
717 Ga0157378_11916808
718 Ga0163162_10206286
719 Ga0163162_10288329
720 Ga0163162_10703382
721 Ga0163162_10836701
722 Ga0163162_12251748
723 Ga0157372_10040545
724 Ga0157372_10057288
725 Ga0157372_10174869
726 Ga0157372_10321048
727 Ga0157372_10487768
728 Ga0157372_10655478
729 Ga0157375_10048447
730 Ga0157375_10071075
731 Ga0157375_11129381
732 Ga0163163_10035419
733 Ga0163163_10063346
734 Ga0163163_10476328
735 Ga0163163_10791039
736 Ga0163163_10866736
737 Ga0163163_10904091
738 Ga0163163_11078390
739 Ga0163163_11320579
740 Ga0157380_10231592
741 Ga0157377_10419132
742 Ga0157379_10029212
743 Ga0157379_10854763
744 Ga0157379_11751932
745 Ga0157376_10035155
746 Ga0157376_10119162
747 Ga0157376_10353470
748 Ga0157376_11253289
749 Ga0157376_11774207
750 Ga0163161_10214137
751 Ga0197907_10941983
752 Ga0206356_11270769
753 Ga0206349_1330173
754 Ga0206350_11043932
755 Ga0213875_10027409
756 Ga0224712_10050058
757 Ga0224712_10101185
758 Ga0207642_10528863
759 Ga0207680_10335485
760 Ga0207699_10106109
761 Ga0207645_10332830
762 Ga0207645_11014833
763 Ga0207654_10015698
764 Ga0207654_10034751
765 Ga0207654_10066714
766 Ga0207654_10570893
767 Ga0207654_10587728
768 Ga0207707_10000565
769 Ga0207707_10077877
770 Ga0207707_10849220
771 Ga0207707_11037743
772 Ga0207695_10007763
773 Ga0207695_10305910
774 Ga0207695_10729631
775 Ga0207695_11336061
776 Ga0207671_10021282
777 Ga0207671_10269840
778 Ga0207671_10379654
779 Ga0207671_10888226
780 Ga0207663_10244982
781 Ga0207663_10359146
782 Ga0207663_10528394
783 Ga0207663_10559773
784 Ga0207660_11178766
785 Ga0207657_10122631
786 Ga0207657_10160262
787 Ga0207649_10128675
788 Ga0207652_10104322
789 Ga0207652_10126928
790 Ga0207652_11398101
791 Ga0207646_10013857
792 Ga0207694_10002729
793 Ga0207694_10018009
794 Ga0207694_10019068
795 Ga0207694_10356343
796 Ga0207694_10401147
797 Ga0207694_11056411
798 Ga0207687_10000258
799 Ga0207687_10000662
800 Ga0207687_10329192
801 Ga0207687_10427072
802 Ga0207687_10597242
803 Ga0207687_10731451
804 Ga0207687_10782177
805 Ga0207687_10787431
806 Ga0207687_10797286
807 Ga0207700_10068995
808 Ga0207664_10423767
809 Ga0207690_10124232
810 Ga0207690_10445478
811 Ga0207706_11301577
812 Ga0207686_10044947
813 Ga0207686_10069475
814 Ga0207686_10102873
815 Ga0207686_10127159
816 Ga0207686_10364781
817 Ga0207686_10971631
818 Ga0207709_10089623
819 Ga0207709_10160604
820 Ga0207709_10259234
821 Ga0207709_11596679
822 Ga0207704_10136570
823 Ga0207704_10159741
824 Ga0207704_11463165
825 Ga0207665_10056742
826 Ga0207665_10202548
827 Ga0207711_10000618
828 Ga0207711_10028438
829 Ga0207711_10096599
830 Ga0207711_10453733
831 Ga0207711_11538145
832 Ga0207689_10039928
833 Ga0207689_10200119
834 Ga0207689_10550289
835 Ga0207689_10828790
836 Ga0207661_10014771
837 Ga0207661_10021246
838 Ga0207661_10025170
839 Ga0207661_10081256
840 Ga0207661_10090755
841 Ga0207661_10349477
842 Ga0207661_10677416
843 Ga0207661_11322542
844 Ga0207679_10015047
845 Ga0207679_11360624
846 Ga0207667_10003166
847 Ga0207667_10017775
848 Ga0207667_10136655
849 Ga0207667_10503842
850 Ga0207651_10004593
851 Ga0207651_10184944
852 Ga0207712_10022176
853 Ga0207712_10569519
854 Ga0207712_10716867
855 Ga0207712_10990145
856 Ga0207668_10166285
857 Ga0207640_10142978
858 Ga0207658_11233579
859 Ga0207677_10757589
860 Ga0207677_10941965
861 Ga0207677_12306475
862 Ga0207703_10398233
863 Ga0207703_10405491
864 Ga0207702_10016951
865 Ga0207702_10115501
866 Ga0207702_10124972
867 Ga0207702_10199043
868 Ga0207702_10233084
869 Ga0207702_11214036
870 Ga0207641_10213634
871 Ga0207641_10974337
872 Ga0207641_11817213
873 Ga0207648_10036287
874 Ga0207648_10080324
875 Ga0207648_10218208
876 Ga0207648_10566555
877 Ga0207676_10138474
878 Ga0207676_10158677
879 Ga0207676_10254724
880 Ga0207676_10477884
881 Ga0207674_10003538
882 Ga0207674_10058874
883 Ga0207674_10061166
884 Ga0207674_10072259
885 Ga0207675_100493423
886 Ga0207675_101733131
887 Ga0207675_101874412
888 Ga0207683_10066886
889 Ga0207698_10309744
890 Ga0207698_12026078
891 Ga0210002_1017578
892 Ga0268266_10364250
893 Ga0268264_10076098
894 Ga0268264_10284080
895 Ga0268264_10621904
896 Ga0268264_10842936
897 Ga0265340_10255880
898 Ga0265339_10221987
899 Ga0265314_10001181
900 Ga0307410_10586303
901 Ga0307409_102267791
902 Ga0307416_100153544
903 Ga0307411_10417044
904 Ga0373926_0263629
905 Ga0373926_0289953
906 Ga0373934_0004554
907 Ga0373934_0025188
908 Ga0373923_0014666
909 Ga0373923_0671888
910 Ga0373936_0264657
911 Ga0373954_0037286
912 Ga0373956_0037708
913 Ga0373957_0123849
914 Ga0373943_0023826
915 Ga0373943_0822302
916 Ga0373946_0364073
917 Ga0373955_0017311
918 Ga0373955_0069020
919 Ga0373955_0149012
920 Ga0373924_0098570
921 Ga0373935_0070174
922 Ga0373935_0186151
923 Ga0373927_0549060
924 Ga0373927_0813955
925 Ga0373933_0192418
926 Ga0373933_0311029
927 Ga0373933_0347393
928 Ga0373933_0401238
929 Ga0373933_0535870
930 Ga0373933_1142251
931 Ga0373947_0004793
932 Ga0373947_0207209
933 Ga0373937_0007723
934 Ga0373937_0031744
935 Ga0373937_0031887
936 Ga0373937_0056820
937 Ga0373937_1984591
938 Ga0373925_0049234
939 Ga0373925_0090565
940 Ga0373925_0462047
941 Ga0373925_0618701
942 Ga0373925_0668227
943 Ga0436364_0185732
944 Ga0436365_0199959
945 Ga0436365_1162899
946 Ga0436360_1141110
947 Ga0451839_0592651
948 Ga0495592_0008313
949 Ga0495629_0270619
950 Ga0495653_0373120
951 Ga0495653_0622133
952 Ga0495580_0038496
953 Ga0495580_0095014
954 Ga0495580_0108420
955 Ga0495580_0163846
956 Ga0495580_0889904
957 Ga0495582_0008611
958 Ga0495582_0106375
959 Ga0495608_0698923
960 Ga0495628_0603389
961 Ga0495666_0380429
962 Ga0495652_0409515
963 Ga0495652_0679227
964 Ga0495665_0138617
965 Ga0495586_0090442
966 Ga0495586_0215752
967 Ga0495587_0001830
968 Ga0495587_0059640
969 Ga0495587_0109273
970 Ga0495645_0488923
971 Ga0495645_0807477
972 Ga0495667_0015327
973 Ga0495634_0237024
974 Ga0495635_0760427
975 Ga0495599_0117119
976 Ga0495599_0190397
977 Ga0495623_0146851
978 Ga0495669_0035831
979 Ga0495581_0123421
980 Ga0495581_0779603
981 Ga0495636_0034489
982 Ga0495636_0175245
983 Ga0495674_0357499
984 Ga0495674_0377742
985 Ga0495674_0430061
986 Ga0495675_0311030
987 Ga0495684_0107667
988 Ga0495684_0467363
989 Ga0495602_0056248
990 Ga0495602_0370968
991 Ga0496101_0969764
992 Ga0496104_0151859
993 Ga0496104_0254566
994 Ga0496110_0561205
995 Ga0496112_0264343
996 Ga0496112_1320349
997 nmdc:mga05p37_54758_c1
998 nmdc:mga0qj67_132573_c1
999 nmdc:mga06r32_46556_c1
1000 nmdc:mga08y16_1888668_c1
1001 nmdc:mga0n895_125068_c1
1002 nmdc:mga0rr50_87650_c1
1003 nmdc:mga08x19_512975_c1
1004 nmdc:mga0a205_775740_c1
1005 Ga0495601_0329144
1006 Ga0495612_0041392
1007 Ga0495619_0356834
1008 Ga0495619_0868191
1009 Ga0587079_049869
1010 Ga0587111_0057834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qhs-assembly1.cif.gz_F s. cerevisiae cmge nucleating origin dna melting 0.7607 18 105
6hv9-assembly1.cif.gz_B s. cerevisiae cmg-pol epsilon-dna 0.7353 60 106
5doi-assembly4.cif.gz_H crystal structure of tetrahymena p45n and p19 0.7323 18 108
7pmk-assembly1.cif.gz_R s. cerevisiae replisome-scf(dia2) complex bound to double-stranded dna (conformation i) 0.7322 18 104
6lbu-assembly1.cif.gz_A crystal structure of yeast stn1 and ten1 0.7171 59 108
ID Description Score Start End Superfamily
af_P24482_161_348_3.60.21.50 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2; 0.7761 18 106 3.60.21.50
af_Q8I579_162_322_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7567 16 106 2.40.50.140
af_Q5SV06_230_347_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7374 59 108 2.40.50.140
4gopA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7116 18 108 2.40.50.140
af_Q5APD5_1_109_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7002 18 108 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V8CER5-F1-model_v4 Uncharacterized protein 0.9942 42 108
AF-A0A2V8CER5-F1-model_v4 Uncharacterized protein 0.9797 42 108
AF-A0A800K746-F1-model_v4 OB domain-containing protein 0.979 15 108
AF-A0A2V9J5D7-F1-model_v4 DUF5666 domain-containing protein 0.9607 47 107
AF-A0A7X4I3L0-F1-model_v4 DUF5666 domain-containing protein 0.951 1 108

Map