F456313

General Info

Members Datasets Scaffolds Average Seq Length
505 237 1010 141

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100007818|Ga0068868_1000078186
Length 161
Sequence VQYSNGCPKDSDELDRREPSHAVKPRITLITLGVDDLERAVAFYRDGLGFETKGIVGAELENGAVAFFNLESGLKLALWPRKSLAADSGLPQRAGSGDFSLAHNVASQPEVDAVMQQAEHAGAHVVKPAQPTFYGGYAGYFQDPDGHLWEVAFNPGFASLG

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
182 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
183 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
214 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
222 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.16
Nodule 0
Rhizoplane 4.16
Rhizosphere 90.89
Stem 0
Stem Tuber 0
Unclassified 7.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100007818 3300005338 Bacteria 7633
2 rootH2_10086604 3300003320 Bacteria 1199
3 Ga0065712_10130158 3300005290 Bacteria 1559
4 Ga0070658_10306709 3300005327 Bacteria 1354
5 Ga0070658_10343464 3300005327 Unclassified 1277
6 Ga0070676_10007664 3300005328 Bacteria 5797
7 Ga0070676_10032313 3300005328 Bacteria 2998
8 Ga0070676_10167153 3300005328 Bacteria 1420
9 Ga0070676_11432350 3300005328 Bacteria 531
10 Ga0070683_100358779 3300005329 Bacteria 1388
11 Ga0070690_100210708 3300005330 Bacteria 1357
12 Ga0070670_100052905 3300005331 Bacteria 3487
13 Ga0070670_100081634 3300005331 Bacteria 2777
14 Ga0070670_100132951 3300005331 Bacteria 2149
15 Ga0070670_100133090 3300005331 Bacteria 2148
16 Ga0070670_100489861 3300005331 Bacteria 1092
17 Ga0070670_100695359 3300005331 Bacteria 914
18 Ga0070670_100929490 3300005331 Unclassified 789
19 Ga0070677_10009100 3300005333 Bacteria 3362
20 Ga0068869_100009372 3300005334 Bacteria 6354
21 Ga0068869_100053042 3300005334 Bacteria 2946
22 Ga0070666_10001388 3300005335 Bacteria 14648
23 Ga0070666_10092976 3300005335 Bacteria 2074
24 Ga0070666_10242269 3300005335 Bacteria 1275
25 Ga0070680_100169446 3300005336 Bacteria 1837
26 Ga0068868_100000704 3300005338 Bacteria 22474
27 Ga0068868_100025209 3300005338 Bacteria 4519
28 Ga0068868_100101912 3300005338 Bacteria 2324
29 Ga0070660_100370508 3300005339 Bacteria 1181
30 Ga0070689_100140596 3300005340 Bacteria 1941
31 Ga0070689_100438293 3300005340 Bacteria 1110
32 Ga0070687_100046103 3300005343 Bacteria 2230
33 Ga0070692_10497784 3300005345 Bacteria 789
34 Ga0070668_100000682 3300005347 Bacteria 23141
35 Ga0070668_100128195 3300005347 Bacteria 2034
36 Ga0070668_100153171 3300005347 Bacteria 1866
37 Ga0070669_100001716 3300005353 Bacteria 15868
38 Ga0070669_100124273 3300005353 Bacteria 1973
39 Ga0070669_100198998 3300005353 Bacteria 1575
40 Ga0070675_100000870 3300005354 Bacteria 21464
41 Ga0070675_100008766 3300005354 Bacteria 7857
42 Ga0070675_100030341 3300005354 Bacteria 4365
43 Ga0070675_100079810 3300005354 Bacteria 2727
44 Ga0070675_100449455 3300005354 Unclassified 1155
45 Ga0070675_100897842 3300005354 Bacteria 812
46 Ga0070671_100000917 3300005355 Bacteria 21513
47 Ga0070671_100003475 3300005355 Bacteria 12292
48 Ga0070671_100030989 3300005355 Bacteria 4415
49 Ga0070671_100091693 3300005355 Bacteria 2545
50 Ga0070674_100004651 3300005356 Bacteria 7841
51 Ga0070674_100080183 3300005356 Bacteria 2330
52 Ga0070674_100340680 3300005356 Bacteria 1208
53 Ga0070674_100440596 3300005356 Unclassified 1073
54 Ga0070674_100673559 3300005356 Bacteria 881
55 Ga0070674_101572688 3300005356 Bacteria 592
56 Ga0070673_100022082 3300005364 Bacteria 4627
57 Ga0070673_100481571 3300005364 Bacteria 1120
58 Ga0070673_100552093 3300005364 Bacteria 1046
59 Ga0070688_100060128 3300005365 Bacteria 2399
60 Ga0070688_100968270 3300005365 Bacteria 674
61 Ga0070688_101563212 3300005365 Bacteria 538
62 Ga0070659_100156387 3300005366 Bacteria 1862
63 Ga0070667_100003490 3300005367 Bacteria 13399
64 Ga0070667_100208344 3300005367 Bacteria 1737
65 Ga0070667_100223121 3300005367 Bacteria 1678
66 Ga0070667_100331082 3300005367 Bacteria 1376
67 Ga0070709_10802444 3300005434 Bacteria 739
68 Ga0070701_10168517 3300005438 Bacteria 1274
69 Ga0070701_10228175 3300005438 Unclassified 1114
70 Ga0070701_10786762 3300005438 Bacteria 648
71 Ga0070711_102067376 3300005439 Bacteria 501
72 Ga0070700_100649430 3300005441 Unclassified 833
73 Ga0070694_100302045 3300005444 Bacteria 1227
74 Ga0070694_101128079 3300005444 Unclassified 655
75 Ga0070708_100000034 3300005445 Bacteria 86359
76 Ga0070708_100094564 3300005445 Bacteria 2727
77 Ga0070663_100396518 3300005455 Bacteria 1127
78 Ga0070678_100019429 3300005456 Bacteria 4429
79 Ga0070678_100043549 3300005456 Bacteria 3198
80 Ga0070678_100152323 3300005456 Unclassified 1864
81 Ga0070678_100220063 3300005456 Bacteria 1578
82 Ga0070678_100346516 3300005456 Bacteria 1276
83 Ga0070678_100549352 3300005456 Bacteria 1025
84 Ga0070662_100001421 3300005457 Bacteria 14771
85 Ga0070662_100156807 3300005457 Bacteria 1778
86 Ga0070662_100301849 3300005457 Bacteria 1301
87 Ga0070681_10978323 3300005458 Unclassified 766
88 Ga0068867_100023575 3300005459 Bacteria 4406
89 Ga0068867_100051199 3300005459 Bacteria 3045
90 Ga0068867_100101970 3300005459 Bacteria 2193
91 Ga0068867_100302602 3300005459 Bacteria 1319
92 Ga0068867_102039707 3300005459 Bacteria 543
93 Ga0070685_10378368 3300005466 Bacteria 975
94 Ga0070685_10408155 3300005466 Bacteria 942
95 Ga0070685_11309244 3300005466 Bacteria 554
96 Ga0070706_100339887 3300005467 Bacteria 1400
97 Ga0070706_100568956 3300005467 Bacteria 1054
98 Ga0070707_100003426 3300005468 Bacteria 14995
99 Ga0070698_100882625 3300005471 Unclassified 840
100 Ga0070699_100085088 3300005518 Bacteria 2759
101 Ga0070699_100518976 3300005518 Bacteria 1083
102 Ga0070679_100317841 3300005530 Bacteria 1506
103 Ga0070679_100376905 3300005530 Bacteria 1365
104 Ga0070679_100575758 3300005530 Unclassified 1070
105 Ga0070684_100262261 3300005535 Bacteria 1581
106 Ga0070697_100402710 3300005536 Unclassified 1188
107 Ga0068853_100128999 3300005539 Bacteria 2262
108 Ga0068853_100333790 3300005539 Bacteria 1407
109 Ga0070672_100001295 3300005543 Bacteria 15400
110 Ga0070672_100047433 3300005543 Bacteria 3334
111 Ga0070672_100276119 3300005543 Bacteria 1420
112 Ga0070672_100364845 3300005543 Bacteria 1233
113 Ga0070672_100620680 3300005543 Bacteria 943
114 Ga0070686_100151812 3300005544 Bacteria 1623
115 Ga0070686_100687792 3300005544 Unclassified 814
116 Ga0070696_100013382 3300005546 Bacteria 5503
117 Ga0070696_100199241 3300005546 Bacteria 1494
118 Ga0070696_100414137 3300005546 Bacteria 1057
119 Ga0070696_100745547 3300005546 Bacteria 802
120 Ga0070693_101244252 3300005547 Unclassified 573
121 Ga0070665_100113775 3300005548 Bacteria 2709
122 Ga0070704_101154441 3300005549 Bacteria 705
123 Ga0070704_101582398 3300005549 Bacteria 604
124 Ga0070704_102092339 3300005549 Bacteria 526
125 Ga0070664_100039490 3300005564 Bacteria 3977
126 Ga0070702_100202244 3300005615 Bacteria 1316
127 Ga0070702_100534482 3300005615 Unclassified 867
128 Ga0070702_100773198 3300005615 Unclassified 740
129 Ga0068852_100006556 3300005616 Bacteria 8423
130 Ga0068852_100024651 3300005616 Bacteria 4865
131 Ga0068852_100035837 3300005616 Bacteria 4144
132 Ga0068859_100059743 3300005617 Bacteria 3841
133 Ga0068859_100081610 3300005617 Bacteria 3276
134 Ga0068859_100083503 3300005617 Bacteria 3237
135 Ga0068859_100856367 3300005617 Bacteria 995
136 Ga0068864_100012872 3300005618 Bacteria 6920
137 Ga0068864_100019672 3300005618 Bacteria 5647
138 Ga0068864_100034800 3300005618 Bacteria 4286
139 Ga0068864_100169531 3300005618 Bacteria 1989
140 Ga0068864_100462417 3300005618 Bacteria 1215
141 Ga0068866_10061914 3300005718 Bacteria 1945
142 Ga0068866_10180476 3300005718 Bacteria 1247
143 Ga0068861_100004066 3300005719 Bacteria 9799
144 Ga0068861_100876139 3300005719 Bacteria 848
145 Ga0068851_10126631 3300005834 Unclassified 1378
146 Ga0068851_10563675 3300005834 Bacteria 689
147 Ga0068870_10018402 3300005840 Bacteria 3373
148 Ga0068863_100008911 3300005841 Bacteria 9795
149 Ga0068863_100013698 3300005841 Bacteria 7819
150 Ga0068863_100037783 3300005841 Bacteria 4595
151 Ga0068863_100049857 3300005841 Bacteria 3970
152 Ga0068863_100094165 3300005841 Bacteria 2843
153 Ga0068858_100003840 3300005842 Bacteria 14854
154 Ga0068858_100014301 3300005842 Bacteria 7483
155 Ga0068858_101150514 3300005842 Bacteria 762
156 Ga0068858_101228142 3300005842 Bacteria 737
157 Ga0068858_101895938 3300005842 Bacteria 589
158 Ga0068860_100001826 3300005843 Bacteria 22678
159 Ga0068860_100199708 3300005843 Bacteria 1937
160 Ga0068860_100267512 3300005843 Bacteria 1668
161 Ga0068860_100503718 3300005843 Bacteria 1209
162 Ga0068862_100540899 3300005844 Bacteria 1111
163 Ga0081539_10075348 3300005985 Bacteria 1793
164 Ga0075368_10168175 3300006042 Bacteria 921
165 Ga0075363_100101626 3300006048 Bacteria 1591
166 Ga0075364_10081852 3300006051 Bacteria 2135
167 Ga0075364_10464873 3300006051 Bacteria 864
168 Ga0070715_10058328 3300006163 Bacteria 1685
169 Ga0070716_100010801 3300006173 Bacteria 4590
170 Ga0070716_100128961 3300006173 Bacteria 1596
171 Ga0075366_10002380 3300006195 Bacteria 9642
172 Ga0075366_10007251 3300006195 Bacteria 6112
173 Ga0075366_10010565 3300006195 Bacteria 5182
174 Ga0075366_10132077 3300006195 Bacteria 1507
175 Ga0075366_10146625 3300006195 Bacteria 1428
176 Ga0075366_10244177 3300006195 Bacteria 1095
177 Ga0075366_10591405 3300006195 Bacteria 688
178 Ga0097621_100010530 3300006237 Bacteria 6773
179 Ga0097621_100163223 3300006237 Bacteria 1916
180 Ga0097621_100229060 3300006237 Bacteria 1622
181 Ga0097621_100278058 3300006237 Bacteria 1473
182 Ga0097621_100648954 3300006237 Bacteria 968
183 Ga0097621_100736135 3300006237 Unclassified 910
184 Ga0068871_100003479 3300006358 Bacteria 10818
185 Ga0068871_100007269 3300006358 Bacteria 7900
186 Ga0068871_100048661 3300006358 Bacteria 3423
187 Ga0068871_100166253 3300006358 Bacteria 1888
188 Ga0075428_101358406 3300006844 Bacteria 746
189 Ga0075430_100031374 3300006846 Bacteria 4510
190 Ga0075433_10005827 3300006852 Bacteria 9702
191 Ga0075433_10522439 3300006852 Bacteria 1044
192 Ga0075434_100009949 3300006871 Bacteria 8898
193 Ga0075434_100026543 3300006871 Bacteria 5676
194 Ga0075434_101052323 3300006871 Bacteria 827
195 Ga0075434_102375718 3300006871 Unclassified 532
196 Ga0075429_100007863 3300006880 Bacteria 9261
197 Ga0068865_100000599 3300006881 Bacteria 20236
198 Ga0075436_100000152 3300006914 Bacteria 42960
199 Ga0075436_100690786 3300006914 Bacteria 755
200 Ga0097620_100059743 3300006931 Bacteria 3841
201 Ga0097620_100081610 3300006931 Bacteria 3276
202 Ga0097620_100083502 3300006931 Bacteria 3237
203 Ga0097620_100856196 3300006931 Bacteria 995
204 Ga0099794_10123405 3300007265 Bacteria 1305
205 Ga0105240_10005216 3300009093 Bacteria 19440
206 Ga0111539_10344200 3300009094 Bacteria 1735
207 Ga0111539_10404518 3300009094 Bacteria 1590
208 Ga0111539_10601630 3300009094 Bacteria 1280
209 Ga0105245_10054076 3300009098 Bacteria 3605
210 Ga0105245_10387395 3300009098 Bacteria 1393
211 Ga0105245_10865057 3300009098 Bacteria 944
212 Ga0105247_11040400 3300009101 Bacteria 642
213 Ga0105243_10002376 3300009148 Bacteria 15759
214 Ga0105242_10029448 3300009176 Bacteria 4379
215 Ga0105242_10415225 3300009176 Bacteria 1259
216 Ga0105242_10420800 3300009176 Bacteria 1252
217 Ga0105242_10696078 3300009176 Bacteria 994
218 Ga0105248_10001312 3300009177 Bacteria 27697
219 Ga0105248_10009844 3300009177 Bacteria 10530
220 Ga0105248_10017166 3300009177 Bacteria 7974
221 Ga0105248_10049840 3300009177 Bacteria 4695
222 Ga0105248_10060701 3300009177 Bacteria 4245
223 Ga0105237_10003588 3300009545 Bacteria 18362
224 Ga0105237_10464638 3300009545 Bacteria 1271
225 Ga0105238_10111288 3300009551 Bacteria 2719
226 Ga0105249_10008572 3300009553 Bacteria 8916
227 Ga0105249_12490040 3300009553 Bacteria 590
228 Ga0105239_10003774 3300010375 Bacteria 18433
229 Ga0105246_10261426 3300011119 Bacteria 1379
230 Ga0105246_10283521 3300011119 Bacteria 1330
231 Ga0157373_10087378 3300013100 Bacteria 2197
232 Ga0157371_10976206 3300013102 Bacteria 645
233 Ga0157371_11283089 3300013102 Unclassified 566
234 Ga0157369_10579406 3300013105 Bacteria 1159
235 Ga0157374_10447592 3300013296 Bacteria 1293
236 Ga0157378_10003505 3300013297 Bacteria 13919
237 Ga0157378_10093956 3300013297 Bacteria 2730
238 Ga0157378_10100548 3300013297 Bacteria 2640
239 Ga0157378_10167362 3300013297 Bacteria 2059
240 Ga0163162_10077043 3300013306 Bacteria 3398
241 Ga0163162_10079920 3300013306 Bacteria 3336
242 Ga0163162_10261837 3300013306 Unclassified 1861
243 Ga0163162_11085498 3300013306 Bacteria 907
244 Ga0157375_10063099 3300013308 Bacteria 3684
245 Ga0157375_10802160 3300013308 Bacteria 1090
246 Ga0163163_10031947 3300014325 Bacteria 5084
247 Ga0163163_10525649 3300014325 Bacteria 1245
248 Ga0163163_12718265 3300014325 Bacteria 552
249 Ga0157380_10275916 3300014326 Unclassified 1535
250 Ga0157380_10398946 3300014326 Bacteria 1304
251 Ga0157380_10494026 3300014326 Bacteria 1187
252 Ga0157379_10002348 3300014968 Bacteria 15791
253 Ga0157379_10002864 3300014968 Bacteria 14545
254 Ga0157379_10058992 3300014968 Bacteria 3432
255 Ga0157379_10301542 3300014968 Bacteria 1460
256 Ga0157379_11765693 3300014968 Bacteria 607
257 Ga0157376_10008212 3300014969 Bacteria 7514
258 Ga0157376_10044710 3300014969 Bacteria 3641
259 Ga0157376_11192123 3300014969 Bacteria 789
260 Ga0157376_12140522 3300014969 Bacteria 598
261 Ga0163161_10226621 3300017792 Bacteria 1449
262 Ga0163161_11247047 3300017792 Bacteria 644
263 Ga0209051_1001780 3300025303 Bacteria 17093
264 Ga0207697_10010359 3300025315 Bacteria 3989
265 Ga0207656_10332204 3300025321 Bacteria 756
266 Ga0207682_10012139 3300025893 Bacteria 3364
267 Ga0207642_10004657 3300025899 Bacteria 4431
268 Ga0207642_10297413 3300025899 Bacteria 934
269 Ga0207680_10025886 3300025903 Bacteria 3242
270 Ga0207680_10116614 3300025903 Bacteria 1740
271 Ga0207647_10368099 3300025904 Unclassified 813
272 Ga0207645_10014967 3300025907 Bacteria 5169
273 Ga0207645_10019213 3300025907 Bacteria 4483
274 Ga0207645_10184087 3300025907 Bacteria 1371
275 Ga0207705_10150042 3300025909 Bacteria 1746
276 Ga0207707_10241216 3300025912 Bacteria 1571
277 Ga0207695_10038593 3300025913 Bacteria 5139
278 Ga0207671_10012313 3300025914 Bacteria 6885
279 Ga0207671_10286311 3300025914 Bacteria 1300
280 Ga0207671_11118796 3300025914 Bacteria 618
281 Ga0207663_11566591 3300025916 Bacteria 530
282 Ga0207660_10517862 3300025917 Unclassified 968
283 Ga0207662_10017549 3300025918 Bacteria 4051
284 Ga0207657_10310611 3300025919 Bacteria 1248
285 Ga0207649_10274968 3300025920 Bacteria 1222
286 Ga0207652_10063946 3300025921 Bacteria 3183
287 Ga0207646_10001531 3300025922 Bacteria 28307
288 Ga0207646_10047620 3300025922 Unclassified 3845
289 Ga0207681_10001431 3300025923 Bacteria 15381
290 Ga0207681_10076041 3300025923 Bacteria 2357
291 Ga0207681_10169082 3300025923 Bacteria 1656
292 Ga0207694_10036814 3300025924 Bacteria 3755
293 Ga0207694_10809460 3300025924 Bacteria 791
294 Ga0207650_10002812 3300025925 Bacteria 12018
295 Ga0207650_10023376 3300025925 Bacteria 4382
296 Ga0207650_10107953 3300025925 Bacteria 2151
297 Ga0207650_10110573 3300025925 Bacteria 2126
298 Ga0207650_10339750 3300025925 Bacteria 1233
299 Ga0207659_10002086 3300025926 Bacteria 11835
300 Ga0207659_10010512 3300025926 Bacteria 5817
301 Ga0207659_10176298 3300025926 Bacteria 1690
302 Ga0207659_10190982 3300025926 Bacteria 1630
303 Ga0207659_10774113 3300025926 Bacteria 824
304 Ga0207687_10262798 3300025927 Bacteria 1377
305 Ga0207687_10703061 3300025927 Bacteria 858
306 Ga0207644_10000749 3300025931 Bacteria 20609
307 Ga0207644_10021152 3300025931 Bacteria 4429
308 Ga0207644_10090222 3300025931 Bacteria 2283
309 Ga0207644_10292928 3300025931 Bacteria 1309
310 Ga0207690_10600884 3300025932 Unclassified 898
311 Ga0207706_10010703 3300025933 Bacteria 8378
312 Ga0207706_10031984 3300025933 Bacteria 4687
313 Ga0207706_10469860 3300025933 Unclassified 1087
314 Ga0207686_10011886 3300025934 Bacteria 4777
315 Ga0207686_10405015 3300025934 Bacteria 1040
316 Ga0207686_10596222 3300025934 Bacteria 869
317 Ga0207709_10139601 3300025935 Unclassified 1664
318 Ga0207709_10282533 3300025935 Bacteria 1226
319 Ga0207670_11561897 3300025936 Bacteria 561
320 Ga0207669_10099773 3300025937 Bacteria 1916
321 Ga0207669_10308711 3300025937 Unclassified 1205
322 Ga0207669_10429455 3300025937 Bacteria 1042
323 Ga0207669_11468097 3300025937 Bacteria 581
324 Ga0207704_10014090 3300025938 Bacteria 4027
325 Ga0207665_10003169 3300025939 Bacteria 11018
326 Ga0207665_10023803 3300025939 Bacteria 4033
327 Ga0207691_10000678 3300025940 Bacteria 33621
328 Ga0207691_10010182 3300025940 Bacteria 9019
329 Ga0207691_10412963 3300025940 Bacteria 1151
330 Ga0207691_10497453 3300025940 Bacteria 1035
331 Ga0207711_10004798 3300025941 Bacteria 11476
332 Ga0207711_10013895 3300025941 Bacteria 6687
333 Ga0207711_10115158 3300025941 Bacteria 2395
334 Ga0207711_10148691 3300025941 Bacteria 2112
335 Ga0207711_10201368 3300025941 Bacteria 1817
336 Ga0207689_10006552 3300025942 Bacteria 10272
337 Ga0207689_10107381 3300025942 Bacteria 2294
338 Ga0207689_10112582 3300025942 Bacteria 2237
339 Ga0207661_10243587 3300025944 Bacteria 1596
340 Ga0207651_10001152 3300025960 Bacteria 11811
341 Ga0207651_10115388 3300025960 Bacteria 2025
342 Ga0207651_10147261 3300025960 Bacteria 1828
343 Ga0207651_10248182 3300025960 Bacteria 1455
344 Ga0207651_10379215 3300025960 Bacteria 1198
345 Ga0207651_10485792 3300025960 Bacteria 1065
346 Ga0207668_10030896 3300025972 Bacteria 3523
347 Ga0207668_10929270 3300025972 Bacteria 775
348 Ga0207668_12145313 3300025972 Bacteria 503
349 Ga0207640_10001215 3300025981 Bacteria 14065
350 Ga0207658_10002016 3300025986 Bacteria 15151
351 Ga0207658_10125160 3300025986 Bacteria 2056
352 Ga0207658_11070418 3300025986 Bacteria 736
353 Ga0207677_10072069 3300026023 Bacteria 2441
354 Ga0207677_10087891 3300026023 Bacteria 2252
355 Ga0207677_10209725 3300026023 Bacteria 1555
356 Ga0207677_10298192 3300026023 Bacteria 1330
357 Ga0207677_10860050 3300026023 Unclassified 815
358 Ga0207703_10000937 3300026035 Bacteria 28276
359 Ga0207703_10129266 3300026035 Bacteria 2179
360 Ga0207703_11392409 3300026035 Bacteria 675
361 Ga0207639_10165975 3300026041 Bacteria 1865
362 Ga0207678_10067222 3300026067 Bacteria 3076
363 Ga0207678_11457077 3300026067 Unclassified 605
364 Ga0207708_10279740 3300026075 Bacteria 1352
365 Ga0207708_11041306 3300026075 Bacteria 712
366 Ga0207641_10054275 3300026088 Bacteria 3400
367 Ga0207641_10119417 3300026088 Bacteria 2350
368 Ga0207641_10289899 3300026088 Bacteria 1542
369 Ga0207641_10337780 3300026088 Unclassified 1432
370 Ga0207641_10405756 3300026088 Bacteria 1309
371 Ga0207641_10998394 3300026088 Bacteria 834
372 Ga0207648_10001948 3300026089 Bacteria 22560
373 Ga0207648_10027670 3300026089 Bacteria 5032
374 Ga0207648_10181873 3300026089 Bacteria 1861
375 Ga0207648_10293453 3300026089 Bacteria 1456
376 Ga0207648_10623208 3300026089 Bacteria 996
377 Ga0207676_10038162 3300026095 Bacteria 3664
378 Ga0207676_10150836 3300026095 Bacteria 2002
379 Ga0207676_10181024 3300026095 Unclassified 1845
380 Ga0207676_10312041 3300026095 Bacteria 1440
381 Ga0207676_10354161 3300026095 Bacteria 1358
382 Ga0207676_10493648 3300026095 Bacteria 1161
383 Ga0207674_11689306 3300026116 Unclassified 601
384 Ga0207675_100005532 3300026118 Bacteria 12081
385 Ga0207675_100281084 3300026118 Bacteria 1617
386 Ga0207683_10000381 3300026121 Bacteria 40910
387 Ga0207683_10016188 3300026121 Bacteria 6348
388 Ga0207683_10018328 3300026121 Bacteria 5971
389 Ga0207683_10051239 3300026121 Bacteria 3616
390 Ga0207683_10231442 3300026121 Bacteria 1685
391 Ga0207683_10570251 3300026121 Bacteria 1047
392 Ga0207683_11390609 3300026121 Bacteria 649
393 Ga0207698_10007214 3300026142 Bacteria 6963
394 Ga0207698_10041570 3300026142 Bacteria 3427
395 Ga0207698_10108012 3300026142 Bacteria 2325
396 Ga0207698_11056737 3300026142 Bacteria 824
397 Ga0209983_1071091 3300027665 Bacteria 775
398 Ga0209588_1035555 3300027671 Bacteria 1601
399 Ga0268266_11279542 3300028379 Bacteria 709
400 Ga0268265_10675473 3300028380 Bacteria 995
401 Ga0268264_10004346 3300028381 Bacteria 12099
402 Ga0268264_10176433 3300028381 Bacteria 1937
403 Ga0268264_10258591 3300028381 Bacteria 1621
404 Ga0268264_10412100 3300028381 Bacteria 1301
405 Ga0307408_100120514 3300031548 Bacteria 2032
406 Ga0307516_10004643 3300031730 Bacteria 16850
407 Ga0307413_10190224 3300031824 Bacteria 1473
408 Ga0373934_0423255 3300035086 Bacteria 557
409 Ga0373956_0226432 3300035119 Bacteria 888
410 Ga0373943_0726871 3300035170 Bacteria 589
411 Ga0373947_1192031 3300035725 Unclassified 519
412 Ga0373937_0286155 3300036401 Bacteria 1557
413 Ga0373937_0830491 3300036401 Bacteria 872
414 Ga0395905_0004697 3300037471 Bacteria 14121
415 Ga0395905_0084729 3300037471 Bacteria 2970
416 Ga0395905_0116017 3300037471 Bacteria 2516
417 Ga0395905_0166693 3300037471 Bacteria 2070
418 Ga0436361_0734361 3300039447 Bacteria 1440
419 Ga0451807_1328611 3300041486 Bacteria 874
420 Ga0451807_2634338 3300041486 Bacteria 903
421 Ga0451807_2737184 3300041486 Bacteria 1080
422 Ga0451841_1298612 3300041498 Bacteria 583
423 Ga0439431_0072146 3300041997 Bacteria 921
424 Ga0439433_0032901 3300041999 Bacteria 1190
425 Ga0439449_0048397 3300042007 Bacteria 1574
426 Ga0439457_029287 3300042014 Bacteria 1220
427 Ga0450911_026079 3300042115 Bacteria 758
428 Ga0450896_012323 3300042133 Bacteria 1209
429 Ga0450898_003190 3300042134 Bacteria 2341
430 Ga0439446_0323582 3300042156 Bacteria 545
431 Ga0450908_001429 3300042184 Bacteria 4639
432 Ga0439434_0163847 3300042435 Bacteria 740
433 Ga0439459_0114941 3300042438 Bacteria 672
434 Ga0451577_0661542 3300042876 Bacteria 947
435 Ga0466969_0048314 3300044656 Bacteria 2104
436 Ga0466977_0006959 3300044666 Bacteria 6108
437 Ga0466964_0056004 3300044706 Bacteria 1629
438 Ga0466968_0117159 3300044735 Bacteria 1202
439 Ga0466957_0037471 3300044842 Bacteria 2920
440 Ga0451576_1892388 3300045051 Unclassified 616
441 Ga0466958_0220543 3300045836 Bacteria 1210
442 Ga0495642_0121045 3300046528 Bacteria 1123
443 Ga0495621_0001469 3300046539 Bacteria 6113
444 Ga0495621_0066665 3300046539 Bacteria 1317
445 Ga0495621_0100087 3300046539 Bacteria 1102
446 Ga0495656_0027850 3300046615 Bacteria 2261
447 Ga0495656_0309710 3300046615 Bacteria 811
448 Ga0495658_0219955 3300046683 Bacteria 1189
449 Ga0495669_0234313 3300046684 Bacteria 881
450 Ga0495660_0037498 3300046810 Bacteria 2699
451 Ga0495636_0026878 3300047318 Bacteria 2343
452 Ga0496100_1383843 3300048903 Bacteria 555
453 Ga0496102_0008203 3300048905 Bacteria 8940
454 Ga0496102_0009020 3300048905 Bacteria 8560
455 Ga0496102_0832405 3300048905 Bacteria 845
456 Ga0496104_0042740 3300048907 Bacteria 4255
457 Ga0496104_0175532 3300048907 Bacteria 2053
458 Ga0496108_0896215 3300048911 Bacteria 761
459 Ga0496108_1507553 3300048911 Bacteria 559
460 Ga0496109_0075048 3300048912 Bacteria 3109
461 Ga0496109_0678654 3300048912 Bacteria 968
462 Ga0496110_0008030 3300048913 Bacteria 8462
463 Ga0496110_0702354 3300048913 Bacteria 913
464 Ga0496111_0252466 3300048914 Bacteria 1309
465 Ga0496112_0507069 3300048915 Bacteria 1141
466 Ga0496113_0023869 3300048916 Bacteria 4341
467 Ga0496113_0377423 3300048916 Bacteria 1138
468 Ga0496114_0148344 3300048917 Bacteria 2034
469 Ga0496114_0349189 3300048917 Bacteria 1308
470 Ga0501292_023619 3300049515 Bacteria 1006
471 Ga0501300_025149 3300049523 Bacteria 873
472 Ga0501032_0620087 3300049569 Bacteria 688
473 Ga0501034_0188165 3300049571 Unclassified 2027
474 Ga0501034_0540600 3300049571 Bacteria 1075
475 Ga0501034_0641944 3300049571 Bacteria 964
476 Ga0501040_1118012 3300049576 Unclassified 572
477 Ga0501043_1240825 3300049579 Unclassified 522
478 Ga0501046_0074710 3300049580 Bacteria 2629
479 Ga0501070_1362927 3300049586 Bacteria 540
480 Ga0501206_009388 3300049653 Bacteria 1300
481 Ga0501253_042668 3300049683 Bacteria 920
482 Ga0501079_1472727 3300049741 Unclassified 536
483 Ga0501262_003484 3300049759 Bacteria 1802
484 nmdc:mga03n38_112849_c1 3300050490 Bacteria 1326
485 nmdc:mga00v17_618743_c1 3300050491 Bacteria 698
486 nmdc:mga0k408_153397_c1 3300050493 Bacteria 1372
487 nmdc:mga0k408_21719_c1 3300050493 Bacteria 3608
488 nmdc:mga0k408_273024_c1 3300050493 Bacteria 1009
489 nmdc:mga0k408_4137_c1 3300050493 Bacteria 7706
490 nmdc:mga0k408_647552_c1 3300050493 Bacteria 621
491 nmdc:mga06z11_127797_c2 3300050494 Bacteria 957
492 nmdc:mga06z11_40193_c1 3300050494 Bacteria 2333
493 nmdc:mga05p37_1436903_c1 3300050507 Bacteria 692
494 nmdc:mga0qj67_19667_c1 3300050509 Bacteria 5162
495 nmdc:mga0qj67_462823_c1 3300050509 Bacteria 1021
496 nmdc:mga08y16_1268555_c1 3300050511 Bacteria 705
497 nmdc:mga08y16_524664_c1 3300050511 Bacteria 1201
498 nmdc:mga0n895_102778_c1 3300050512 Bacteria 2869
499 nmdc:mga0n895_19448_c1 3300050512 Bacteria 6313
500 nmdc:mga08x19_4573_c1 3300050514 Bacteria 8211
501 nmdc:mga0a205_2498_c1 3300050515 Bacteria 16214
502 nmdc:mga0a205_678190_c1 3300050515 Bacteria 881
503 Ga0501084_0491837 3300054114 Bacteria 1037
504 Ga0501082_0000983 3300060353 Bacteria 25153
505 2910251160 2910245624 Bacteria 6935613
506 Ga0068868_100007818
507 rootH2_10086604
508 Ga0065712_10130158
509 Ga0070658_10306709
510 Ga0070658_10343464
511 Ga0070676_10007664
512 Ga0070676_10032313
513 Ga0070676_10167153
514 Ga0070676_11432350
515 Ga0070683_100358779
516 Ga0070690_100210708
517 Ga0070670_100052905
518 Ga0070670_100081634
519 Ga0070670_100132951
520 Ga0070670_100133090
521 Ga0070670_100489861
522 Ga0070670_100695359
523 Ga0070670_100929490
524 Ga0070677_10009100
525 Ga0068869_100009372
526 Ga0068869_100053042
527 Ga0070666_10001388
528 Ga0070666_10092976
529 Ga0070666_10242269
530 Ga0070680_100169446
531 Ga0068868_100000704
532 Ga0068868_100025209
533 Ga0068868_100101912
534 Ga0070660_100370508
535 Ga0070689_100140596
536 Ga0070689_100438293
537 Ga0070687_100046103
538 Ga0070692_10497784
539 Ga0070668_100000682
540 Ga0070668_100128195
541 Ga0070668_100153171
542 Ga0070669_100001716
543 Ga0070669_100124273
544 Ga0070669_100198998
545 Ga0070675_100000870
546 Ga0070675_100008766
547 Ga0070675_100030341
548 Ga0070675_100079810
549 Ga0070675_100449455
550 Ga0070675_100897842
551 Ga0070671_100000917
552 Ga0070671_100003475
553 Ga0070671_100030989
554 Ga0070671_100091693
555 Ga0070674_100004651
556 Ga0070674_100080183
557 Ga0070674_100340680
558 Ga0070674_100440596
559 Ga0070674_100673559
560 Ga0070674_101572688
561 Ga0070673_100022082
562 Ga0070673_100481571
563 Ga0070673_100552093
564 Ga0070688_100060128
565 Ga0070688_100968270
566 Ga0070688_101563212
567 Ga0070659_100156387
568 Ga0070667_100003490
569 Ga0070667_100208344
570 Ga0070667_100223121
571 Ga0070667_100331082
572 Ga0070709_10802444
573 Ga0070701_10168517
574 Ga0070701_10228175
575 Ga0070701_10786762
576 Ga0070711_102067376
577 Ga0070700_100649430
578 Ga0070694_100302045
579 Ga0070694_101128079
580 Ga0070708_100000034
581 Ga0070708_100094564
582 Ga0070663_100396518
583 Ga0070678_100019429
584 Ga0070678_100043549
585 Ga0070678_100152323
586 Ga0070678_100220063
587 Ga0070678_100346516
588 Ga0070678_100549352
589 Ga0070662_100001421
590 Ga0070662_100156807
591 Ga0070662_100301849
592 Ga0070681_10978323
593 Ga0068867_100023575
594 Ga0068867_100051199
595 Ga0068867_100101970
596 Ga0068867_100302602
597 Ga0068867_102039707
598 Ga0070685_10378368
599 Ga0070685_10408155
600 Ga0070685_11309244
601 Ga0070706_100339887
602 Ga0070706_100568956
603 Ga0070707_100003426
604 Ga0070698_100882625
605 Ga0070699_100085088
606 Ga0070699_100518976
607 Ga0070679_100317841
608 Ga0070679_100376905
609 Ga0070679_100575758
610 Ga0070684_100262261
611 Ga0070697_100402710
612 Ga0068853_100128999
613 Ga0068853_100333790
614 Ga0070672_100001295
615 Ga0070672_100047433
616 Ga0070672_100276119
617 Ga0070672_100364845
618 Ga0070672_100620680
619 Ga0070686_100151812
620 Ga0070686_100687792
621 Ga0070696_100013382
622 Ga0070696_100199241
623 Ga0070696_100414137
624 Ga0070696_100745547
625 Ga0070693_101244252
626 Ga0070665_100113775
627 Ga0070704_101154441
628 Ga0070704_101582398
629 Ga0070704_102092339
630 Ga0070664_100039490
631 Ga0070702_100202244
632 Ga0070702_100534482
633 Ga0070702_100773198
634 Ga0068852_100006556
635 Ga0068852_100024651
636 Ga0068852_100035837
637 Ga0068859_100059743
638 Ga0068859_100081610
639 Ga0068859_100083503
640 Ga0068859_100856367
641 Ga0068864_100012872
642 Ga0068864_100019672
643 Ga0068864_100034800
644 Ga0068864_100169531
645 Ga0068864_100462417
646 Ga0068866_10061914
647 Ga0068866_10180476
648 Ga0068861_100004066
649 Ga0068861_100876139
650 Ga0068851_10126631
651 Ga0068851_10563675
652 Ga0068870_10018402
653 Ga0068863_100008911
654 Ga0068863_100013698
655 Ga0068863_100037783
656 Ga0068863_100049857
657 Ga0068863_100094165
658 Ga0068858_100003840
659 Ga0068858_100014301
660 Ga0068858_101150514
661 Ga0068858_101228142
662 Ga0068858_101895938
663 Ga0068860_100001826
664 Ga0068860_100199708
665 Ga0068860_100267512
666 Ga0068860_100503718
667 Ga0068862_100540899
668 Ga0081539_10075348
669 Ga0075368_10168175
670 Ga0075363_100101626
671 Ga0075364_10081852
672 Ga0075364_10464873
673 Ga0070715_10058328
674 Ga0070716_100010801
675 Ga0070716_100128961
676 Ga0075366_10002380
677 Ga0075366_10007251
678 Ga0075366_10010565
679 Ga0075366_10132077
680 Ga0075366_10146625
681 Ga0075366_10244177
682 Ga0075366_10591405
683 Ga0097621_100010530
684 Ga0097621_100163223
685 Ga0097621_100229060
686 Ga0097621_100278058
687 Ga0097621_100648954
688 Ga0097621_100736135
689 Ga0068871_100003479
690 Ga0068871_100007269
691 Ga0068871_100048661
692 Ga0068871_100166253
693 Ga0075428_101358406
694 Ga0075430_100031374
695 Ga0075433_10005827
696 Ga0075433_10522439
697 Ga0075434_100009949
698 Ga0075434_100026543
699 Ga0075434_101052323
700 Ga0075434_102375718
701 Ga0075429_100007863
702 Ga0068865_100000599
703 Ga0075436_100000152
704 Ga0075436_100690786
705 Ga0097620_100059743
706 Ga0097620_100081610
707 Ga0097620_100083502
708 Ga0097620_100856196
709 Ga0099794_10123405
710 Ga0105240_10005216
711 Ga0111539_10344200
712 Ga0111539_10404518
713 Ga0111539_10601630
714 Ga0105245_10054076
715 Ga0105245_10387395
716 Ga0105245_10865057
717 Ga0105247_11040400
718 Ga0105243_10002376
719 Ga0105242_10029448
720 Ga0105242_10415225
721 Ga0105242_10420800
722 Ga0105242_10696078
723 Ga0105248_10001312
724 Ga0105248_10009844
725 Ga0105248_10017166
726 Ga0105248_10049840
727 Ga0105248_10060701
728 Ga0105237_10003588
729 Ga0105237_10464638
730 Ga0105238_10111288
731 Ga0105249_10008572
732 Ga0105249_12490040
733 Ga0105239_10003774
734 Ga0105246_10261426
735 Ga0105246_10283521
736 Ga0157373_10087378
737 Ga0157371_10976206
738 Ga0157371_11283089
739 Ga0157369_10579406
740 Ga0157374_10447592
741 Ga0157378_10003505
742 Ga0157378_10093956
743 Ga0157378_10100548
744 Ga0157378_10167362
745 Ga0163162_10077043
746 Ga0163162_10079920
747 Ga0163162_10261837
748 Ga0163162_11085498
749 Ga0157375_10063099
750 Ga0157375_10802160
751 Ga0163163_10031947
752 Ga0163163_10525649
753 Ga0163163_12718265
754 Ga0157380_10275916
755 Ga0157380_10398946
756 Ga0157380_10494026
757 Ga0157379_10002348
758 Ga0157379_10002864
759 Ga0157379_10058992
760 Ga0157379_10301542
761 Ga0157379_11765693
762 Ga0157376_10008212
763 Ga0157376_10044710
764 Ga0157376_11192123
765 Ga0157376_12140522
766 Ga0163161_10226621
767 Ga0163161_11247047
768 Ga0209051_1001780
769 Ga0207697_10010359
770 Ga0207656_10332204
771 Ga0207682_10012139
772 Ga0207642_10004657
773 Ga0207642_10297413
774 Ga0207680_10025886
775 Ga0207680_10116614
776 Ga0207647_10368099
777 Ga0207645_10014967
778 Ga0207645_10019213
779 Ga0207645_10184087
780 Ga0207705_10150042
781 Ga0207707_10241216
782 Ga0207695_10038593
783 Ga0207671_10012313
784 Ga0207671_10286311
785 Ga0207671_11118796
786 Ga0207663_11566591
787 Ga0207660_10517862
788 Ga0207662_10017549
789 Ga0207657_10310611
790 Ga0207649_10274968
791 Ga0207652_10063946
792 Ga0207646_10001531
793 Ga0207646_10047620
794 Ga0207681_10001431
795 Ga0207681_10076041
796 Ga0207681_10169082
797 Ga0207694_10036814
798 Ga0207694_10809460
799 Ga0207650_10002812
800 Ga0207650_10023376
801 Ga0207650_10107953
802 Ga0207650_10110573
803 Ga0207650_10339750
804 Ga0207659_10002086
805 Ga0207659_10010512
806 Ga0207659_10176298
807 Ga0207659_10190982
808 Ga0207659_10774113
809 Ga0207687_10262798
810 Ga0207687_10703061
811 Ga0207644_10000749
812 Ga0207644_10021152
813 Ga0207644_10090222
814 Ga0207644_10292928
815 Ga0207690_10600884
816 Ga0207706_10010703
817 Ga0207706_10031984
818 Ga0207706_10469860
819 Ga0207686_10011886
820 Ga0207686_10405015
821 Ga0207686_10596222
822 Ga0207709_10139601
823 Ga0207709_10282533
824 Ga0207670_11561897
825 Ga0207669_10099773
826 Ga0207669_10308711
827 Ga0207669_10429455
828 Ga0207669_11468097
829 Ga0207704_10014090
830 Ga0207665_10003169
831 Ga0207665_10023803
832 Ga0207691_10000678
833 Ga0207691_10010182
834 Ga0207691_10412963
835 Ga0207691_10497453
836 Ga0207711_10004798
837 Ga0207711_10013895
838 Ga0207711_10115158
839 Ga0207711_10148691
840 Ga0207711_10201368
841 Ga0207689_10006552
842 Ga0207689_10107381
843 Ga0207689_10112582
844 Ga0207661_10243587
845 Ga0207651_10001152
846 Ga0207651_10115388
847 Ga0207651_10147261
848 Ga0207651_10248182
849 Ga0207651_10379215
850 Ga0207651_10485792
851 Ga0207668_10030896
852 Ga0207668_10929270
853 Ga0207668_12145313
854 Ga0207640_10001215
855 Ga0207658_10002016
856 Ga0207658_10125160
857 Ga0207658_11070418
858 Ga0207677_10072069
859 Ga0207677_10087891
860 Ga0207677_10209725
861 Ga0207677_10298192
862 Ga0207677_10860050
863 Ga0207703_10000937
864 Ga0207703_10129266
865 Ga0207703_11392409
866 Ga0207639_10165975
867 Ga0207678_10067222
868 Ga0207678_11457077
869 Ga0207708_10279740
870 Ga0207708_11041306
871 Ga0207641_10054275
872 Ga0207641_10119417
873 Ga0207641_10289899
874 Ga0207641_10337780
875 Ga0207641_10405756
876 Ga0207641_10998394
877 Ga0207648_10001948
878 Ga0207648_10027670
879 Ga0207648_10181873
880 Ga0207648_10293453
881 Ga0207648_10623208
882 Ga0207676_10038162
883 Ga0207676_10150836
884 Ga0207676_10181024
885 Ga0207676_10312041
886 Ga0207676_10354161
887 Ga0207676_10493648
888 Ga0207674_11689306
889 Ga0207675_100005532
890 Ga0207675_100281084
891 Ga0207683_10000381
892 Ga0207683_10016188
893 Ga0207683_10018328
894 Ga0207683_10051239
895 Ga0207683_10231442
896 Ga0207683_10570251
897 Ga0207683_11390609
898 Ga0207698_10007214
899 Ga0207698_10041570
900 Ga0207698_10108012
901 Ga0207698_11056737
902 Ga0209983_1071091
903 Ga0209588_1035555
904 Ga0268266_11279542
905 Ga0268265_10675473
906 Ga0268264_10004346
907 Ga0268264_10176433
908 Ga0268264_10258591
909 Ga0268264_10412100
910 Ga0307408_100120514
911 Ga0307516_10004643
912 Ga0307413_10190224
913 Ga0373934_0423255
914 Ga0373956_0226432
915 Ga0373943_0726871
916 Ga0373947_1192031
917 Ga0373937_0286155
918 Ga0373937_0830491
919 Ga0395905_0004697
920 Ga0395905_0084729
921 Ga0395905_0116017
922 Ga0395905_0166693
923 Ga0436361_0734361
924 Ga0451807_1328611
925 Ga0451807_2634338
926 Ga0451807_2737184
927 Ga0451841_1298612
928 Ga0439431_0072146
929 Ga0439433_0032901
930 Ga0439449_0048397
931 Ga0439457_029287
932 Ga0450911_026079
933 Ga0450896_012323
934 Ga0450898_003190
935 Ga0439446_0323582
936 Ga0450908_001429
937 Ga0439434_0163847
938 Ga0439459_0114941
939 Ga0451577_0661542
940 Ga0466969_0048314
941 Ga0466977_0006959
942 Ga0466964_0056004
943 Ga0466968_0117159
944 Ga0466957_0037471
945 Ga0451576_1892388
946 Ga0466958_0220543
947 Ga0495642_0121045
948 Ga0495621_0001469
949 Ga0495621_0066665
950 Ga0495621_0100087
951 Ga0495656_0027850
952 Ga0495656_0309710
953 Ga0495658_0219955
954 Ga0495669_0234313
955 Ga0495660_0037498
956 Ga0495636_0026878
957 Ga0496100_1383843
958 Ga0496102_0008203
959 Ga0496102_0009020
960 Ga0496102_0832405
961 Ga0496104_0042740
962 Ga0496104_0175532
963 Ga0496108_0896215
964 Ga0496108_1507553
965 Ga0496109_0075048
966 Ga0496109_0678654
967 Ga0496110_0008030
968 Ga0496110_0702354
969 Ga0496111_0252466
970 Ga0496112_0507069
971 Ga0496113_0023869
972 Ga0496113_0377423
973 Ga0496114_0148344
974 Ga0496114_0349189
975 Ga0501292_023619
976 Ga0501300_025149
977 Ga0501032_0620087
978 Ga0501034_0188165
979 Ga0501034_0540600
980 Ga0501034_0641944
981 Ga0501040_1118012
982 Ga0501043_1240825
983 Ga0501046_0074710
984 Ga0501070_1362927
985 Ga0501206_009388
986 Ga0501253_042668
987 Ga0501079_1472727
988 Ga0501262_003484
989 nmdc:mga03n38_112849_c1
990 nmdc:mga00v17_618743_c1
991 nmdc:mga0k408_153397_c1
992 nmdc:mga0k408_21719_c1
993 nmdc:mga0k408_273024_c1
994 nmdc:mga0k408_4137_c1
995 nmdc:mga0k408_647552_c1
996 nmdc:mga06z11_127797_c2
997 nmdc:mga06z11_40193_c1
998 nmdc:mga05p37_1436903_c1
999 nmdc:mga0qj67_19667_c1
1000 nmdc:mga0qj67_462823_c1
1001 nmdc:mga08y16_1268555_c1
1002 nmdc:mga08y16_524664_c1
1003 nmdc:mga0n895_102778_c1
1004 nmdc:mga0n895_19448_c1
1005 nmdc:mga08x19_4573_c1
1006 nmdc:mga0a205_2498_c1
1007 nmdc:mga0a205_678190_c1
1008 Ga0501084_0491837
1009 Ga0501082_0000983
1010 2910251160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

26

54

0.92

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

151

0.84

PF18029

Glyoxalase_6

Glyoxalase-like domain

29

152

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8319 5 133
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8274 7 133
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8015 5 133
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.801 7 133
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.7269 4 133
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.94 77 132 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9166 79 135 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8876 79 135 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.859 79 133 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8125 81 131 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A259IWH6-F1-model_v4 Glyoxalase 0.9977 79 134
AF-A0A7W0G7P7-F1-model_v4 VOC family protein 0.9965 82 135
AF-A0A3C0FM12-F1-model_v4 Glyoxalase 0.9949 82 134
AF-A0A537NX92-F1-model_v4 VOC family protein 0.9923 82 136
AF-A0A6L7X5H9-F1-model_v4 VOC family protein 0.9905 81 135

Map