F456182

General Info

Members Datasets Scaffolds Average Seq Length
504 199 1008 150

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10074206|Ga0105245_100742062
Length 175
Sequence MADYLLEHRAVHASARSCDTLLKKENMAKISEVLGGAAAIAKGMSVTFREMLNPTLTEDYPEAPAKFQERYRGVHELQRDENGLEKCVACFLCAAACPAECIYIEAAENTEELRISGGERYAKVYNIDYTHGHGFEIASYNTSTLIYRKEQMLVQIPAGAHFPLKADASQPAEGH

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.99
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10074206 3300009098 Bacteria 3095
2 Ga0070658_11118694 3300005327 Bacteria 685
3 Ga0070683_100000049 3300005329 Bacteria 93310
4 Ga0070683_100000283 3300005329 Bacteria 34847
5 Ga0070683_100028441 3300005329 Bacteria 5052
6 Ga0070683_100061376 3300005329 Bacteria 3496
7 Ga0070683_100163796 3300005329 Bacteria 2109
8 Ga0070683_100625140 3300005329 Bacteria 1031
9 Ga0068869_100107260 3300005334 Unclassified 2120
10 Ga0068869_100167819 3300005334 Bacteria 1713
11 Ga0070666_10003740 3300005335 Bacteria 9223
12 Ga0070666_10162596 3300005335 Unclassified 1561
13 Ga0070666_10259832 3300005335 Bacteria 1231
14 Ga0070680_100001131 3300005336 Bacteria 19146
15 Ga0068868_100210540 3300005338 Bacteria 1624
16 Ga0068868_100376836 3300005338 Bacteria 1220
17 Ga0068868_101133359 3300005338 Bacteria 721
18 Ga0070660_100009373 3300005339 Bacteria 6880
19 Ga0070660_100157010 3300005339 Bacteria 1831
20 Ga0070689_100857138 3300005340 Bacteria 802
21 Ga0070691_10001045 3300005341 Bacteria 11403
22 Ga0070669_100083708 3300005353 Bacteria 2379
23 Ga0070675_100405906 3300005354 Bacteria 1216
24 Ga0070671_100169283 3300005355 Bacteria 1847
25 Ga0070671_100332107 3300005355 Bacteria 1296
26 Ga0070674_100986544 3300005356 Bacteria 738
27 Ga0070673_100248269 3300005364 Bacteria 1550
28 Ga0070673_100403129 3300005364 Bacteria 1223
29 Ga0070673_100449330 3300005364 Bacteria 1159
30 Ga0070659_100093932 3300005366 Bacteria 2408
31 Ga0070659_100176879 3300005366 Bacteria 1750
32 Ga0070667_100408399 3300005367 Bacteria 1237
33 Ga0070667_100473650 3300005367 Bacteria 1146
34 Ga0070709_10083008 3300005434 Bacteria 2095
35 Ga0070713_100035693 3300005436 Bacteria 4005
36 Ga0070713_100116665 3300005436 Bacteria 2335
37 Ga0070713_100158897 3300005436 Bacteria 2016
38 Ga0070711_100168578 3300005439 Bacteria 1667
39 Ga0070711_100314513 3300005439 Bacteria 1249
40 Ga0070700_100300047 3300005441 Bacteria 1172
41 Ga0070708_100278187 3300005445 Bacteria 1575
42 Ga0070708_100394467 3300005445 Bacteria 1305
43 Ga0070681_10000846 3300005458 Bacteria 25701
44 Ga0070681_10002931 3300005458 Bacteria 15812
45 Ga0070681_10049129 3300005458 Bacteria 4214
46 Ga0070681_10054409 3300005458 Bacteria 3987
47 Ga0070681_10063295 3300005458 Bacteria 3671
48 Ga0070681_10278689 3300005458 Bacteria 1583
49 Ga0070681_10585511 3300005458 Bacteria 1030
50 Ga0070681_10897475 3300005458 Bacteria 805
51 Ga0068867_100053843 3300005459 Bacteria 2972
52 Ga0068867_100688866 3300005459 Bacteria 901
53 Ga0070685_10624309 3300005466 Bacteria 778
54 Ga0070698_101864215 3300005471 Bacteria 554
55 Ga0070699_100329013 3300005518 Bacteria 1374
56 Ga0070679_100001786 3300005530 Bacteria 19386
57 Ga0070679_100241832 3300005530 Bacteria 1762
58 Ga0070679_100262217 3300005530 Bacteria 1683
59 Ga0070684_100000040 3300005535 Bacteria 93306
60 Ga0070684_100005904 3300005535 Bacteria 9429
61 Ga0070684_100021122 3300005535 Bacteria 5410
62 Ga0070684_100052878 3300005535 Bacteria 3533
63 Ga0070684_100144365 3300005535 Bacteria 2154
64 Ga0070684_100264662 3300005535 Bacteria 1573
65 Ga0070684_100367670 3300005535 Bacteria 1324
66 Ga0068853_100035208 3300005539 Bacteria 4252
67 Ga0070686_100608654 3300005544 Bacteria 862
68 Ga0070696_100001840 3300005546 Bacteria 13932
69 Ga0070696_100608738 3300005546 Bacteria 882
70 Ga0070693_100096330 3300005547 Bacteria 1793
71 Ga0068855_100001008 3300005563 Bacteria 35144
72 Ga0068855_100029002 3300005563 Bacteria 6619
73 Ga0068855_100035012 3300005563 Bacteria 5984
74 Ga0068855_100368966 3300005563 Bacteria 1578
75 Ga0068855_100913497 3300005563 Bacteria 927
76 Ga0070664_100099850 3300005564 Bacteria 2523
77 Ga0070664_100328088 3300005564 Bacteria 1388
78 Ga0068857_100000138 3300005577 Bacteria 44676
79 Ga0068857_100004199 3300005577 Bacteria 12128
80 Ga0068857_100037568 3300005577 Bacteria 4290
81 Ga0068857_100084773 3300005577 Bacteria 2831
82 Ga0068857_100556994 3300005577 Bacteria 1080
83 Ga0068854_100106431 3300005578 Bacteria 2110
84 Ga0068854_100477590 3300005578 Bacteria 1046
85 Ga0068856_100001054 3300005614 Bacteria 29221
86 Ga0068856_100033027 3300005614 Bacteria 5068
87 Ga0068856_100050537 3300005614 Bacteria 4098
88 Ga0068856_100063288 3300005614 Bacteria 3655
89 Ga0068856_100065789 3300005614 Bacteria 3582
90 Ga0068856_100473205 3300005614 Bacteria 1274
91 Ga0068852_100060648 3300005616 Bacteria 3284
92 Ga0068852_100592487 3300005616 Bacteria 1112
93 Ga0068852_100882818 3300005616 Bacteria 911
94 Ga0068859_100018469 3300005617 Bacteria 7009
95 Ga0068859_100067129 3300005617 Bacteria 3621
96 Ga0068864_100015460 3300005618 Bacteria 6346
97 Ga0068866_10066756 3300005718 Bacteria 1886
98 Ga0068870_10195445 3300005840 Bacteria 1223
99 Ga0068863_100067679 3300005841 Bacteria 3378
100 Ga0068858_100015461 3300005842 Bacteria 7178
101 Ga0068858_100023738 3300005842 Bacteria 5713
102 Ga0068858_100060070 3300005842 Bacteria 3514
103 Ga0068858_100110475 3300005842 Bacteria 2567
104 Ga0068858_100214285 3300005842 Bacteria 1823
105 Ga0068858_101336112 3300005842 Bacteria 706
106 Ga0068860_100044578 3300005843 Bacteria 4227
107 Ga0068860_100209902 3300005843 Bacteria 1889
108 Ga0068860_100260133 3300005843 Bacteria 1691
109 Ga0068860_100363647 3300005843 Bacteria 1426
110 Ga0068860_100607853 3300005843 Bacteria 1099
111 Ga0070716_100856783 3300006173 Unclassified 708
112 Ga0097621_100017410 3300006237 Bacteria 5457
113 Ga0097621_100048273 3300006237 Bacteria 3453
114 Ga0097621_100161584 3300006237 Bacteria 1926
115 Ga0097621_100209070 3300006237 Bacteria 1697
116 Ga0097621_100459077 3300006237 Bacteria 1148
117 Ga0068871_100069741 3300006358 Bacteria 2887
118 Ga0068871_100070385 3300006358 Bacteria 2875
119 Ga0068871_100080144 3300006358 Bacteria 2703
120 Ga0068871_100187356 3300006358 Bacteria 1781
121 Ga0068871_100250312 3300006358 Bacteria 1543
122 Ga0068871_100251195 3300006358 Bacteria 1540
123 Ga0068871_100272371 3300006358 Bacteria 1479
124 Ga0075428_101013059 3300006844 Bacteria 879
125 Ga0075428_101326905 3300006844 Bacteria 756
126 Ga0075431_100020442 3300006847 Bacteria 6764
127 Ga0075433_10203679 3300006852 Bacteria 1759
128 Ga0075434_100440840 3300006871 Bacteria 1323
129 Ga0068865_100006171 3300006881 Bacteria 7307
130 Ga0068865_100392450 3300006881 Bacteria 1135
131 Ga0097620_100018469 3300006931 Bacteria 7009
132 Ga0097620_100067134 3300006931 Bacteria 3621
133 Ga0105240_10005774 3300009093 Bacteria 18353
134 Ga0105240_10018153 3300009093 Bacteria 9457
135 Ga0105240_10093693 3300009093 Bacteria 3665
136 Ga0105240_10202472 3300009093 Bacteria 2325
137 Ga0105240_10209769 3300009093 Bacteria 2277
138 Ga0105240_10402113 3300009093 Bacteria 1542
139 Ga0111539_10314397 3300009094 Bacteria 1823
140 Ga0105245_10000447 3300009098 Bacteria 37818
141 Ga0105245_10004270 3300009098 Bacteria 12669
142 Ga0105245_10006915 3300009098 Bacteria 9945
143 Ga0105245_10090620 3300009098 Bacteria 2813
144 Ga0105245_10107734 3300009098 Bacteria 2587
145 Ga0105245_11382255 3300009098 Bacteria 754
146 Ga0105247_10027024 3300009101 Bacteria 3470
147 Ga0114129_10059331 3300009147 Bacteria 5350
148 Ga0114129_10099622 3300009147 Bacteria 4022
149 Ga0105243_10199804 3300009148 Bacteria 1752
150 Ga0105243_10254471 3300009148 Bacteria 1569
151 Ga0105241_10002879 3300009174 Bacteria 12857
152 Ga0105241_10034677 3300009174 Bacteria 3793
153 Ga0105241_10636256 3300009174 Bacteria 967
154 Ga0105242_10005927 3300009176 Bacteria 9424
155 Ga0105242_10008793 3300009176 Bacteria 7749
156 Ga0105242_10174260 3300009176 Bacteria 1893
157 Ga0105242_10177000 3300009176 Bacteria 1879
158 Ga0105242_10219206 3300009176 Bacteria 1699
159 Ga0105242_10357159 3300009176 Bacteria 1351
160 Ga0105242_10812340 3300009176 Bacteria 927
161 Ga0105242_11870269 3300009176 Bacteria 640
162 Ga0105248_10006069 3300009177 Bacteria 13259
163 Ga0105248_10027929 3300009177 Bacteria 6283
164 Ga0105248_10067915 3300009177 Bacteria 4003
165 Ga0105248_10756271 3300009177 Bacteria 1097
166 Ga0105248_10892145 3300009177 Bacteria 1004
167 Ga0105248_11280309 3300009177 Bacteria 829
168 Ga0105237_10015937 3300009545 Bacteria 7814
169 Ga0105237_10061775 3300009545 Bacteria 3745
170 Ga0105237_10095322 3300009545 Bacteria 2965
171 Ga0105237_10132363 3300009545 Bacteria 2488
172 Ga0105237_10848066 3300009545 Bacteria 920
173 Ga0105238_10003373 3300009551 Bacteria 15940
174 Ga0105238_10059194 3300009551 Bacteria 3838
175 Ga0105238_10071375 3300009551 Bacteria 3470
176 Ga0105238_10105197 3300009551 Bacteria 2804
177 Ga0105238_10983545 3300009551 Bacteria 864
178 Ga0105249_10046702 3300009553 Bacteria 3942
179 Ga0105249_10161425 3300009553 Bacteria 2166
180 Ga0105249_10319630 3300009553 Bacteria 1563
181 Ga0105239_10001184 3300010375 Bacteria 35758
182 Ga0105239_10015588 3300010375 Bacteria 8418
183 Ga0105239_10023709 3300010375 Bacteria 6757
184 Ga0105239_10158453 3300010375 Bacteria 2529
185 Ga0105239_10229935 3300010375 Bacteria 2080
186 Ga0105239_10252077 3300010375 Bacteria 1983
187 Ga0105239_10296797 3300010375 Bacteria 1820
188 Ga0105239_10614606 3300010375 Bacteria 1240
189 Ga0105239_11104746 3300010375 Bacteria 913
190 Ga0105246_10035496 3300011119 Bacteria 3333
191 Ga0105246_10091108 3300011119 Bacteria 2197
192 Ga0105246_10130933 3300011119 Bacteria 1874
193 Ga0105246_10258116 3300011119 Bacteria 1387
194 Ga0105246_10376108 3300011119 Bacteria 1172
195 Ga0157370_10003327 3300013104 Bacteria 18945
196 Ga0157370_10044597 3300013104 Bacteria 4260
197 Ga0157370_10548891 3300013104 Bacteria 1059
198 Ga0157369_10003253 3300013105 Bacteria 19343
199 Ga0157369_10057362 3300013105 Bacteria 4202
200 Ga0157369_10272523 3300013105 Unclassified 1763
201 Ga0157369_10451429 3300013105 Bacteria 1331
202 Ga0157369_10470932 3300013105 Bacteria 1300
203 Ga0157369_10582392 3300013105 Bacteria 1156
204 Ga0157369_11014891 3300013105 Bacteria 849
205 Ga0157374_10041797 3300013296 Bacteria 4226
206 Ga0157374_10056318 3300013296 Bacteria 3669
207 Ga0157374_10123673 3300013296 Bacteria 2499
208 Ga0157374_10187946 3300013296 Bacteria 2020
209 Ga0157374_10414829 3300013296 Bacteria 1344
210 Ga0157378_10003109 3300013297 Bacteria 14757
211 Ga0157378_10006879 3300013297 Bacteria 9921
212 Ga0157378_10437112 3300013297 Unclassified 1296
213 Ga0157378_10609070 3300013297 Bacteria 1104
214 Ga0157378_11205208 3300013297 Bacteria 796
215 Ga0163162_10005957 3300013306 Bacteria 11802
216 Ga0163162_10097671 3300013306 Bacteria 3026
217 Ga0163162_11837161 3300013306 Bacteria 693
218 Ga0157372_10004072 3300013307 Bacteria 15673
219 Ga0157372_10266912 3300013307 Bacteria 1988
220 Ga0157372_10373992 3300013307 Bacteria 1660
221 Ga0157372_11521163 3300013307 Bacteria 771
222 Ga0157372_11925806 3300013307 Bacteria 679
223 Ga0157372_12032822 3300013307 Bacteria 660
224 Ga0157375_10011394 3300013308 Bacteria 7849
225 Ga0157375_10060439 3300013308 Bacteria 3758
226 Ga0157375_10307828 3300013308 Bacteria 1748
227 Ga0157375_10337084 3300013308 Bacteria 1673
228 Ga0157375_10392588 3300013308 Bacteria 1554
229 Ga0157375_10548572 3300013308 Bacteria 1318
230 Ga0157375_10572301 3300013308 Bacteria 1290
231 Ga0163163_10000755 3300014325 Bacteria 27525
232 Ga0163163_10069658 3300014325 Bacteria 3502
233 Ga0163163_10133283 3300014325 Bacteria 2525
234 Ga0163163_10203110 3300014325 Bacteria 2030
235 Ga0163163_11157597 3300014325 Bacteria 836
236 Ga0163163_12508124 3300014325 Bacteria 574
237 Ga0157380_10621951 3300014326 Bacteria 1072
238 Ga0157379_11359789 3300014968 Bacteria 687
239 Ga0157376_10082610 3300014969 Bacteria 2761
240 Ga0157376_10115358 3300014969 Bacteria 2371
241 Ga0163161_10496329 3300017792 Unclassified 993
242 Ga0206355_1149239 3300020076 Bacteria 1181
243 Ga0206350_10129919 3300020080 Bacteria 1621
244 Ga0206350_10334689 3300020080 Bacteria 1165
245 Ga0213873_10020775 3300021358 Bacteria 1537
246 Ga0213876_10038222 3300021384 Unclassified 2533
247 Ga0213875_10138717 3300021388 Unclassified 1137
248 Ga0207642_10181010 3300025899 Bacteria 1148
249 Ga0207642_10325934 3300025899 Bacteria 898
250 Ga0207680_10012969 3300025903 Bacteria 4262
251 Ga0207680_10191473 3300025903 Unclassified 1389
252 Ga0207680_10486477 3300025903 Bacteria 878
253 Ga0207699_10304098 3300025906 Bacteria 1114
254 Ga0207645_10341680 3300025907 Bacteria 1001
255 Ga0207705_10148589 3300025909 Bacteria 1754
256 Ga0207705_10409978 3300025909 Bacteria 1048
257 Ga0207654_10001564 3300025911 Bacteria 12015
258 Ga0207654_10024552 3300025911 Bacteria 3243
259 Ga0207654_10211008 3300025911 Bacteria 1283
260 Ga0207707_10002719 3300025912 Bacteria 15792
261 Ga0207707_10011071 3300025912 Bacteria 7844
262 Ga0207707_10077159 3300025912 Bacteria 2908
263 Ga0207707_10221903 3300025912 Bacteria 1645
264 Ga0207707_10484323 3300025912 Bacteria 1056
265 Ga0207707_10831005 3300025912 Bacteria 768
266 Ga0207695_10000264 3300025913 Bacteria 132624
267 Ga0207695_10007930 3300025913 Bacteria 13399
268 Ga0207695_10014578 3300025913 Bacteria 9297
269 Ga0207695_10106729 3300025913 Bacteria 2786
270 Ga0207695_10298703 3300025913 Bacteria 1502
271 Ga0207695_10319115 3300025913 Bacteria 1443
272 Ga0207695_10339159 3300025913 Bacteria 1391
273 Ga0207671_10037575 3300025914 Bacteria 3590
274 Ga0207671_10046292 3300025914 Bacteria 3218
275 Ga0207671_10065649 3300025914 Bacteria 2700
276 Ga0207693_10488186 3300025915 Bacteria 962
277 Ga0207663_10149283 3300025916 Bacteria 1638
278 Ga0207663_10434129 3300025916 Bacteria 1010
279 Ga0207663_11085704 3300025916 Bacteria 643
280 Ga0207660_10002806 3300025917 Bacteria 11421
281 Ga0207660_10364700 3300025917 Bacteria 1159
282 Ga0207660_10510999 3300025917 Bacteria 975
283 Ga0207657_10139642 3300025919 Bacteria 1980
284 Ga0207657_10532263 3300025919 Bacteria 919
285 Ga0207649_11117404 3300025920 Bacteria 622
286 Ga0207652_10006919 3300025921 Bacteria 9133
287 Ga0207652_10235040 3300025921 Bacteria 1652
288 Ga0207652_10550691 3300025921 Bacteria 1037
289 Ga0207694_10000915 3300025924 Bacteria 26131
290 Ga0207694_10012556 3300025924 Bacteria 6385
291 Ga0207694_10090068 3300025924 Bacteria 2420
292 Ga0207694_10123235 3300025924 Bacteria 2071
293 Ga0207694_10138653 3300025924 Bacteria 1955
294 Ga0207687_10000964 3300025927 Bacteria 19563
295 Ga0207687_10019614 3300025927 Bacteria 4482
296 Ga0207687_10046605 3300025927 Bacteria 3002
297 Ga0207687_10050905 3300025927 Bacteria 2885
298 Ga0207687_10071116 3300025927 Bacteria 2485
299 Ga0207687_10080193 3300025927 Bacteria 2355
300 Ga0207687_10300788 3300025927 Bacteria 1292
301 Ga0207700_10074459 3300025928 Bacteria 2627
302 Ga0207700_10106142 3300025928 Bacteria 2251
303 Ga0207644_10046867 3300025931 Bacteria 3082
304 Ga0207690_10232153 3300025932 Bacteria 1417
305 Ga0207690_10469972 3300025932 Bacteria 1013
306 Ga0207706_10056707 3300025933 Bacteria 3453
307 Ga0207686_10059539 3300025934 Bacteria 2413
308 Ga0207686_10101246 3300025934 Bacteria 1924
309 Ga0207686_10130176 3300025934 Bacteria 1725
310 Ga0207686_10137889 3300025934 Bacteria 1682
311 Ga0207686_10290812 3300025934 Bacteria 1210
312 Ga0207709_10013421 3300025935 Bacteria 4521
313 Ga0207709_10039625 3300025935 Bacteria 2815
314 Ga0207709_10714023 3300025935 Bacteria 803
315 Ga0207670_10579311 3300025936 Bacteria 920
316 Ga0207669_10233840 3300025937 Bacteria 1358
317 Ga0207669_10706728 3300025937 Bacteria 829
318 Ga0207704_10123155 3300025938 Bacteria 1779
319 Ga0207704_10360672 3300025938 Bacteria 1135
320 Ga0207711_10003202 3300025941 Bacteria 14267
321 Ga0207711_10072905 3300025941 Bacteria 2984
322 Ga0207711_10083459 3300025941 Bacteria 2795
323 Ga0207711_10155504 3300025941 Bacteria 2066
324 Ga0207689_10071262 3300025942 Unclassified 2854
325 Ga0207689_10248890 3300025942 Bacteria 1470
326 Ga0207689_10499336 3300025942 Bacteria 1019
327 Ga0207661_10000050 3300025944 Bacteria 93646
328 Ga0207661_10009147 3300025944 Bacteria 7102
329 Ga0207661_10096848 3300025944 Bacteria 2469
330 Ga0207661_10116668 3300025944 Bacteria 2267
331 Ga0207661_10129024 3300025944 Bacteria 2163
332 Ga0207661_10688429 3300025944 Bacteria 940
333 Ga0207661_10921544 3300025944 Bacteria 805
334 Ga0207679_10040965 3300025945 Bacteria 3319
335 Ga0207667_10000289 3300025949 Bacteria 69596
336 Ga0207667_10000366 3300025949 Bacteria 61008
337 Ga0207667_10002897 3300025949 Bacteria 21302
338 Ga0207651_10035308 3300025960 Bacteria 3249
339 Ga0207651_10332376 3300025960 Unclassified 1274
340 Ga0207651_10487114 3300025960 Bacteria 1064
341 Ga0207712_10225761 3300025961 Bacteria 1500
342 Ga0207712_10328674 3300025961 Bacteria 1264
343 Ga0207640_10363789 3300025981 Bacteria 1166
344 Ga0207658_10318678 3300025986 Bacteria 1345
345 Ga0207677_10170366 3300026023 Bacteria 1702
346 Ga0207677_10767515 3300026023 Bacteria 861
347 Ga0207703_10021337 3300026035 Bacteria 5071
348 Ga0207703_10042653 3300026035 Bacteria 3639
349 Ga0207703_10045610 3300026035 Bacteria 3527
350 Ga0207703_10114196 3300026035 Bacteria 2309
351 Ga0207703_10429553 3300026035 Bacteria 1231
352 Ga0207703_10614832 3300026035 Bacteria 1029
353 Ga0207639_10105714 3300026041 Bacteria 2284
354 Ga0207639_10136187 3300026041 Bacteria 2040
355 Ga0207639_10588481 3300026041 Bacteria 1025
356 Ga0207639_10845054 3300026041 Bacteria 854
357 Ga0207702_10001608 3300026078 Bacteria 22348
358 Ga0207702_10010570 3300026078 Bacteria 7714
359 Ga0207702_10037590 3300026078 Bacteria 4053
360 Ga0207702_10503752 3300026078 Bacteria 1181
361 Ga0207702_10522044 3300026078 Bacteria 1159
362 Ga0207702_11499608 3300026078 Bacteria 668
363 Ga0207702_11669416 3300026078 Unclassified 630
364 Ga0207641_10070974 3300026088 Bacteria 2994
365 Ga0207648_10069640 3300026089 Bacteria 3065
366 Ga0207648_10103756 3300026089 Bacteria 2493
367 Ga0207676_10014498 3300026095 Bacteria 5673
368 Ga0207674_10000287 3300026116 Bacteria 63851
369 Ga0207674_10005796 3300026116 Bacteria 14656
370 Ga0207674_10014049 3300026116 Bacteria 8848
371 Ga0207674_10079089 3300026116 Bacteria 3293
372 Ga0207674_10316864 3300026116 Bacteria 1509
373 Ga0207674_10454327 3300026116 Bacteria 1238
374 Ga0207675_100442416 3300026118 Bacteria 1287
375 Ga0207675_100728964 3300026118 Bacteria 1001
376 Ga0207698_10008682 3300026142 Bacteria 6441
377 Ga0207698_10091543 3300026142 Bacteria 2490
378 Ga0268266_10508799 3300028379 Bacteria 1150
379 Ga0268264_10031492 3300028381 Bacteria 4347
380 Ga0268264_10059233 3300028381 Bacteria 3208
381 Ga0265338_10087121 3300028800 Bacteria 2596
382 Ga0265338_10808074 3300028800 Bacteria 642
383 Ga0265762_1053610 3300030760 Bacteria 815
384 Ga0265330_10162561 3300031235 Bacteria 948
385 Ga0265325_10001493 3300031241 Bacteria 16453
386 Ga0265339_10343117 3300031249 Bacteria 705
387 Ga0265316_10175745 3300031344 Bacteria 1596
388 Ga0265316_10480451 3300031344 Bacteria 889
389 Ga0265313_10008945 3300031595 Bacteria 6574
390 Ga0265313_10288487 3300031595 Bacteria 662
391 Ga0265314_10001314 3300031711 Bacteria 28148
392 Ga0265314_10004067 3300031711 Bacteria 13797
393 Ga0265314_10081051 3300031711 Bacteria 2140
394 Ga0373934_0005091 3300035086 Bacteria 4871
395 Ga0373923_0074062 3300035111 Bacteria 1467
396 Ga0373932_0099372 3300035112 Bacteria 945
397 Ga0373953_0142698 3300035117 Bacteria 1024
398 Ga0373953_0215132 3300035117 Bacteria 832
399 Ga0373953_0254571 3300035117 Bacteria 763
400 Ga0373954_0007001 3300035118 Bacteria 4921
401 Ga0373954_0009778 3300035118 Bacteria 4221
402 Ga0373954_0092168 3300035118 Bacteria 1456
403 Ga0373954_0118977 3300035118 Bacteria 1281
404 Ga0373957_0406463 3300035120 Bacteria 586
405 Ga0373943_0409236 3300035170 Bacteria 784
406 Ga0373946_0140658 3300035171 Bacteria 1118
407 Ga0373955_0040310 3300035172 Bacteria 2497
408 Ga0373955_0119474 3300035172 Bacteria 1531
409 Ga0373955_0275837 3300035172 Bacteria 1011
410 Ga0373935_0021568 3300035692 Bacteria 3945
411 Ga0373935_0746339 3300035692 Bacteria 721
412 Ga0373927_0001052 3300035695 Bacteria 21044
413 Ga0373927_0043654 3300035695 Bacteria 2902
414 Ga0373927_0099976 3300035695 Bacteria 1886
415 Ga0373927_0265499 3300035695 Bacteria 1129
416 Ga0373933_0043666 3300035724 Bacteria 2653
417 Ga0373933_0336684 3300035724 Bacteria 979
418 Ga0373947_0019720 3300035725 Bacteria 3889
419 Ga0373947_0022071 3300035725 Bacteria 3689
420 Ga0373947_0370386 3300035725 Unclassified 963
421 Ga0373937_0003169 3300036401 Bacteria 13765
422 Ga0373937_0013616 3300036401 Bacteria 7166
423 Ga0373937_0016750 3300036401 Bacteria 6514
424 Ga0373937_0034987 3300036401 Bacteria 4569
425 Ga0373937_0347231 3300036401 Bacteria 1405
426 Ga0373925_0007535 3300037068 Bacteria 7936
427 Ga0373925_0032809 3300037068 Bacteria 3824
428 Ga0373925_0737094 3300037068 Bacteria 812
429 Ga0436364_0679391 3300037853 Bacteria 5241
430 Ga0436365_0039986 3300039437 Bacteria 617
431 Ga0436365_0140208 3300039437 Bacteria 1012
432 Ga0436360_0164153 3300039438 Bacteria 710
433 Ga0436362_0500233 3300039453 Bacteria 2652
434 Ga0451839_0031478 3300041496 Unclassified 551
435 Ga0451853_1752319 3300041512 Bacteria 1011
436 Ga0451577_0373427 3300042876 Unclassified 1294
437 Ga0453684_0386675 3300044712 Bacteria 1570
438 Ga0451576_0248804 3300045051 Bacteria 1858
439 Ga0451576_1077985 3300045051 Bacteria 841
440 Ga0495592_0193070 3300046454 Bacteria 1379
441 Ga0495651_0006788 3300046462 Bacteria 8744
442 Ga0495651_0341691 3300046462 Bacteria 992
443 Ga0495580_0040334 3300046472 Bacteria 3335
444 Ga0495580_0042833 3300046472 Bacteria 3223
445 Ga0495580_0118787 3300046472 Bacteria 1836
446 Ga0495580_0182981 3300046472 Unclassified 1447
447 Ga0495582_0111660 3300046473 Bacteria 1535
448 Ga0495639_0264171 3300046475 Bacteria 853
449 Ga0495664_0124848 3300046477 Bacteria 1557
450 Ga0495664_0242906 3300046477 Bacteria 1089
451 Ga0495594_0052850 3300046499 Bacteria 2237
452 Ga0495594_0131782 3300046499 Bacteria 1416
453 Ga0495628_0112435 3300046516 Bacteria 2094
454 Ga0495628_0968160 3300046516 Bacteria 587
455 Ga0495652_0361535 3300046529 Bacteria 1037
456 Ga0495652_0386103 3300046529 Bacteria 995
457 Ga0495665_0181422 3300046531 Bacteria 1094
458 Ga0495640_0101838 3300046533 Bacteria 1885
459 Ga0495640_0286173 3300046533 Unclassified 1026
460 Ga0495640_0496495 3300046533 Bacteria 743
461 Ga0495586_0209246 3300046535 Bacteria 1107
462 Ga0495586_0239630 3300046535 Bacteria 1034
463 Ga0495586_0368824 3300046535 Bacteria 825
464 Ga0495587_0001067 3300046536 Bacteria 18013
465 Ga0495667_0003301 3300046559 Bacteria 10817
466 Ga0495667_0131856 3300046559 Bacteria 1612
467 Ga0495588_0275195 3300046674 Bacteria 887
468 Ga0495599_0003545 3300046678 Bacteria 9140
469 Ga0495599_0014149 3300046678 Bacteria 4939
470 Ga0495599_0408340 3300046678 Bacteria 808
471 Ga0495658_0003851 3300046683 Bacteria 7428
472 Ga0495658_0015665 3300046683 Bacteria 3892
473 Ga0495613_0043209 3300046689 Bacteria 3334
474 Ga0495613_0223067 3300046689 Bacteria 1323
475 Ga0495613_0666650 3300046689 Bacteria 687
476 Ga0495636_0042493 3300047318 Bacteria 1889
477 Ga0495674_0041355 3300047319 Bacteria 4118
478 Ga0495674_0045905 3300047319 Bacteria 3879
479 Ga0495674_0221674 3300047319 Bacteria 1563
480 Ga0495674_0302093 3300047319 Bacteria 1307
481 Ga0495680_0357801 3300047322 Bacteria 1015
482 Ga0495680_0648396 3300047322 Bacteria 702
483 Ga0495675_0069088 3300047444 Bacteria 2231
484 Ga0495684_0001707 3300047471 Bacteria 17670
485 Ga0495684_0019177 3300047471 Bacteria 5265
486 Ga0495684_0021916 3300047471 Bacteria 4919
487 Ga0495602_0005788 3300048088 Bacteria 12974
488 Ga0495602_0047305 3300048088 Bacteria 3877
489 Ga0495602_0242971 3300048088 Bacteria 1346
490 Ga0495602_0327534 3300048088 Bacteria 1112
491 Ga0495602_0427779 3300048088 Bacteria 939
492 Ga0496104_0195981 3300048907 Bacteria 1932
493 Ga0496112_0153164 3300048915 Bacteria 2273
494 Ga0496112_0466728 3300048915 Bacteria 1200
495 Ga0496115_0124354 3300048918 Bacteria 2124
496 Ga0496115_0373432 3300048918 Bacteria 1161
497 Ga0501047_0277324 3300049581 Bacteria 1522
498 Ga0501080_0279456 3300049742 Bacteria 1518
499 Ga0501044_0007391 3300049823 Bacteria 12084
500 nmdc:mga06r32_972760_c1 3300050510 Bacteria 802
501 nmdc:mga08y16_579323_c1 3300050511 Bacteria 1133
502 nmdc:mga0rr50_800647_c1 3300050513 Bacteria 804
503 Ga0495595_0175900 3300053084 Bacteria 1061
504 Ga0500568_0001519 3300053139 Bacteria 14784
505 Ga0105245_10074206
506 Ga0070658_11118694
507 Ga0070683_100000049
508 Ga0070683_100000283
509 Ga0070683_100028441
510 Ga0070683_100061376
511 Ga0070683_100163796
512 Ga0070683_100625140
513 Ga0068869_100107260
514 Ga0068869_100167819
515 Ga0070666_10003740
516 Ga0070666_10162596
517 Ga0070666_10259832
518 Ga0070680_100001131
519 Ga0068868_100210540
520 Ga0068868_100376836
521 Ga0068868_101133359
522 Ga0070660_100009373
523 Ga0070660_100157010
524 Ga0070689_100857138
525 Ga0070691_10001045
526 Ga0070669_100083708
527 Ga0070675_100405906
528 Ga0070671_100169283
529 Ga0070671_100332107
530 Ga0070674_100986544
531 Ga0070673_100248269
532 Ga0070673_100403129
533 Ga0070673_100449330
534 Ga0070659_100093932
535 Ga0070659_100176879
536 Ga0070667_100408399
537 Ga0070667_100473650
538 Ga0070709_10083008
539 Ga0070713_100035693
540 Ga0070713_100116665
541 Ga0070713_100158897
542 Ga0070711_100168578
543 Ga0070711_100314513
544 Ga0070700_100300047
545 Ga0070708_100278187
546 Ga0070708_100394467
547 Ga0070681_10000846
548 Ga0070681_10002931
549 Ga0070681_10049129
550 Ga0070681_10054409
551 Ga0070681_10063295
552 Ga0070681_10278689
553 Ga0070681_10585511
554 Ga0070681_10897475
555 Ga0068867_100053843
556 Ga0068867_100688866
557 Ga0070685_10624309
558 Ga0070698_101864215
559 Ga0070699_100329013
560 Ga0070679_100001786
561 Ga0070679_100241832
562 Ga0070679_100262217
563 Ga0070684_100000040
564 Ga0070684_100005904
565 Ga0070684_100021122
566 Ga0070684_100052878
567 Ga0070684_100144365
568 Ga0070684_100264662
569 Ga0070684_100367670
570 Ga0068853_100035208
571 Ga0070686_100608654
572 Ga0070696_100001840
573 Ga0070696_100608738
574 Ga0070693_100096330
575 Ga0068855_100001008
576 Ga0068855_100029002
577 Ga0068855_100035012
578 Ga0068855_100368966
579 Ga0068855_100913497
580 Ga0070664_100099850
581 Ga0070664_100328088
582 Ga0068857_100000138
583 Ga0068857_100004199
584 Ga0068857_100037568
585 Ga0068857_100084773
586 Ga0068857_100556994
587 Ga0068854_100106431
588 Ga0068854_100477590
589 Ga0068856_100001054
590 Ga0068856_100033027
591 Ga0068856_100050537
592 Ga0068856_100063288
593 Ga0068856_100065789
594 Ga0068856_100473205
595 Ga0068852_100060648
596 Ga0068852_100592487
597 Ga0068852_100882818
598 Ga0068859_100018469
599 Ga0068859_100067129
600 Ga0068864_100015460
601 Ga0068866_10066756
602 Ga0068870_10195445
603 Ga0068863_100067679
604 Ga0068858_100015461
605 Ga0068858_100023738
606 Ga0068858_100060070
607 Ga0068858_100110475
608 Ga0068858_100214285
609 Ga0068858_101336112
610 Ga0068860_100044578
611 Ga0068860_100209902
612 Ga0068860_100260133
613 Ga0068860_100363647
614 Ga0068860_100607853
615 Ga0070716_100856783
616 Ga0097621_100017410
617 Ga0097621_100048273
618 Ga0097621_100161584
619 Ga0097621_100209070
620 Ga0097621_100459077
621 Ga0068871_100069741
622 Ga0068871_100070385
623 Ga0068871_100080144
624 Ga0068871_100187356
625 Ga0068871_100250312
626 Ga0068871_100251195
627 Ga0068871_100272371
628 Ga0075428_101013059
629 Ga0075428_101326905
630 Ga0075431_100020442
631 Ga0075433_10203679
632 Ga0075434_100440840
633 Ga0068865_100006171
634 Ga0068865_100392450
635 Ga0097620_100018469
636 Ga0097620_100067134
637 Ga0105240_10005774
638 Ga0105240_10018153
639 Ga0105240_10093693
640 Ga0105240_10202472
641 Ga0105240_10209769
642 Ga0105240_10402113
643 Ga0111539_10314397
644 Ga0105245_10000447
645 Ga0105245_10004270
646 Ga0105245_10006915
647 Ga0105245_10090620
648 Ga0105245_10107734
649 Ga0105245_11382255
650 Ga0105247_10027024
651 Ga0114129_10059331
652 Ga0114129_10099622
653 Ga0105243_10199804
654 Ga0105243_10254471
655 Ga0105241_10002879
656 Ga0105241_10034677
657 Ga0105241_10636256
658 Ga0105242_10005927
659 Ga0105242_10008793
660 Ga0105242_10174260
661 Ga0105242_10177000
662 Ga0105242_10219206
663 Ga0105242_10357159
664 Ga0105242_10812340
665 Ga0105242_11870269
666 Ga0105248_10006069
667 Ga0105248_10027929
668 Ga0105248_10067915
669 Ga0105248_10756271
670 Ga0105248_10892145
671 Ga0105248_11280309
672 Ga0105237_10015937
673 Ga0105237_10061775
674 Ga0105237_10095322
675 Ga0105237_10132363
676 Ga0105237_10848066
677 Ga0105238_10003373
678 Ga0105238_10059194
679 Ga0105238_10071375
680 Ga0105238_10105197
681 Ga0105238_10983545
682 Ga0105249_10046702
683 Ga0105249_10161425
684 Ga0105249_10319630
685 Ga0105239_10001184
686 Ga0105239_10015588
687 Ga0105239_10023709
688 Ga0105239_10158453
689 Ga0105239_10229935
690 Ga0105239_10252077
691 Ga0105239_10296797
692 Ga0105239_10614606
693 Ga0105239_11104746
694 Ga0105246_10035496
695 Ga0105246_10091108
696 Ga0105246_10130933
697 Ga0105246_10258116
698 Ga0105246_10376108
699 Ga0157370_10003327
700 Ga0157370_10044597
701 Ga0157370_10548891
702 Ga0157369_10003253
703 Ga0157369_10057362
704 Ga0157369_10272523
705 Ga0157369_10451429
706 Ga0157369_10470932
707 Ga0157369_10582392
708 Ga0157369_11014891
709 Ga0157374_10041797
710 Ga0157374_10056318
711 Ga0157374_10123673
712 Ga0157374_10187946
713 Ga0157374_10414829
714 Ga0157378_10003109
715 Ga0157378_10006879
716 Ga0157378_10437112
717 Ga0157378_10609070
718 Ga0157378_11205208
719 Ga0163162_10005957
720 Ga0163162_10097671
721 Ga0163162_11837161
722 Ga0157372_10004072
723 Ga0157372_10266912
724 Ga0157372_10373992
725 Ga0157372_11521163
726 Ga0157372_11925806
727 Ga0157372_12032822
728 Ga0157375_10011394
729 Ga0157375_10060439
730 Ga0157375_10307828
731 Ga0157375_10337084
732 Ga0157375_10392588
733 Ga0157375_10548572
734 Ga0157375_10572301
735 Ga0163163_10000755
736 Ga0163163_10069658
737 Ga0163163_10133283
738 Ga0163163_10203110
739 Ga0163163_11157597
740 Ga0163163_12508124
741 Ga0157380_10621951
742 Ga0157379_11359789
743 Ga0157376_10082610
744 Ga0157376_10115358
745 Ga0163161_10496329
746 Ga0206355_1149239
747 Ga0206350_10129919
748 Ga0206350_10334689
749 Ga0213873_10020775
750 Ga0213876_10038222
751 Ga0213875_10138717
752 Ga0207642_10181010
753 Ga0207642_10325934
754 Ga0207680_10012969
755 Ga0207680_10191473
756 Ga0207680_10486477
757 Ga0207699_10304098
758 Ga0207645_10341680
759 Ga0207705_10148589
760 Ga0207705_10409978
761 Ga0207654_10001564
762 Ga0207654_10024552
763 Ga0207654_10211008
764 Ga0207707_10002719
765 Ga0207707_10011071
766 Ga0207707_10077159
767 Ga0207707_10221903
768 Ga0207707_10484323
769 Ga0207707_10831005
770 Ga0207695_10000264
771 Ga0207695_10007930
772 Ga0207695_10014578
773 Ga0207695_10106729
774 Ga0207695_10298703
775 Ga0207695_10319115
776 Ga0207695_10339159
777 Ga0207671_10037575
778 Ga0207671_10046292
779 Ga0207671_10065649
780 Ga0207693_10488186
781 Ga0207663_10149283
782 Ga0207663_10434129
783 Ga0207663_11085704
784 Ga0207660_10002806
785 Ga0207660_10364700
786 Ga0207660_10510999
787 Ga0207657_10139642
788 Ga0207657_10532263
789 Ga0207649_11117404
790 Ga0207652_10006919
791 Ga0207652_10235040
792 Ga0207652_10550691
793 Ga0207694_10000915
794 Ga0207694_10012556
795 Ga0207694_10090068
796 Ga0207694_10123235
797 Ga0207694_10138653
798 Ga0207687_10000964
799 Ga0207687_10019614
800 Ga0207687_10046605
801 Ga0207687_10050905
802 Ga0207687_10071116
803 Ga0207687_10080193
804 Ga0207687_10300788
805 Ga0207700_10074459
806 Ga0207700_10106142
807 Ga0207644_10046867
808 Ga0207690_10232153
809 Ga0207690_10469972
810 Ga0207706_10056707
811 Ga0207686_10059539
812 Ga0207686_10101246
813 Ga0207686_10130176
814 Ga0207686_10137889
815 Ga0207686_10290812
816 Ga0207709_10013421
817 Ga0207709_10039625
818 Ga0207709_10714023
819 Ga0207670_10579311
820 Ga0207669_10233840
821 Ga0207669_10706728
822 Ga0207704_10123155
823 Ga0207704_10360672
824 Ga0207711_10003202
825 Ga0207711_10072905
826 Ga0207711_10083459
827 Ga0207711_10155504
828 Ga0207689_10071262
829 Ga0207689_10248890
830 Ga0207689_10499336
831 Ga0207661_10000050
832 Ga0207661_10009147
833 Ga0207661_10096848
834 Ga0207661_10116668
835 Ga0207661_10129024
836 Ga0207661_10688429
837 Ga0207661_10921544
838 Ga0207679_10040965
839 Ga0207667_10000289
840 Ga0207667_10000366
841 Ga0207667_10002897
842 Ga0207651_10035308
843 Ga0207651_10332376
844 Ga0207651_10487114
845 Ga0207712_10225761
846 Ga0207712_10328674
847 Ga0207640_10363789
848 Ga0207658_10318678
849 Ga0207677_10170366
850 Ga0207677_10767515
851 Ga0207703_10021337
852 Ga0207703_10042653
853 Ga0207703_10045610
854 Ga0207703_10114196
855 Ga0207703_10429553
856 Ga0207703_10614832
857 Ga0207639_10105714
858 Ga0207639_10136187
859 Ga0207639_10588481
860 Ga0207639_10845054
861 Ga0207702_10001608
862 Ga0207702_10010570
863 Ga0207702_10037590
864 Ga0207702_10503752
865 Ga0207702_10522044
866 Ga0207702_11499608
867 Ga0207702_11669416
868 Ga0207641_10070974
869 Ga0207648_10069640
870 Ga0207648_10103756
871 Ga0207676_10014498
872 Ga0207674_10000287
873 Ga0207674_10005796
874 Ga0207674_10014049
875 Ga0207674_10079089
876 Ga0207674_10316864
877 Ga0207674_10454327
878 Ga0207675_100442416
879 Ga0207675_100728964
880 Ga0207698_10008682
881 Ga0207698_10091543
882 Ga0268266_10508799
883 Ga0268264_10031492
884 Ga0268264_10059233
885 Ga0265338_10087121
886 Ga0265338_10808074
887 Ga0265762_1053610
888 Ga0265330_10162561
889 Ga0265325_10001493
890 Ga0265339_10343117
891 Ga0265316_10175745
892 Ga0265316_10480451
893 Ga0265313_10008945
894 Ga0265313_10288487
895 Ga0265314_10001314
896 Ga0265314_10004067
897 Ga0265314_10081051
898 Ga0373934_0005091
899 Ga0373923_0074062
900 Ga0373932_0099372
901 Ga0373953_0142698
902 Ga0373953_0215132
903 Ga0373953_0254571
904 Ga0373954_0007001
905 Ga0373954_0009778
906 Ga0373954_0092168
907 Ga0373954_0118977
908 Ga0373957_0406463
909 Ga0373943_0409236
910 Ga0373946_0140658
911 Ga0373955_0040310
912 Ga0373955_0119474
913 Ga0373955_0275837
914 Ga0373935_0021568
915 Ga0373935_0746339
916 Ga0373927_0001052
917 Ga0373927_0043654
918 Ga0373927_0099976
919 Ga0373927_0265499
920 Ga0373933_0043666
921 Ga0373933_0336684
922 Ga0373947_0019720
923 Ga0373947_0022071
924 Ga0373947_0370386
925 Ga0373937_0003169
926 Ga0373937_0013616
927 Ga0373937_0016750
928 Ga0373937_0034987
929 Ga0373937_0347231
930 Ga0373925_0007535
931 Ga0373925_0032809
932 Ga0373925_0737094
933 Ga0436364_0679391
934 Ga0436365_0039986
935 Ga0436365_0140208
936 Ga0436360_0164153
937 Ga0436362_0500233
938 Ga0451839_0031478
939 Ga0451853_1752319
940 Ga0451577_0373427
941 Ga0453684_0386675
942 Ga0451576_0248804
943 Ga0451576_1077985
944 Ga0495592_0193070
945 Ga0495651_0006788
946 Ga0495651_0341691
947 Ga0495580_0040334
948 Ga0495580_0042833
949 Ga0495580_0118787
950 Ga0495580_0182981
951 Ga0495582_0111660
952 Ga0495639_0264171
953 Ga0495664_0124848
954 Ga0495664_0242906
955 Ga0495594_0052850
956 Ga0495594_0131782
957 Ga0495628_0112435
958 Ga0495628_0968160
959 Ga0495652_0361535
960 Ga0495652_0386103
961 Ga0495665_0181422
962 Ga0495640_0101838
963 Ga0495640_0286173
964 Ga0495640_0496495
965 Ga0495586_0209246
966 Ga0495586_0239630
967 Ga0495586_0368824
968 Ga0495587_0001067
969 Ga0495667_0003301
970 Ga0495667_0131856
971 Ga0495588_0275195
972 Ga0495599_0003545
973 Ga0495599_0014149
974 Ga0495599_0408340
975 Ga0495658_0003851
976 Ga0495658_0015665
977 Ga0495613_0043209
978 Ga0495613_0223067
979 Ga0495613_0666650
980 Ga0495636_0042493
981 Ga0495674_0041355
982 Ga0495674_0045905
983 Ga0495674_0221674
984 Ga0495674_0302093
985 Ga0495680_0357801
986 Ga0495680_0648396
987 Ga0495675_0069088
988 Ga0495684_0001707
989 Ga0495684_0019177
990 Ga0495684_0021916
991 Ga0495602_0005788
992 Ga0495602_0047305
993 Ga0495602_0242971
994 Ga0495602_0327534
995 Ga0495602_0427779
996 Ga0496104_0195981
997 Ga0496112_0153164
998 Ga0496112_0466728
999 Ga0496115_0124354
1000 Ga0496115_0373432
1001 Ga0501047_0277324
1002 Ga0501080_0279456
1003 Ga0501044_0007391
1004 nmdc:mga06r32_972760_c1
1005 nmdc:mga08y16_579323_c1
1006 nmdc:mga0rr50_800647_c1
1007 Ga0495595_0175900
1008 Ga0500568_0001519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map