F455895

General Info

Members Datasets Scaffolds Average Seq Length
502 246 1004 285

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0212137|Ga0466959_0212137_161_1111
Length 316
Sequence VEPGAAAVFGTFLGRACAYTIIETEAPMKRRDFLVRSACGLGAAWLSSHPFATNLLGQSLPRRFAASDTVTLGKTGIKTSRLAMGTGTVGFGHTSHQSSMGIKGLSELLLNGYDHGLRFFDTADAYGSHPHVAEAIRQLPRDKVTVMTKTWARDPQTARADLDRFRRELKTDYLDICLMHCLTEGDWTTRFRGVMDVFSEAKEKGIIRSHGCSCHSIEALRAAAKSPWVEVDLVRMNPIGSHMDAEPETVAGVIREMRAAGKGIIGMKILGQGDLRNRQDEALKFALSLGTLDAFTIGAESKTEQEDLIRRISAVA

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
119 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
120 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
194 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.57
Rhizosphere 91.83
Stem 0
Stem Tuber 0
Unclassified 16.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0212137 3300045049 Bacteria 1345
2 JGI24743J22301_10023558 3300001991 Unclassified 1185
3 JGI24034J26672_10005872 3300002239 Bacteria 1766
4 JGI24751J29686_10035705 3300002459 Bacteria 1030
5 Ga0065712_10208597 3300005290 Bacteria 1081
6 Ga0070658_10010860 3300005327 Bacteria 7303
7 Ga0070658_10305360 3300005327 Bacteria 1357
8 Ga0070676_10017445 3300005328 Bacteria 3973
9 Ga0070683_100035908 3300005329 Bacteria 4533
10 Ga0070683_100188618 3300005329 Bacteria 1957
11 Ga0070690_100008718 3300005330 Bacteria 5851
12 Ga0070690_100034484 3300005330 Bacteria 3171
13 Ga0070670_100058225 3300005331 Bacteria 3317
14 Ga0070670_100228783 3300005331 Viruses 1618
15 Ga0068869_100014996 3300005334 Bacteria 5185
16 Ga0068869_100037127 3300005334 Bacteria 3463
17 Ga0068869_100288664 3300005334 Bacteria 1321
18 Ga0070666_10018570 3300005335 Bacteria 4474
19 Ga0070666_10128974 3300005335 Bacteria 1756
20 Ga0070680_100028132 3300005336 Unclassified 4508
21 Ga0070682_100020908 3300005337 Unclassified 3856
22 Ga0070682_100446092 3300005337 Unclassified 990
23 Ga0068868_100015450 3300005338 Bacteria 5647
24 Ga0068868_100021261 3300005338 Bacteria 4886
25 Ga0068868_100097509 3300005338 Unclassified 2376
26 Ga0070660_100032083 3300005339 Bacteria 3950
27 Ga0070660_100037336 3300005339 Bacteria 3683
28 Ga0070689_100057732 3300005340 Unclassified 3013
29 Ga0070691_10063684 3300005341 Bacteria 1778
30 Ga0070687_100012083 3300005343 Bacteria 3800
31 Ga0070661_100114577 3300005344 Bacteria 2015
32 Ga0070668_100135608 3300005347 Bacteria 1979
33 Ga0070668_100226204 3300005347 Viruses 1545
34 Ga0070669_100003643 3300005353 Bacteria 11111
35 Ga0070675_100026112 3300005354 Bacteria 4685
36 Ga0070675_100092215 3300005354 Bacteria 2539
37 Ga0070671_100048427 3300005355 Bacteria 3534
38 Ga0070674_100325023 3300005356 Bacteria 1234
39 Ga0070674_100335093 3300005356 Viruses 1217
40 Ga0070673_100089967 3300005364 Viruses 2507
41 Ga0070673_100163355 3300005364 Bacteria 1895
42 Ga0070673_100327109 3300005364 Bacteria 1355
43 Ga0070688_100011460 3300005365 Bacteria 4926
44 Ga0070659_100036620 3300005366 Bacteria 3825
45 Ga0070659_100180249 3300005366 Bacteria 1733
46 Ga0070667_100015454 3300005367 Bacteria 6312
47 Ga0070667_100075454 3300005367 Viruses 2878
48 Ga0070667_100193164 3300005367 Bacteria 1804
49 Ga0070703_10021471 3300005406 Unclassified 1887
50 Ga0070709_10092875 3300005434 Bacteria 1994
51 Ga0070714_100130520 3300005435 Bacteria 2245
52 Ga0070713_100102427 3300005436 Bacteria 2483
53 Ga0070710_10008926 3300005437 Bacteria 4895
54 Ga0070710_10017864 3300005437 Unclassified 3641
55 Ga0070710_10049252 3300005437 Bacteria 2356
56 Ga0070701_10194567 3300005438 Bacteria 1195
57 Ga0070711_100000262 3300005439 Bacteria 27016
58 Ga0070711_100002368 3300005439 Bacteria 10722
59 Ga0070711_100010580 3300005439 Bacteria 5713
60 Ga0070711_100036555 3300005439 Bacteria 3290
61 Ga0070705_100004858 3300005440 Bacteria 6542
62 Ga0070694_100014615 3300005444 Unclassified 4916
63 Ga0070708_100000435 3300005445 Bacteria 31161
64 Ga0070708_100000443 3300005445 Bacteria 30954
65 Ga0070708_100000564 3300005445 Bacteria 27744
66 Ga0070663_100116302 3300005455 Bacteria 2015
67 Ga0070663_100267187 3300005455 Bacteria 1359
68 Ga0070678_100147619 3300005456 Bacteria 1890
69 Ga0070678_100525208 3300005456 Unclassified 1048
70 Ga0070662_100010036 3300005457 Bacteria 6203
71 Ga0070662_100024944 3300005457 Bacteria 4125
72 Ga0070662_100060093 3300005457 Bacteria 2770
73 Ga0070681_10022178 3300005458 Bacteria 6373
74 Ga0070681_10186269 3300005458 Unclassified 1996
75 Ga0068867_100061744 3300005459 Bacteria 2783
76 Ga0068867_100091254 3300005459 Bacteria 2312
77 Ga0070685_10001402 3300005466 Bacteria 12647
78 Ga0070706_100000706 3300005467 Bacteria 37581
79 Ga0070706_100000882 3300005467 Bacteria 32908
80 Ga0070706_100003850 3300005467 Bacteria 14663
81 Ga0070706_100008394 3300005467 Bacteria 9625
82 Ga0070707_100000605 3300005468 Bacteria 36094
83 Ga0070707_100011527 3300005468 Bacteria 8244
84 Ga0070707_100083412 3300005468 Bacteria 3088
85 Ga0070707_100087674 3300005468 Bacteria 3010
86 Ga0070707_100222117 3300005468 Unclassified 1839
87 Ga0070707_100243863 3300005468 Bacteria 1749
88 Ga0070698_100000377 3300005471 Bacteria 46568
89 Ga0070698_100003037 3300005471 Bacteria 18494
90 Ga0070698_100005090 3300005471 Bacteria 14398
91 Ga0070699_100001736 3300005518 Bacteria 19896
92 Ga0070699_100079276 3300005518 Unclassified 2860
93 Ga0070699_100100040 3300005518 Bacteria 2541
94 Ga0070699_100174484 3300005518 Bacteria 1905
95 Ga0070699_100263914 3300005518 Unclassified 1540
96 Ga0070679_100013741 3300005530 Bacteria 7756
97 Ga0070679_100026899 3300005530 Bacteria 5657
98 Ga0070684_100002100 3300005535 Bacteria 14672
99 Ga0070697_100000190 3300005536 Bacteria 50723
100 Ga0070697_100000199 3300005536 Bacteria 49135
101 Ga0070697_100000828 3300005536 Bacteria 23193
102 Ga0070697_100003283 3300005536 Bacteria 12422
103 Ga0070697_100008208 3300005536 Bacteria 8152
104 Ga0070697_100075559 3300005536 Unclassified 2770
105 Ga0070697_100287494 3300005536 Bacteria 1412
106 Ga0068853_100106171 3300005539 Unclassified 2488
107 Ga0068853_100138395 3300005539 Bacteria 2184
108 Ga0070672_100016712 3300005543 Bacteria 5260
109 Ga0070686_100005745 3300005544 Bacteria 6877
110 Ga0070686_100007153 3300005544 Bacteria 6220
111 Ga0070695_100006287 3300005545 Bacteria 7018
112 Ga0070695_100017746 3300005545 Bacteria 4318
113 Ga0070696_100005191 3300005546 Bacteria 8705
114 Ga0070696_100199514 3300005546 Unclassified 1493
115 Ga0070693_100000024 3300005547 Bacteria 58381
116 Ga0070693_100019782 3300005547 Bacteria 3538
117 Ga0070665_100032032 3300005548 Bacteria 5292
118 Ga0070665_100038496 3300005548 Bacteria 4807
119 Ga0070665_100435680 3300005548 Bacteria 1320
120 Ga0070704_100033604 3300005549 Unclassified 3469
121 Ga0070704_100130143 3300005549 Bacteria 1949
122 Ga0068855_100039493 3300005563 Bacteria 5603
123 Ga0068855_100129597 3300005563 Unclassified 2881
124 Ga0068855_100592477 3300005563 Bacteria 1196
125 Ga0068857_100080775 3300005577 Unclassified 2903
126 Ga0068857_100084699 3300005577 Bacteria 2833
127 Ga0068854_100008137 3300005578 Bacteria 6728
128 Ga0068854_100074054 3300005578 Bacteria 2497
129 Ga0068856_100021655 3300005614 Bacteria 6247
130 Ga0068856_100049275 3300005614 Bacteria 4151
131 Ga0068856_100162627 3300005614 Viruses 2243
132 Ga0068856_100307968 3300005614 Unclassified 1602
133 Ga0068856_100492820 3300005614 Unclassified 1246
134 Ga0070702_100308099 3300005615 Bacteria 1098
135 Ga0068852_100015730 3300005616 Bacteria 5880
136 Ga0068852_100029718 3300005616 Bacteria 4491
137 Ga0068859_100015326 3300005617 Bacteria 7700
138 Ga0068859_100368232 3300005617 Bacteria 1532
139 Ga0068864_100165071 3300005618 Bacteria 2015
140 Ga0068866_10263309 3300005718 Bacteria 1061
141 Ga0068861_100009532 3300005719 Bacteria 6708
142 Ga0068851_10001362 3300005834 Bacteria 10655
143 Ga0068870_10000490 3300005840 Bacteria 14989
144 Ga0068863_100052825 3300005841 Unclassified 3850
145 Ga0068858_100138747 3300005842 Bacteria 2282
146 Ga0068860_100010146 3300005843 Bacteria 9332
147 Ga0068860_100057522 3300005843 Unclassified 3696
148 Ga0068860_100188546 3300005843 Bacteria 1995
149 Ga0068860_100318431 3300005843 Bacteria 1526
150 Ga0070717_10060201 3300006028 Bacteria 3144
151 Ga0070715_10019964 3300006163 Unclassified 2577
152 Ga0070715_10020178 3300006163 Bacteria 2567
153 Ga0070716_100005060 3300006173 Bacteria 6360
154 Ga0070716_100008904 3300006173 Bacteria 4991
155 Ga0070716_100140741 3300006173 Bacteria 1538
156 Ga0070712_100000422 3300006175 Bacteria 24266
157 Ga0070712_100002341 3300006175 Bacteria 11678
158 Ga0070712_100045391 3300006175 Unclassified 3034
159 Ga0070712_100212056 3300006175 Unclassified 1528
160 Ga0097621_100001300 3300006237 Bacteria 17185
161 Ga0097621_100048838 3300006237 Bacteria 3435
162 Ga0097621_100156938 3300006237 Bacteria 1953
163 Ga0097621_100200699 3300006237 Viruses 1731
164 Ga0097621_100427571 3300006237 Unclassified 1190
165 Ga0068871_100001558 3300006358 Bacteria 15385
166 Ga0068871_100043478 3300006358 Unclassified 3608
167 Ga0075434_100005040 3300006871 Bacteria 11996
168 Ga0075434_100087262 3300006871 Unclassified 3120
169 Ga0075434_100348648 3300006871 Bacteria 1502
170 Ga0075434_100409434 3300006871 Bacteria 1377
171 Ga0075434_100412264 3300006871 Bacteria 1372
172 Ga0068865_100012686 3300006881 Bacteria 5310
173 Ga0097620_100015326 3300006931 Bacteria 7700
174 Ga0097620_100368219 3300006931 Bacteria 1532
175 Ga0099794_10012524 3300007265 Bacteria 3663
176 Ga0099794_10034248 3300007265 Unclassified 2392
177 Ga0099794_10045014 3300007265 Bacteria 2111
178 Ga0105250_10009589 3300009092 Bacteria 4072
179 Ga0105240_10064605 3300009093 Unclassified 4547
180 Ga0105240_10145783 3300009093 Unclassified 2825
181 Ga0105240_10404005 3300009093 Bacteria 1538
182 Ga0105245_10002791 3300009098 Bacteria 15717
183 Ga0105245_10004354 3300009098 Bacteria 12531
184 Ga0105245_10030773 3300009098 Bacteria 4747
185 Ga0105245_10177233 3300009098 Bacteria 2034
186 Ga0105245_10192521 3300009098 Viruses 1954
187 Ga0105245_10423419 3300009098 Unclassified 1335
188 Ga0105247_10025404 3300009101 Unclassified 3573
189 Ga0105247_10042405 3300009101 Bacteria 2787
190 Ga0105247_10074265 3300009101 Unclassified 2132
191 Ga0105243_10064953 3300009148 Bacteria 2930
192 Ga0105241_10006319 3300009174 Bacteria 8741
193 Ga0105241_10010312 3300009174 Bacteria 6861
194 Ga0105241_10065178 3300009174 Unclassified 2814
195 Ga0105241_10065932 3300009174 Bacteria 2799
196 Ga0105242_10005528 3300009176 Bacteria 9754
197 Ga0105242_10034469 3300009176 Bacteria 4058
198 Ga0105242_10041779 3300009176 Bacteria 3700
199 Ga0105242_10156213 3300009176 Bacteria 1993
200 Ga0105248_10003198 3300009177 Bacteria 18158
201 Ga0105248_10019902 3300009177 Bacteria 7430
202 Ga0105248_10190421 3300009177 Bacteria 2311
203 Ga0105248_10613807 3300009177 Viruses 1227
204 Ga0105248_10767196 3300009177 Unclassified 1088
205 Ga0105237_10026399 3300009545 Bacteria 5935
206 Ga0105237_10031068 3300009545 Bacteria 5418
207 Ga0105237_10164822 3300009545 Bacteria 2215
208 Ga0105238_10258658 3300009551 Unclassified 1720
209 Ga0105249_10020149 3300009553 Bacteria 5958
210 Ga0105249_10066236 3300009553 Bacteria 3325
211 Ga0099796_10056814 3300010159 Unclassified 1375
212 Ga0105239_10035581 3300010375 Bacteria 5468
213 Ga0105239_10041165 3300010375 Bacteria 5063
214 Ga0105239_10179619 3300010375 Bacteria 2368
215 Ga0105239_10433902 3300010375 Bacteria 1489
216 Ga0105239_10533496 3300010375 Bacteria 1336
217 Ga0105246_10000838 3300011119 Bacteria 17539
218 Ga0105246_10046505 3300011119 Bacteria 2960
219 Ga0105246_10049846 3300011119 Bacteria 2869
220 Ga0105246_10318785 3300011119 Bacteria 1262
221 Ga0157373_10010517 3300013100 Bacteria 6808
222 Ga0157373_10255708 3300013100 Bacteria 1239
223 Ga0157371_10005669 3300013102 Bacteria 10481
224 Ga0157371_10038170 3300013102 Bacteria 3437
225 Ga0157370_10436812 3300013104 Bacteria 1204
226 Ga0157369_10053610 3300013105 Bacteria 4357
227 Ga0157369_10076933 3300013105 Bacteria 3577
228 Ga0157369_10130892 3300013105 Bacteria 2659
229 Ga0157374_10003910 3300013296 Bacteria 12512
230 Ga0157374_10006274 3300013296 Bacteria 10080
231 Ga0157374_10062222 3300013296 Unclassified 3497
232 Ga0157374_10097570 3300013296 Bacteria 2812
233 Ga0157374_10290494 3300013296 Bacteria 1616
234 Ga0157378_10001432 3300013297 Bacteria 21488
235 Ga0157378_10018552 3300013297 Bacteria 6115
236 Ga0157378_10031352 3300013297 Bacteria 4697
237 Ga0157378_10141326 3300013297 Bacteria 2236
238 Ga0163162_10002560 3300013306 Bacteria 17209
239 Ga0163162_10003471 3300013306 Bacteria 15061
240 Ga0163162_10008499 3300013306 Bacteria 10011
241 Ga0163162_10020331 3300013306 Bacteria 6522
242 Ga0163162_10054764 3300013306 Bacteria 4013
243 Ga0163162_10067377 3300013306 Viruses 3630
244 Ga0163162_10319497 3300013306 Bacteria 1685
245 Ga0157372_10013903 3300013307 Bacteria 8601
246 Ga0157372_10032108 3300013307 Bacteria 5755
247 Ga0157372_10069606 3300013307 Bacteria 3958
248 Ga0157372_10417927 3300013307 Bacteria 1563
249 Ga0163163_10001045 3300014325 Bacteria 23465
250 Ga0163163_10012273 3300014325 Bacteria 7802
251 Ga0163163_10013526 3300014325 Bacteria 7479
252 Ga0163163_10062006 3300014325 Bacteria 3705
253 Ga0163163_10101942 3300014325 Viruses 2893
254 Ga0163163_10109890 3300014325 Bacteria 2785
255 Ga0163163_10159723 3300014325 Unclassified 2299
256 Ga0157380_10094744 3300014326 Bacteria 2472
257 Ga0182008_10034600 3300014497 Bacteria 2533
258 Ga0157377_10024352 3300014745 Bacteria 3216
259 Ga0157379_10000392 3300014968 Bacteria 35411
260 Ga0157379_10071939 3300014968 Bacteria 3094
261 Ga0157379_10080578 3300014968 Bacteria 2916
262 Ga0157376_10370965 3300014969 Bacteria 1375
263 Ga0157376_10428659 3300014969 Bacteria 1285
264 Ga0182007_10017666 3300015262 Bacteria 2599
265 Ga0163161_10006556 3300017792 Bacteria 8056
266 Ga0163161_10153689 3300017792 Viruses 1750
267 Ga0206350_10251140 3300020080 Unclassified 1043
268 Ga0213874_10054964 3300021377 Bacteria 1232
269 Ga0224570_100095 3300022730 Bacteria 5279
270 Ga0224572_1000359 3300024225 Bacteria 5049
271 Ga0228598_1001725 3300024227 Unclassified 4780
272 Ga0228598_1003701 3300024227 Bacteria 3270
273 Ga0207697_10005915 3300025315 Bacteria 5616
274 Ga0207656_10019451 3300025321 Bacteria 2687
275 Ga0207653_10024999 3300025885 Unclassified 1909
276 Ga0207682_10004539 3300025893 Bacteria 5786
277 Ga0207692_10017042 3300025898 Bacteria 3232
278 Ga0207692_10024648 3300025898 Unclassified 2800
279 Ga0207710_10017189 3300025900 Unclassified 3066
280 Ga0207688_10006862 3300025901 Bacteria 6194
281 Ga0207680_10068572 3300025903 Unclassified 2188
282 Ga0207680_10134593 3300025903 Bacteria 1632
283 Ga0207647_10167235 3300025904 Viruses 1281
284 Ga0207685_10042004 3300025905 Bacteria 1714
285 Ga0207685_10077859 3300025905 Bacteria 1364
286 Ga0207699_10077316 3300025906 Bacteria 2053
287 Ga0207699_10107090 3300025906 Unclassified 1785
288 Ga0207699_10221914 3300025906 Bacteria 1290
289 Ga0207645_10001012 3300025907 Bacteria 23249
290 Ga0207645_10007451 3300025907 Bacteria 7729
291 Ga0207645_10015224 3300025907 Bacteria 5120
292 Ga0207643_10004669 3300025908 Bacteria 7350
293 Ga0207705_10018045 3300025909 Bacteria 5046
294 Ga0207684_10000419 3300025910 Bacteria 56628
295 Ga0207684_10001311 3300025910 Bacteria 27341
296 Ga0207684_10007459 3300025910 Bacteria 9843
297 Ga0207684_10020415 3300025910 Bacteria 5660
298 Ga0207684_10285529 3300025910 Bacteria 1423
299 Ga0207654_10050627 3300025911 Unclassified 2388
300 Ga0207654_10114133 3300025911 Bacteria 1685
301 Ga0207707_10018112 3300025912 Bacteria 6137
302 Ga0207707_10184846 3300025912 Unclassified 1819
303 Ga0207707_10279920 3300025912 Unclassified 1445
304 Ga0207695_10016312 3300025913 Bacteria 8697
305 Ga0207695_10065319 3300025913 Bacteria 3741
306 Ga0207693_10000509 3300025915 Bacteria 35091
307 Ga0207693_10075725 3300025915 Bacteria 2635
308 Ga0207663_10002876 3300025916 Bacteria 8321
309 Ga0207663_10006497 3300025916 Bacteria 5987
310 Ga0207663_10037735 3300025916 Bacteria 2915
311 Ga0207663_10098624 3300025916 Bacteria 1957
312 Ga0207663_10118646 3300025916 Bacteria 1807
313 Ga0207663_10159318 3300025916 Bacteria 1591
314 Ga0207660_10112237 3300025917 Unclassified 2053
315 Ga0207662_10004784 3300025918 Bacteria 7156
316 Ga0207657_10006310 3300025919 Bacteria 12318
317 Ga0207657_10010936 3300025919 Bacteria 9027
318 Ga0207649_10001017 3300025920 Bacteria 17305
319 Ga0207649_10016171 3300025920 Bacteria 4202
320 Ga0207652_10013561 3300025921 Bacteria 6592
321 Ga0207652_10055999 3300025921 Unclassified 3394
322 Ga0207646_10001253 3300025922 Bacteria 31821
323 Ga0207646_10001857 3300025922 Bacteria 25474
324 Ga0207646_10278759 3300025922 Bacteria 1511
325 Ga0207681_10078736 3300025923 Bacteria 2320
326 Ga0207694_10054546 3300025924 Unclassified 3101
327 Ga0207694_10130557 3300025924 Bacteria 2013
328 Ga0207650_10000541 3300025925 Bacteria 30916
329 Ga0207650_10015050 3300025925 Bacteria 5381
330 Ga0207650_10210474 3300025925 Viruses 1561
331 Ga0207659_10023238 3300025926 Bacteria 4135
332 Ga0207659_10615814 3300025926 Viruses 926
333 Ga0207687_10009327 3300025927 Bacteria 6420
334 Ga0207687_10042909 3300025927 Unclassified 3115
335 Ga0207687_10183576 3300025927 Unclassified 1622
336 Ga0207700_10050602 3300025928 Bacteria 3097
337 Ga0207700_10129861 3300025928 Bacteria 2056
338 Ga0207700_10167722 3300025928 Bacteria 1829
339 Ga0207664_10487267 3300025929 Bacteria 1103
340 Ga0207644_10061367 3300025931 Unclassified 2722
341 Ga0207690_10185694 3300025932 Bacteria 1568
342 Ga0207706_10000992 3300025933 Bacteria 28868
343 Ga0207706_10003206 3300025933 Bacteria 15704
344 Ga0207706_10024085 3300025933 Bacteria 5460
345 Ga0207686_10053639 3300025934 Bacteria 2522
346 Ga0207686_10156539 3300025934 Bacteria 1592
347 Ga0207709_10046598 3300025935 Bacteria 2632
348 Ga0207670_10026267 3300025936 Bacteria 3667
349 Ga0207669_10068987 3300025937 Bacteria 2210
350 Ga0207704_10037034 3300025938 Bacteria 2813
351 Ga0207704_10116465 3300025938 Bacteria 1818
352 Ga0207665_10000067 3300025939 Bacteria 67657
353 Ga0207665_10006548 3300025939 Bacteria 7723
354 Ga0207665_10033804 3300025939 Unclassified 3392
355 Ga0207665_10059447 3300025939 Bacteria 2587
356 Ga0207691_10001227 3300025940 Bacteria 25547
357 Ga0207691_10004326 3300025940 Bacteria 13791
358 Ga0207691_10178728 3300025940 Bacteria 1855
359 Ga0207711_10001668 3300025941 Bacteria 20458
360 Ga0207711_10046258 3300025941 Bacteria 3718
361 Ga0207689_10003400 3300025942 Bacteria 14535
362 Ga0207689_10023964 3300025942 Bacteria 5120
363 Ga0207689_10036556 3300025942 Bacteria 4076
364 Ga0207689_10120422 3300025942 Bacteria 2159
365 Ga0207689_10209746 3300025942 Bacteria 1609
366 Ga0207661_10000122 3300025944 Bacteria 49562
367 Ga0207661_10069386 3300025944 Bacteria 2874
368 Ga0207679_10000101 3300025945 Bacteria 71096
369 Ga0207667_10127292 3300025949 Viruses 2624
370 Ga0207667_10288041 3300025949 Bacteria 1678
371 Ga0207651_10000477 3300025960 Bacteria 16837
372 Ga0207651_10286322 3300025960 Viruses 1364
373 Ga0207712_10020836 3300025961 Bacteria 4299
374 Ga0207668_10010855 3300025972 Bacteria 5519
375 Ga0207668_10035898 3300025972 Unclassified 3306
376 Ga0207668_10230292 3300025972 Bacteria 1493
377 Ga0207640_10007043 3300025981 Bacteria 6191
378 Ga0207658_10008438 3300025986 Bacteria 7012
379 Ga0207658_10022883 3300025986 Unclassified 4354
380 Ga0207677_10004076 3300026023 Bacteria 7809
381 Ga0207677_10052887 3300026023 Bacteria 2761
382 Ga0207677_10089339 3300026023 Unclassified 2236
383 Ga0207677_10221168 3300026023 Bacteria 1519
384 Ga0207703_10023764 3300026035 Bacteria 4821
385 Ga0207703_10146654 3300026035 Bacteria 2053
386 Ga0207639_10039181 3300026041 Bacteria 3529
387 Ga0207678_10003303 3300026067 Bacteria 14535
388 Ga0207678_10013355 3300026067 Bacteria 7208
389 Ga0207702_10041356 3300026078 Bacteria 3865
390 Ga0207702_10108849 3300026078 Viruses 2460
391 Ga0207641_10000006 3300026088 Bacteria 442569
392 Ga0207641_10028068 3300026088 Unclassified 4648
393 Ga0207641_10153608 3300026088 Bacteria 2087
394 Ga0207648_10003200 3300026089 Bacteria 17243
395 Ga0207648_10029863 3300026089 Unclassified 4834
396 Ga0207676_10000155 3300026095 Bacteria 59757
397 Ga0207674_10000537 3300026116 Bacteria 49684
398 Ga0207674_10014757 3300026116 Bacteria 8618
399 Ga0207674_10029746 3300026116 Bacteria 5748
400 Ga0207675_100023552 3300026118 Bacteria 5728
401 Ga0207683_10000432 3300026121 Bacteria 38828
402 Ga0207683_10002720 3300026121 Bacteria 15439
403 Ga0207698_10031004 3300026142 Bacteria 3854
404 Ga0209588_1029314 3300027671 Bacteria 1755
405 Ga0265356_1001289 3300028017 Bacteria 3781
406 Ga0268266_10007224 3300028379 Bacteria 10045
407 Ga0268266_10093021 3300028379 Viruses 2646
408 Ga0268266_10098566 3300028379 Bacteria 2572
409 Ga0268265_10006691 3300028380 Bacteria 7802
410 Ga0268264_10024498 3300028381 Bacteria 4927
411 Ga0268264_10029086 3300028381 Bacteria 4524
412 Ga0265762_1001612 3300030760 Bacteria 4109
413 Ga0265762_1004495 3300030760 Bacteria 2496
414 Ga0265760_10000193 3300031090 Bacteria 16134
415 Ga0265760_10000690 3300031090 Bacteria 9620
416 Ga0265760_10063669 3300031090 Bacteria 1124
417 Ga0316578_10042236 3300031728 Unclassified 2643
418 Ga0316577_10053310 3300031733 Unclassified 2258
419 Ga0373930_0034649 3300034816 Bacteria 1053
420 Ga0373958_0030815 3300034819 Bacteria 1051
421 Ga0373926_0001267 3300035083 Bacteria 7613
422 Ga0373929_0052038 3300035085 Bacteria 938
423 Ga0373946_0000364 3300035171 Bacteria 14678
424 Ga0373931_0122585 3300035691 Bacteria 1487
425 Ga0373927_0000126 3300035695 Bacteria 58608
426 Ga0373947_0006819 3300035725 Bacteria 6622
427 Ga0373937_0170053 3300036401 Bacteria 2045
428 Ga0373937_0342940 3300036401 Unclassified 1415
429 Ga0316584_0015962 3300036712 Bacteria 5380
430 Ga0373925_0000551 3300037068 Bacteria 36811
431 Ga0436365_0201256 3300039437 Bacteria 1865
432 Ga0436363_0715223 3300039450 Bacteria 3729
433 Ga0436362_1247441 3300039453 Bacteria 1283
434 Ga0439448_0085962 3300042005 Bacteria 1060
435 Ga0451577_0106713 3300042876 Bacteria 2504
436 Ga0453684_0243783 3300044712 Bacteria 2068
437 Ga0451576_0026405 3300045051 Bacteria 6247
438 Ga0451576_0523531 3300045051 Bacteria 1246
439 Ga0495603_0087783 3300046455 Bacteria 1820
440 Ga0495580_0002135 3300046472 Bacteria 17339
441 Ga0495580_0030830 3300046472 Bacteria 3879
442 Ga0495580_0187809 3300046472 Unclassified 1426
443 Ga0495639_0014978 3300046475 Bacteria 3361
444 Ga0495664_0012205 3300046477 Unclassified 4864
445 Ga0495628_0043805 3300046516 Bacteria 3563
446 Ga0495630_0001981 3300046517 Bacteria 14256
447 Ga0495652_0049744 3300046529 Bacteria 3587
448 Ga0495586_0079647 3300046535 Bacteria 1799
449 Ga0495645_0051388 3300046543 Bacteria 2999
450 Ga0495645_0189145 3300046543 Unclassified 1404
451 Ga0495599_0196493 3300046678 Bacteria 1240
452 Ga0495669_0084014 3300046684 Bacteria 1464
453 Ga0495674_0043642 3300047319 Bacteria 3991
454 Ga0496100_0042292 3300048903 Unclassified 2910
455 Ga0496100_0095620 3300048903 Bacteria 2037
456 Ga0496100_0400751 3300048903 Bacteria 1045
457 Ga0496101_0031590 3300048904 Unclassified 3724
458 Ga0496101_0078388 3300048904 Bacteria 2437
459 Ga0496101_0404793 3300048904 Bacteria 1075
460 Ga0496102_0000898 3300048905 Bacteria 28227
461 Ga0496102_0015375 3300048905 Bacteria 6665
462 Ga0496102_0326481 3300048905 Bacteria 1445
463 Ga0496103_0011863 3300048906 Bacteria 5172
464 Ga0496104_0066491 3300048907 Unclassified 3423
465 Ga0496104_0077699 3300048907 Bacteria 3163
466 Ga0496104_0205469 3300048907 Bacteria 1881
467 Ga0496104_0239114 3300048907 Bacteria 1728
468 Ga0496105_0143287 3300048908 Unclassified 1966
469 Ga0496105_0350926 3300048908 Bacteria 1178
470 Ga0496106_0060281 3300048909 Unclassified 2876
471 Ga0496106_0082933 3300048909 Bacteria 2465
472 Ga0496107_0063315 3300048910 Unclassified 2680
473 Ga0496107_0322895 3300048910 Bacteria 1149
474 Ga0496108_0000258 3300048911 Bacteria 45782
475 Ga0496109_0000126 3300048912 Bacteria 77920
476 Ga0496110_0002963 3300048913 Bacteria 12869
477 Ga0496111_0003589 3300048914 Bacteria 9616
478 Ga0496112_0000081 3300048915 Bacteria 62594
479 Ga0496112_0097806 3300048915 Bacteria 2905
480 Ga0496112_0122545 3300048915 Bacteria 2570
481 Ga0496112_0236609 3300048915 Bacteria 1780
482 Ga0496112_0511419 3300048915 Unclassified 1136
483 Ga0496113_0000730 3300048916 Bacteria 16848
484 Ga0496113_0175133 3300048916 Unclassified 1700
485 Ga0496113_0175291 3300048916 Unclassified 1699
486 Ga0496114_0036361 3300048917 Bacteria 4071
487 Ga0496115_0009143 3300048918 Bacteria 7355
488 Ga0496115_0011592 3300048918 Bacteria 6611
489 Ga0496115_0055167 3300048918 Unclassified 3192
490 Ga0496115_0072429 3300048918 Bacteria 2796
491 Ga0496115_0191991 3300048918 Bacteria 1687
492 Ga0501083_0122809 3300049744 Bacteria 1703
493 nmdc:mga0n895_1502_c2 3300050512 Bacteria 15127
494 nmdc:mga0n895_165755_c1 3300050512 Unclassified 2241
495 nmdc:mga0n895_339971_c1 3300050512 Bacteria 1520
496 nmdc:mga0n895_388019_c1 3300050512 Bacteria 1413
497 nmdc:mga08x19_103557_c1 3300050514 Bacteria 1891
498 nmdc:mga08x19_6584_c1 3300050514 Bacteria 6885
499 nmdc:mga08x19_79083_c1 3300050514 Bacteria 2156
500 nmdc:mga0a205_12206_c2 3300050515 Bacteria 6350
501 Ga0495601_0130197 3300053077 Bacteria 1638
502 Ga0495612_0072390 3300053078 Bacteria 1439
503 Ga0466959_0212137
504 JGI24743J22301_10023558
505 JGI24034J26672_10005872
506 JGI24751J29686_10035705
507 Ga0065712_10208597
508 Ga0070658_10010860
509 Ga0070658_10305360
510 Ga0070676_10017445
511 Ga0070683_100035908
512 Ga0070683_100188618
513 Ga0070690_100008718
514 Ga0070690_100034484
515 Ga0070670_100058225
516 Ga0070670_100228783
517 Ga0068869_100014996
518 Ga0068869_100037127
519 Ga0068869_100288664
520 Ga0070666_10018570
521 Ga0070666_10128974
522 Ga0070680_100028132
523 Ga0070682_100020908
524 Ga0070682_100446092
525 Ga0068868_100015450
526 Ga0068868_100021261
527 Ga0068868_100097509
528 Ga0070660_100032083
529 Ga0070660_100037336
530 Ga0070689_100057732
531 Ga0070691_10063684
532 Ga0070687_100012083
533 Ga0070661_100114577
534 Ga0070668_100135608
535 Ga0070668_100226204
536 Ga0070669_100003643
537 Ga0070675_100026112
538 Ga0070675_100092215
539 Ga0070671_100048427
540 Ga0070674_100325023
541 Ga0070674_100335093
542 Ga0070673_100089967
543 Ga0070673_100163355
544 Ga0070673_100327109
545 Ga0070688_100011460
546 Ga0070659_100036620
547 Ga0070659_100180249
548 Ga0070667_100015454
549 Ga0070667_100075454
550 Ga0070667_100193164
551 Ga0070703_10021471
552 Ga0070709_10092875
553 Ga0070714_100130520
554 Ga0070713_100102427
555 Ga0070710_10008926
556 Ga0070710_10017864
557 Ga0070710_10049252
558 Ga0070701_10194567
559 Ga0070711_100000262
560 Ga0070711_100002368
561 Ga0070711_100010580
562 Ga0070711_100036555
563 Ga0070705_100004858
564 Ga0070694_100014615
565 Ga0070708_100000435
566 Ga0070708_100000443
567 Ga0070708_100000564
568 Ga0070663_100116302
569 Ga0070663_100267187
570 Ga0070678_100147619
571 Ga0070678_100525208
572 Ga0070662_100010036
573 Ga0070662_100024944
574 Ga0070662_100060093
575 Ga0070681_10022178
576 Ga0070681_10186269
577 Ga0068867_100061744
578 Ga0068867_100091254
579 Ga0070685_10001402
580 Ga0070706_100000706
581 Ga0070706_100000882
582 Ga0070706_100003850
583 Ga0070706_100008394
584 Ga0070707_100000605
585 Ga0070707_100011527
586 Ga0070707_100083412
587 Ga0070707_100087674
588 Ga0070707_100222117
589 Ga0070707_100243863
590 Ga0070698_100000377
591 Ga0070698_100003037
592 Ga0070698_100005090
593 Ga0070699_100001736
594 Ga0070699_100079276
595 Ga0070699_100100040
596 Ga0070699_100174484
597 Ga0070699_100263914
598 Ga0070679_100013741
599 Ga0070679_100026899
600 Ga0070684_100002100
601 Ga0070697_100000190
602 Ga0070697_100000199
603 Ga0070697_100000828
604 Ga0070697_100003283
605 Ga0070697_100008208
606 Ga0070697_100075559
607 Ga0070697_100287494
608 Ga0068853_100106171
609 Ga0068853_100138395
610 Ga0070672_100016712
611 Ga0070686_100005745
612 Ga0070686_100007153
613 Ga0070695_100006287
614 Ga0070695_100017746
615 Ga0070696_100005191
616 Ga0070696_100199514
617 Ga0070693_100000024
618 Ga0070693_100019782
619 Ga0070665_100032032
620 Ga0070665_100038496
621 Ga0070665_100435680
622 Ga0070704_100033604
623 Ga0070704_100130143
624 Ga0068855_100039493
625 Ga0068855_100129597
626 Ga0068855_100592477
627 Ga0068857_100080775
628 Ga0068857_100084699
629 Ga0068854_100008137
630 Ga0068854_100074054
631 Ga0068856_100021655
632 Ga0068856_100049275
633 Ga0068856_100162627
634 Ga0068856_100307968
635 Ga0068856_100492820
636 Ga0070702_100308099
637 Ga0068852_100015730
638 Ga0068852_100029718
639 Ga0068859_100015326
640 Ga0068859_100368232
641 Ga0068864_100165071
642 Ga0068866_10263309
643 Ga0068861_100009532
644 Ga0068851_10001362
645 Ga0068870_10000490
646 Ga0068863_100052825
647 Ga0068858_100138747
648 Ga0068860_100010146
649 Ga0068860_100057522
650 Ga0068860_100188546
651 Ga0068860_100318431
652 Ga0070717_10060201
653 Ga0070715_10019964
654 Ga0070715_10020178
655 Ga0070716_100005060
656 Ga0070716_100008904
657 Ga0070716_100140741
658 Ga0070712_100000422
659 Ga0070712_100002341
660 Ga0070712_100045391
661 Ga0070712_100212056
662 Ga0097621_100001300
663 Ga0097621_100048838
664 Ga0097621_100156938
665 Ga0097621_100200699
666 Ga0097621_100427571
667 Ga0068871_100001558
668 Ga0068871_100043478
669 Ga0075434_100005040
670 Ga0075434_100087262
671 Ga0075434_100348648
672 Ga0075434_100409434
673 Ga0075434_100412264
674 Ga0068865_100012686
675 Ga0097620_100015326
676 Ga0097620_100368219
677 Ga0099794_10012524
678 Ga0099794_10034248
679 Ga0099794_10045014
680 Ga0105250_10009589
681 Ga0105240_10064605
682 Ga0105240_10145783
683 Ga0105240_10404005
684 Ga0105245_10002791
685 Ga0105245_10004354
686 Ga0105245_10030773
687 Ga0105245_10177233
688 Ga0105245_10192521
689 Ga0105245_10423419
690 Ga0105247_10025404
691 Ga0105247_10042405
692 Ga0105247_10074265
693 Ga0105243_10064953
694 Ga0105241_10006319
695 Ga0105241_10010312
696 Ga0105241_10065178
697 Ga0105241_10065932
698 Ga0105242_10005528
699 Ga0105242_10034469
700 Ga0105242_10041779
701 Ga0105242_10156213
702 Ga0105248_10003198
703 Ga0105248_10019902
704 Ga0105248_10190421
705 Ga0105248_10613807
706 Ga0105248_10767196
707 Ga0105237_10026399
708 Ga0105237_10031068
709 Ga0105237_10164822
710 Ga0105238_10258658
711 Ga0105249_10020149
712 Ga0105249_10066236
713 Ga0099796_10056814
714 Ga0105239_10035581
715 Ga0105239_10041165
716 Ga0105239_10179619
717 Ga0105239_10433902
718 Ga0105239_10533496
719 Ga0105246_10000838
720 Ga0105246_10046505
721 Ga0105246_10049846
722 Ga0105246_10318785
723 Ga0157373_10010517
724 Ga0157373_10255708
725 Ga0157371_10005669
726 Ga0157371_10038170
727 Ga0157370_10436812
728 Ga0157369_10053610
729 Ga0157369_10076933
730 Ga0157369_10130892
731 Ga0157374_10003910
732 Ga0157374_10006274
733 Ga0157374_10062222
734 Ga0157374_10097570
735 Ga0157374_10290494
736 Ga0157378_10001432
737 Ga0157378_10018552
738 Ga0157378_10031352
739 Ga0157378_10141326
740 Ga0163162_10002560
741 Ga0163162_10003471
742 Ga0163162_10008499
743 Ga0163162_10020331
744 Ga0163162_10054764
745 Ga0163162_10067377
746 Ga0163162_10319497
747 Ga0157372_10013903
748 Ga0157372_10032108
749 Ga0157372_10069606
750 Ga0157372_10417927
751 Ga0163163_10001045
752 Ga0163163_10012273
753 Ga0163163_10013526
754 Ga0163163_10062006
755 Ga0163163_10101942
756 Ga0163163_10109890
757 Ga0163163_10159723
758 Ga0157380_10094744
759 Ga0182008_10034600
760 Ga0157377_10024352
761 Ga0157379_10000392
762 Ga0157379_10071939
763 Ga0157379_10080578
764 Ga0157376_10370965
765 Ga0157376_10428659
766 Ga0182007_10017666
767 Ga0163161_10006556
768 Ga0163161_10153689
769 Ga0206350_10251140
770 Ga0213874_10054964
771 Ga0224570_100095
772 Ga0224572_1000359
773 Ga0228598_1001725
774 Ga0228598_1003701
775 Ga0207697_10005915
776 Ga0207656_10019451
777 Ga0207653_10024999
778 Ga0207682_10004539
779 Ga0207692_10017042
780 Ga0207692_10024648
781 Ga0207710_10017189
782 Ga0207688_10006862
783 Ga0207680_10068572
784 Ga0207680_10134593
785 Ga0207647_10167235
786 Ga0207685_10042004
787 Ga0207685_10077859
788 Ga0207699_10077316
789 Ga0207699_10107090
790 Ga0207699_10221914
791 Ga0207645_10001012
792 Ga0207645_10007451
793 Ga0207645_10015224
794 Ga0207643_10004669
795 Ga0207705_10018045
796 Ga0207684_10000419
797 Ga0207684_10001311
798 Ga0207684_10007459
799 Ga0207684_10020415
800 Ga0207684_10285529
801 Ga0207654_10050627
802 Ga0207654_10114133
803 Ga0207707_10018112
804 Ga0207707_10184846
805 Ga0207707_10279920
806 Ga0207695_10016312
807 Ga0207695_10065319
808 Ga0207693_10000509
809 Ga0207693_10075725
810 Ga0207663_10002876
811 Ga0207663_10006497
812 Ga0207663_10037735
813 Ga0207663_10098624
814 Ga0207663_10118646
815 Ga0207663_10159318
816 Ga0207660_10112237
817 Ga0207662_10004784
818 Ga0207657_10006310
819 Ga0207657_10010936
820 Ga0207649_10001017
821 Ga0207649_10016171
822 Ga0207652_10013561
823 Ga0207652_10055999
824 Ga0207646_10001253
825 Ga0207646_10001857
826 Ga0207646_10278759
827 Ga0207681_10078736
828 Ga0207694_10054546
829 Ga0207694_10130557
830 Ga0207650_10000541
831 Ga0207650_10015050
832 Ga0207650_10210474
833 Ga0207659_10023238
834 Ga0207659_10615814
835 Ga0207687_10009327
836 Ga0207687_10042909
837 Ga0207687_10183576
838 Ga0207700_10050602
839 Ga0207700_10129861
840 Ga0207700_10167722
841 Ga0207664_10487267
842 Ga0207644_10061367
843 Ga0207690_10185694
844 Ga0207706_10000992
845 Ga0207706_10003206
846 Ga0207706_10024085
847 Ga0207686_10053639
848 Ga0207686_10156539
849 Ga0207709_10046598
850 Ga0207670_10026267
851 Ga0207669_10068987
852 Ga0207704_10037034
853 Ga0207704_10116465
854 Ga0207665_10000067
855 Ga0207665_10006548
856 Ga0207665_10033804
857 Ga0207665_10059447
858 Ga0207691_10001227
859 Ga0207691_10004326
860 Ga0207691_10178728
861 Ga0207711_10001668
862 Ga0207711_10046258
863 Ga0207689_10003400
864 Ga0207689_10023964
865 Ga0207689_10036556
866 Ga0207689_10120422
867 Ga0207689_10209746
868 Ga0207661_10000122
869 Ga0207661_10069386
870 Ga0207679_10000101
871 Ga0207667_10127292
872 Ga0207667_10288041
873 Ga0207651_10000477
874 Ga0207651_10286322
875 Ga0207712_10020836
876 Ga0207668_10010855
877 Ga0207668_10035898
878 Ga0207668_10230292
879 Ga0207640_10007043
880 Ga0207658_10008438
881 Ga0207658_10022883
882 Ga0207677_10004076
883 Ga0207677_10052887
884 Ga0207677_10089339
885 Ga0207677_10221168
886 Ga0207703_10023764
887 Ga0207703_10146654
888 Ga0207639_10039181
889 Ga0207678_10003303
890 Ga0207678_10013355
891 Ga0207702_10041356
892 Ga0207702_10108849
893 Ga0207641_10000006
894 Ga0207641_10028068
895 Ga0207641_10153608
896 Ga0207648_10003200
897 Ga0207648_10029863
898 Ga0207676_10000155
899 Ga0207674_10000537
900 Ga0207674_10014757
901 Ga0207674_10029746
902 Ga0207675_100023552
903 Ga0207683_10000432
904 Ga0207683_10002720
905 Ga0207698_10031004
906 Ga0209588_1029314
907 Ga0265356_1001289
908 Ga0268266_10007224
909 Ga0268266_10093021
910 Ga0268266_10098566
911 Ga0268265_10006691
912 Ga0268264_10024498
913 Ga0268264_10029086
914 Ga0265762_1001612
915 Ga0265762_1004495
916 Ga0265760_10000193
917 Ga0265760_10000690
918 Ga0265760_10063669
919 Ga0316578_10042236
920 Ga0316577_10053310
921 Ga0373930_0034649
922 Ga0373958_0030815
923 Ga0373926_0001267
924 Ga0373929_0052038
925 Ga0373946_0000364
926 Ga0373931_0122585
927 Ga0373927_0000126
928 Ga0373947_0006819
929 Ga0373937_0170053
930 Ga0373937_0342940
931 Ga0316584_0015962
932 Ga0373925_0000551
933 Ga0436365_0201256
934 Ga0436363_0715223
935 Ga0436362_1247441
936 Ga0439448_0085962
937 Ga0451577_0106713
938 Ga0453684_0243783
939 Ga0451576_0026405
940 Ga0451576_0523531
941 Ga0495603_0087783
942 Ga0495580_0002135
943 Ga0495580_0030830
944 Ga0495580_0187809
945 Ga0495639_0014978
946 Ga0495664_0012205
947 Ga0495628_0043805
948 Ga0495630_0001981
949 Ga0495652_0049744
950 Ga0495586_0079647
951 Ga0495645_0051388
952 Ga0495645_0189145
953 Ga0495599_0196493
954 Ga0495669_0084014
955 Ga0495674_0043642
956 Ga0496100_0042292
957 Ga0496100_0095620
958 Ga0496100_0400751
959 Ga0496101_0031590
960 Ga0496101_0078388
961 Ga0496101_0404793
962 Ga0496102_0000898
963 Ga0496102_0015375
964 Ga0496102_0326481
965 Ga0496103_0011863
966 Ga0496104_0066491
967 Ga0496104_0077699
968 Ga0496104_0205469
969 Ga0496104_0239114
970 Ga0496105_0143287
971 Ga0496105_0350926
972 Ga0496106_0060281
973 Ga0496106_0082933
974 Ga0496107_0063315
975 Ga0496107_0322895
976 Ga0496108_0000258
977 Ga0496109_0000126
978 Ga0496110_0002963
979 Ga0496111_0003589
980 Ga0496112_0000081
981 Ga0496112_0097806
982 Ga0496112_0122545
983 Ga0496112_0236609
984 Ga0496112_0511419
985 Ga0496113_0000730
986 Ga0496113_0175133
987 Ga0496113_0175291
988 Ga0496114_0036361
989 Ga0496115_0009143
990 Ga0496115_0011592
991 Ga0496115_0055167
992 Ga0496115_0072429
993 Ga0496115_0191991
994 Ga0501083_0122809
995 nmdc:mga0n895_1502_c2
996 nmdc:mga0n895_165755_c1
997 nmdc:mga0n895_339971_c1
998 nmdc:mga0n895_388019_c1
999 nmdc:mga08x19_103557_c1
1000 nmdc:mga08x19_6584_c1
1001 nmdc:mga08x19_79083_c1
1002 nmdc:mga0a205_12206_c2
1003 Ga0495601_0130197
1004 Ga0495612_0072390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

81

289

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.848 36 276
4exb-assembly1.cif.gz_A putative aldo-keto reductase from pseudomona aeruginosa 0.8363 39 276
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8355 36 276
4exb-assembly2.cif.gz_F putative aldo-keto reductase from pseudomona aeruginosa 0.8261 36 276
4exb-assembly1.cif.gz_B putative aldo-keto reductase from pseudomona aeruginosa 0.8258 36 276
ID Description Score Start End Superfamily
af_A0A0R0KVN6_7_249_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8381 42 195 3.20.20.100
af_Q9VGF2_1_211_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8262 42 195 3.20.20.100
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8235 36 276 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8026 42 272 3.20.20.100
af_Q8VZ23_56_411_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7965 42 272 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V9QF06-F1-model_v4 Aldo/keto reductase 0.9792 50 275 GO:0016491
AF-A0A2E8HJE1-F1-model_v4 Aldo/keto reductase 0.969 42 227
AF-A0A2E9MCF1-F1-model_v4 Aldo/keto reductase 0.9645 42 276 GO:0005829
GO:0016491
AF-A0A6B1ESD2-F1-model_v4 Aldo/keto reductase 0.9643 42 276 GO:0016491
AF-A0A7X9DLT5-F1-model_v4 Aldo/keto reductase 0.9618 91 277

Map