F455858

General Info

Members Datasets Scaffolds Average Seq Length
502 211 1004 217

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10006525|Ga0207662_100065252
Length 249
Sequence MRPGITDSLVGLAGPAAPRGWNINGVKSVLLAMQNESRLAVLGAGHVGPVIARLAIGAGYPVAIATSGDPDDIALITELVIPGAEPRWASDAVADADIVVLAIPLHRWTDVDPARLAGKVVIDAMNYWPASDGVLTAFENDATGSSEIVAGRLVGSAVVKALNHIGYHELEDRARPSGAPDRRASGLAGDDPAAVAAVAELTDRIGYDPVRLGGLPAGRVLQPGGPVFGQVLTVPEFERAVHQDARSLR

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.58
Rhizosphere 93.82
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10006525 3300025918 Bacteria 6304
2 Ga0070670_100374884 3300005331 Bacteria 1253
3 Ga0070666_10013694 3300005335 Bacteria 5148
4 Ga0070668_100081880 3300005347 Bacteria 2531
5 Ga0070671_100035513 3300005355 Bacteria 4129
6 Ga0070667_100068224 3300005367 Bacteria 3026
7 Ga0070667_100331924 3300005367 Bacteria 1374
8 Ga0070709_10023160 3300005434 Bacteria 3643
9 Ga0070709_10098297 3300005434 Bacteria 1945
10 Ga0070709_10153060 3300005434 Bacteria 1596
11 Ga0070714_100018182 3300005435 Bacteria 5704
12 Ga0070714_100018455 3300005435 Bacteria 5666
13 Ga0070714_100020349 3300005435 Bacteria 5417
14 Ga0070714_100021540 3300005435 Bacteria 5275
15 Ga0070714_100074250 3300005435 Bacteria 2948
16 Ga0070714_100413097 3300005435 Bacteria 1277
17 Ga0070713_100089415 3300005436 Bacteria 2645
18 Ga0070713_100404989 3300005436 Bacteria 1275
19 Ga0070713_100557538 3300005436 Bacteria 1085
20 Ga0070713_100990433 3300005436 Bacteria 811
21 Ga0070710_10020603 3300005437 Bacteria 3424
22 Ga0070710_10060913 3300005437 Bacteria 2148
23 Ga0070710_10203109 3300005437 Bacteria 1252
24 Ga0070711_100055192 3300005439 Bacteria 2743
25 Ga0070711_100064918 3300005439 Bacteria 2552
26 Ga0070711_100065088 3300005439 Bacteria 2548
27 Ga0070711_100129178 3300005439 Bacteria 1880
28 Ga0070705_100647362 3300005440 Bacteria 823
29 Ga0070700_100053605 3300005441 Bacteria 2518
30 Ga0070694_100064995 3300005444 Bacteria 2498
31 Ga0070708_100008385 3300005445 Bacteria 8299
32 Ga0070708_100086556 3300005445 Bacteria 2846
33 Ga0070708_100217940 3300005445 Bacteria 1789
34 Ga0070708_100332263 3300005445 Bacteria 1432
35 Ga0070708_100366868 3300005445 Bacteria 1357
36 Ga0070708_100373865 3300005445 Bacteria 1344
37 Ga0070708_100462015 3300005445 Bacteria 1198
38 Ga0070708_100593972 3300005445 Unclassified 1044
39 Ga0070708_100980204 3300005445 Bacteria 793
40 Ga0070678_100056540 3300005456 Bacteria 2870
41 Ga0070678_100820452 3300005456 Bacteria 846
42 Ga0070662_100406126 3300005457 Bacteria 1125
43 Ga0070681_10065195 3300005458 Bacteria 3611
44 Ga0070706_100004506 3300005467 Bacteria 13422
45 Ga0070706_100006747 3300005467 Bacteria 10837
46 Ga0070706_100023976 3300005467 Bacteria 5618
47 Ga0070706_100024797 3300005467 Bacteria 5522
48 Ga0070706_100042665 3300005467 Bacteria 4191
49 Ga0070706_100162939 3300005467 Bacteria 2082
50 Ga0070706_100586118 3300005467 Bacteria 1036
51 Ga0070707_100011711 3300005468 Bacteria 8184
52 Ga0070707_100037935 3300005468 Bacteria 4601
53 Ga0070707_100050684 3300005468 Bacteria 3979
54 Ga0070707_100061845 3300005468 Bacteria 3591
55 Ga0070707_100062139 3300005468 Unclassified 3583
56 Ga0070707_100099355 3300005468 Bacteria 2819
57 Ga0070707_100104372 3300005468 Bacteria 2748
58 Ga0070707_100144491 3300005468 Bacteria 2315
59 Ga0070707_100152374 3300005468 Bacteria 2251
60 Ga0070707_100345801 3300005468 Bacteria 1445
61 Ga0070707_100478518 3300005468 Unclassified 1207
62 Ga0070707_100651784 3300005468 Bacteria 1016
63 Ga0070707_100891778 3300005468 Bacteria 854
64 Ga0070698_100005013 3300005471 Bacteria 14509
65 Ga0070698_100024121 3300005471 Bacteria 6348
66 Ga0070698_100030483 3300005471 Bacteria 5591
67 Ga0070698_100083700 3300005471 Bacteria 3179
68 Ga0070698_100334586 3300005471 Bacteria 1445
69 Ga0070698_100381601 3300005471 Bacteria 1342
70 Ga0070698_100496209 3300005471 Bacteria 1159
71 Ga0070699_100003650 3300005518 Bacteria 13627
72 Ga0070699_100175074 3300005518 Bacteria 1902
73 Ga0070699_100464141 3300005518 Bacteria 1148
74 Ga0070697_100001486 3300005536 Bacteria 17843
75 Ga0070686_100054037 3300005544 Bacteria 2567
76 Ga0070695_100009225 3300005545 Bacteria 5866
77 Ga0070695_100350680 3300005545 Unclassified 1106
78 Ga0070696_100044085 3300005546 Bacteria 3088
79 Ga0070693_100119147 3300005547 Bacteria 1635
80 Ga0070664_100008028 3300005564 Bacteria 8527
81 Ga0070664_100519764 3300005564 Bacteria 1099
82 Ga0068857_100083148 3300005577 Bacteria 2860
83 Ga0068856_100246544 3300005614 Bacteria 1802
84 Ga0068856_100440542 3300005614 Bacteria 1323
85 Ga0070702_100020775 3300005615 Bacteria 3445
86 Ga0068864_100131532 3300005618 Bacteria 2248
87 Ga0068861_100624586 3300005719 Bacteria 992
88 Ga0068870_10279766 3300005840 Bacteria 1046
89 Ga0068858_100273241 3300005842 Bacteria 1608
90 Ga0068860_100199104 3300005843 Bacteria 1940
91 Ga0068862_100062845 3300005844 Bacteria 3194
92 Ga0081540_1012672 3300005983 Bacteria 5531
93 Ga0070717_10020149 3300006028 Bacteria 5241
94 Ga0070717_10043494 3300006028 Bacteria 3666
95 Ga0070717_10049745 3300006028 Bacteria 3442
96 Ga0070717_10068574 3300006028 Bacteria 2952
97 Ga0070717_10081343 3300006028 Bacteria 2719
98 Ga0070717_10279540 3300006028 Bacteria 1480
99 Ga0070717_10282655 3300006028 Bacteria 1472
100 Ga0070717_10348650 3300006028 Bacteria 1323
101 Ga0075432_10001009 3300006058 Bacteria 8914
102 Ga0075432_10053756 3300006058 Bacteria 1425
103 Ga0070715_10011744 3300006163 Bacteria 3163
104 Ga0070715_10078246 3300006163 Bacteria 1494
105 Ga0070716_100008064 3300006173 Bacteria 5216
106 Ga0070716_100023690 3300006173 Bacteria 3258
107 Ga0070712_100018865 3300006175 Bacteria 4488
108 Ga0070712_100023629 3300006175 Bacteria 4063
109 Ga0070712_100115799 3300006175 Bacteria 2009
110 Ga0070712_100614845 3300006175 Bacteria 921
111 Ga0097621_100087889 3300006237 Bacteria 2596
112 Ga0068871_100529055 3300006358 Bacteria 1065
113 Ga0075428_100120812 3300006844 Bacteria 2853
114 Ga0075428_100181599 3300006844 Bacteria 2277
115 Ga0075431_100209261 3300006847 Bacteria 1993
116 Ga0075433_10008775 3300006852 Bacteria 8065
117 Ga0075433_10342963 3300006852 Bacteria 1320
118 Ga0075433_11051545 3300006852 Bacteria 708
119 Ga0075434_100010880 3300006871 Bacteria 8553
120 Ga0075434_100126612 3300006871 Bacteria 2571
121 Ga0075429_100199711 3300006880 Bacteria 1752
122 Ga0075436_100002603 3300006914 Bacteria 12393
123 Ga0075436_100085027 3300006914 Bacteria 2196
124 Ga0075436_100136178 3300006914 Bacteria 1724
125 Ga0075436_100163332 3300006914 Bacteria 1570
126 Ga0075436_100514304 3300006914 Bacteria 877
127 Ga0075435_100008074 3300007076 Bacteria 7535
128 Ga0075435_100016758 3300007076 Bacteria 5529
129 Ga0075435_100098518 3300007076 Bacteria 2420
130 Ga0099794_10043892 3300007265 Bacteria 2135
131 Ga0105240_10764120 3300009093 Bacteria 1050
132 Ga0111539_10003578 3300009094 Bacteria 20479
133 Ga0111539_10022628 3300009094 Bacteria 7721
134 Ga0105245_11143463 3300009098 Bacteria 825
135 Ga0105247_10036308 3300009101 Bacteria 3004
136 Ga0114129_10060899 3300009147 Bacteria 5276
137 Ga0114129_10436618 3300009147 Bacteria 1719
138 Ga0105241_10401047 3300009174 Bacteria 1203
139 Ga0105237_10208599 3300009545 Bacteria 1954
140 Ga0105237_10305089 3300009545 Bacteria 1595
141 Ga0105249_11257845 3300009553 Bacteria 811
142 Ga0105239_10323732 3300010375 Bacteria 1738
143 Ga0105246_10009013 3300011119 Bacteria 6145
144 Ga0157373_10126195 3300013100 Bacteria 1799
145 Ga0157373_10453074 3300013100 Bacteria 923
146 Ga0157371_10213920 3300013102 Bacteria 1384
147 Ga0157375_10217837 3300013308 Bacteria 2067
148 Ga0163163_10905316 3300014325 Bacteria 946
149 Ga0163163_11073345 3300014325 Bacteria 868
150 Ga0157377_10042517 3300014745 Bacteria 2524
151 Ga0207692_10005441 3300025898 Bacteria 5101
152 Ga0207692_10019469 3300025898 Bacteria 3068
153 Ga0207692_10058963 3300025898 Bacteria 1980
154 Ga0207647_10181855 3300025904 Bacteria 1221
155 Ga0207685_10015272 3300025905 Bacteria 2429
156 Ga0207685_10309198 3300025905 Bacteria 785
157 Ga0207699_10001784 3300025906 Bacteria 10124
158 Ga0207699_10003494 3300025906 Bacteria 7500
159 Ga0207699_10021126 3300025906 Bacteria 3502
160 Ga0207699_10106181 3300025906 Bacteria 1792
161 Ga0207643_10148298 3300025908 Bacteria 1405
162 Ga0207684_10000721 3300025910 Bacteria 38899
163 Ga0207684_10016559 3300025910 Bacteria 6329
164 Ga0207684_10019714 3300025910 Bacteria 5768
165 Ga0207684_10019897 3300025910 Bacteria 5737
166 Ga0207684_10108743 3300025910 Bacteria 2372
167 Ga0207684_10113890 3300025910 Bacteria 2315
168 Ga0207684_10119343 3300025910 Bacteria 2260
169 Ga0207684_10554114 3300025910 Bacteria 983
170 Ga0207654_10377687 3300025911 Bacteria 981
171 Ga0207693_10015281 3300025915 Bacteria 6160
172 Ga0207693_10022280 3300025915 Bacteria 5035
173 Ga0207693_10029465 3300025915 Bacteria 4335
174 Ga0207693_10069204 3300025915 Bacteria 2762
175 Ga0207693_10166607 3300025915 Bacteria 1735
176 Ga0207693_10220544 3300025915 Bacteria 1490
177 Ga0207693_10576872 3300025915 Bacteria 876
178 Ga0207663_10010410 3300025916 Bacteria 4952
179 Ga0207663_10047113 3300025916 Bacteria 2660
180 Ga0207663_10370128 3300025916 Bacteria 1089
181 Ga0207660_10243437 3300025917 Bacteria 1417
182 Ga0207657_10007155 3300025919 Bacteria 11462
183 Ga0207649_10160488 3300025920 Bacteria 1557
184 Ga0207646_10016723 3300025922 Bacteria 6881
185 Ga0207646_10023238 3300025922 Bacteria 5697
186 Ga0207646_10035529 3300025922 Bacteria 4501
187 Ga0207646_10073288 3300025922 Bacteria 3059
188 Ga0207646_10086531 3300025922 Bacteria 2804
189 Ga0207646_10153989 3300025922 Bacteria 2073
190 Ga0207646_10236800 3300025922 Bacteria 1649
191 Ga0207646_10296396 3300025922 Unclassified 1461
192 Ga0207646_10357334 3300025922 Bacteria 1320
193 Ga0207646_10710935 3300025922 Bacteria 898
194 Ga0207694_10089172 3300025924 Bacteria 2432
195 Ga0207700_10012251 3300025928 Bacteria 5521
196 Ga0207700_10019929 3300025928 Bacteria 4542
197 Ga0207700_10036807 3300025928 Bacteria 3538
198 Ga0207700_10050516 3300025928 Bacteria 3099
199 Ga0207700_10069885 3300025928 Bacteria 2697
200 Ga0207700_10356576 3300025928 Bacteria 1274
201 Ga0207700_10397879 3300025928 Bacteria 1207
202 Ga0207664_10005438 3300025929 Bacteria 8706
203 Ga0207664_10007621 3300025929 Bacteria 7511
204 Ga0207664_10041084 3300025929 Bacteria 3602
205 Ga0207664_10062807 3300025929 Bacteria 2967
206 Ga0207664_10089227 3300025929 Bacteria 2524
207 Ga0207664_10095707 3300025929 Bacteria 2443
208 Ga0207664_10307454 3300025929 Bacteria 1396
209 Ga0207664_10684276 3300025929 Bacteria 922
210 Ga0207644_10153929 3300025931 Bacteria 1781
211 Ga0207706_10012332 3300025933 Bacteria 7785
212 Ga0207709_10132271 3300025935 Bacteria 1702
213 Ga0207665_10032360 3300025939 Bacteria 3462
214 Ga0207665_10054691 3300025939 Bacteria 2692
215 Ga0207665_10058062 3300025939 Bacteria 2615
216 Ga0207665_10137223 3300025939 Bacteria 1741
217 Ga0207691_10031509 3300025940 Bacteria 4947
218 Ga0207711_10232397 3300025941 Bacteria 1689
219 Ga0207689_10009905 3300025942 Bacteria 8217
220 Ga0207661_10137562 3300025944 Bacteria 2099
221 Ga0207668_10127047 3300025972 Bacteria 1941
222 Ga0207658_10035397 3300025986 Bacteria 3576
223 Ga0207658_10055491 3300025986 Bacteria 2936
224 Ga0207703_10194107 3300026035 Bacteria 1800
225 Ga0207678_10025969 3300026067 Bacteria 5111
226 Ga0207678_10273931 3300026067 Bacteria 1448
227 Ga0207708_10339989 3300026075 Bacteria 1229
228 Ga0207702_10091907 3300026078 Bacteria 2658
229 Ga0207648_10030294 3300026089 Bacteria 4793
230 Ga0207676_11343951 3300026095 Bacteria 710
231 Ga0207674_10007925 3300026116 Bacteria 12334
232 Ga0207675_100159552 3300026118 Bacteria 2151
233 Ga0207675_100408784 3300026118 Bacteria 1339
234 Ga0207683_10002252 3300026121 Bacteria 16934
235 Ga0207683_10920499 3300026121 Bacteria 812
236 Ga0207428_10001136 3300027907 Bacteria 28891
237 Ga0207428_10075309 3300027907 Bacteria 2645
238 Ga0268265_10219338 3300028380 Bacteria 1663
239 Ga0268265_10445029 3300028380 Bacteria 1209
240 Ga0268264_10079164 3300028381 Bacteria 2803
241 Ga0268264_10221457 3300028381 Bacteria 1742
242 Ga0307507_10028329 3300033179 Bacteria 5973
243 Ga0307507_10028799 3300033179 Bacteria 5908
244 Ga0373958_0021174 3300034819 Bacteria 1205
245 Ga0373926_0006769 3300035083 Bacteria 3808
246 Ga0373934_0072820 3300035086 Bacteria 1375
247 Ga0373940_0164179 3300035088 Bacteria 714
248 Ga0373944_0000664 3300035089 Bacteria 8204
249 Ga0373951_0034843 3300035091 Bacteria 1197
250 Ga0373923_0008434 3300035111 Bacteria 3673
251 Ga0373923_0093215 3300035111 Bacteria 1320
252 Ga0373932_0089292 3300035112 Bacteria 986
253 Ga0373936_0003266 3300035113 Bacteria 6080
254 Ga0373936_0004125 3300035113 Bacteria 5476
255 Ga0373936_0028257 3300035113 Bacteria 2204
256 Ga0373939_0001291 3300035114 Bacteria 6088
257 Ga0373941_0038090 3300035115 Bacteria 1470
258 Ga0373945_0078192 3300035116 Bacteria 1263
259 Ga0373953_0003747 3300035117 Bacteria 4777
260 Ga0373953_0029997 3300035117 Bacteria 2106
261 Ga0373954_0021178 3300035118 Bacteria 2942
262 Ga0373954_0025478 3300035118 Bacteria 2704
263 Ga0373954_0034825 3300035118 Bacteria 2333
264 Ga0373956_0003134 3300035119 Bacteria 6686
265 Ga0373956_0039143 3300035119 Bacteria 2100
266 Ga0373957_0009430 3300035120 Bacteria 3193
267 Ga0373957_0030045 3300035120 Bacteria 1989
268 Ga0373957_0192262 3300035120 Bacteria 848
269 Ga0373960_0026327 3300035121 Bacteria 1588
270 Ga0373943_0009414 3300035170 Bacteria 4378
271 Ga0373943_0077091 3300035170 Bacteria 1701
272 Ga0373946_0000982 3300035171 Bacteria 9779
273 Ga0373946_0223958 3300035171 Unclassified 909
274 Ga0373955_0010020 3300035172 Bacteria 4460
275 Ga0373942_0009235 3300035207 Bacteria 2305
276 Ga0373924_0000893 3300035410 Bacteria 9411
277 Ga0373924_0088099 3300035410 Bacteria 1326
278 Ga0373931_0227579 3300035691 Bacteria 1125
279 Ga0373935_0080927 3300035692 Bacteria 2110
280 Ga0373927_0007213 3300035695 Bacteria 7543
281 Ga0373927_0269154 3300035695 Bacteria 1120
282 Ga0373933_0001230 3300035724 Bacteria 15147
283 Ga0373933_0017186 3300035724 Bacteria 4055
284 Ga0373933_0027092 3300035724 Bacteria 3297
285 Ga0373947_0007762 3300035725 Bacteria 6200
286 Ga0373947_0015730 3300035725 Bacteria 4346
287 Ga0373947_0148468 3300035725 Bacteria 1508
288 Ga0373937_0004426 3300036401 Bacteria 11941
289 Ga0373937_0022002 3300036401 Bacteria 5725
290 Ga0373937_0029932 3300036401 Bacteria 4931
291 Ga0373937_0055133 3300036401 Bacteria 3648
292 Ga0373937_0436514 3300036401 Bacteria 1243
293 Ga0373925_0023217 3300037068 Bacteria 4526
294 Ga0373925_0047159 3300037068 Bacteria 3206
295 Ga0373925_0152720 3300037068 Bacteria 1814
296 Ga0373925_0261236 3300037068 Bacteria 1391
297 Ga0495592_0134285 3300046454 Bacteria 1727
298 Ga0495592_0389717 3300046454 Bacteria 885
299 Ga0495629_0002045 3300046459 Bacteria 15675
300 Ga0495629_0004530 3300046459 Bacteria 10397
301 Ga0495629_0006311 3300046459 Bacteria 8797
302 Ga0495641_0002955 3300046461 Bacteria 13097
303 Ga0495641_0005509 3300046461 Bacteria 8515
304 Ga0495651_0020238 3300046462 Bacteria 5164
305 Ga0495651_0064772 3300046462 Bacteria 2793
306 Ga0495651_0145248 3300046462 Bacteria 1716
307 Ga0495651_0406320 3300046462 Bacteria 888
308 Ga0495653_0007041 3300046463 Bacteria 9229
309 Ga0495653_0020891 3300046463 Bacteria 5304
310 Ga0495653_0021628 3300046463 Bacteria 5210
311 Ga0495653_0031681 3300046463 Bacteria 4201
312 Ga0495653_0591137 3300046463 Bacteria 683
313 Ga0495580_0018015 3300046472 Bacteria 5265
314 Ga0495580_0034130 3300046472 Bacteria 3663
315 Ga0495580_0383466 3300046472 Bacteria 949
316 Ga0495580_0482087 3300046472 Bacteria 829
317 Ga0495582_0000377 3300046473 Bacteria 24276
318 Ga0495582_0005139 3300046473 Bacteria 7327
319 Ga0495582_0347598 3300046473 Bacteria 854
320 Ga0495639_0001240 3300046475 Bacteria 11503
321 Ga0495639_0030751 3300046475 Bacteria 2387
322 Ga0495662_0011311 3300046476 Bacteria 4361
323 Ga0495662_0109024 3300046476 Bacteria 1356
324 Ga0495662_0158139 3300046476 Bacteria 1116
325 Ga0495664_0002674 3300046477 Bacteria 9595
326 Ga0495664_0011836 3300046477 Bacteria 4927
327 Ga0495664_0014019 3300046477 Bacteria 4541
328 Ga0495664_0021632 3300046477 Bacteria 3715
329 Ga0495664_0120286 3300046477 Bacteria 1588
330 Ga0495664_0184334 3300046477 Bacteria 1265
331 Ga0495664_0370218 3300046477 Bacteria 862
332 Ga0495594_0048835 3300046499 Bacteria 2325
333 Ga0495594_0247408 3300046499 Bacteria 1016
334 Ga0495608_0019775 3300046511 Bacteria 4630
335 Ga0495608_0024400 3300046511 Bacteria 4135
336 Ga0495608_0047654 3300046511 Bacteria 2848
337 Ga0495608_0111007 3300046511 Bacteria 1763
338 Ga0495608_0222204 3300046511 Bacteria 1185
339 Ga0495618_0013503 3300046514 Bacteria 4968
340 Ga0495618_0096723 3300046514 Bacteria 1888
341 Ga0495618_0115631 3300046514 Bacteria 1717
342 Ga0495618_0122950 3300046514 Bacteria 1662
343 Ga0495618_0300954 3300046514 Bacteria 996
344 Ga0495628_0081084 3300046516 Bacteria 2520
345 Ga0495628_0126062 3300046516 Bacteria 1961
346 Ga0495628_0228054 3300046516 Bacteria 1397
347 Ga0495628_0257715 3300046516 Bacteria 1300
348 Ga0495628_0406097 3300046516 Bacteria 994
349 Ga0495630_0002542 3300046517 Bacteria 12651
350 Ga0495630_0003300 3300046517 Bacteria 11249
351 Ga0495630_0075816 3300046517 Bacteria 2533
352 Ga0495630_0134503 3300046517 Bacteria 1878
353 Ga0495630_0151772 3300046517 Bacteria 1763
354 Ga0495666_0031287 3300046526 Bacteria 2607
355 Ga0495666_0070234 3300046526 Bacteria 1665
356 Ga0495652_0023981 3300046529 Bacteria 5404
357 Ga0495652_0053023 3300046529 Bacteria 3458
358 Ga0495652_0171984 3300046529 Bacteria 1671
359 Ga0495652_0195944 3300046529 Bacteria 1537
360 Ga0495652_0298396 3300046529 Bacteria 1172
361 Ga0495652_0459696 3300046529 Bacteria 889
362 Ga0495665_0001479 3300046531 Bacteria 12603
363 Ga0495665_0011089 3300046531 Bacteria 4877
364 Ga0495640_0026788 3300046533 Bacteria 4160
365 Ga0495640_0090684 3300046533 Bacteria 2017
366 Ga0495640_0227156 3300046533 Bacteria 1175
367 Ga0495586_0009664 3300046535 Bacteria 5136
368 Ga0495587_0008354 3300046536 Bacteria 6661
369 Ga0495587_0036996 3300046536 Bacteria 2933
370 Ga0495587_0038641 3300046536 Bacteria 2860
371 Ga0495587_0091704 3300046536 Bacteria 1754
372 Ga0495587_0220829 3300046536 Bacteria 1069
373 Ga0495645_0023313 3300046543 Bacteria 4481
374 Ga0495645_0054285 3300046543 Bacteria 2911
375 Ga0495645_0059964 3300046543 Bacteria 2758
376 Ga0495622_0044095 3300046557 Bacteria 2073
377 Ga0495667_0004794 3300046559 Bacteria 9146
378 Ga0495667_0015384 3300046559 Bacteria 5169
379 Ga0495667_0029881 3300046559 Bacteria 3665
380 Ga0495667_0032929 3300046559 Bacteria 3469
381 Ga0495667_0098025 3300046559 Bacteria 1898
382 Ga0495634_0002380 3300046642 Bacteria 15668
383 Ga0495634_0003827 3300046642 Bacteria 11952
384 Ga0495634_0006194 3300046642 Bacteria 9115
385 Ga0495634_0027823 3300046642 Bacteria 3930
386 Ga0495634_0281322 3300046642 Bacteria 1010
387 Ga0495635_0003153 3300046663 Bacteria 11353
388 Ga0495635_0006124 3300046663 Bacteria 8389
389 Ga0495635_0009246 3300046663 Bacteria 6884
390 Ga0495635_0032241 3300046663 Bacteria 3636
391 Ga0495635_0269788 3300046663 Bacteria 1144
392 Ga0495588_0043521 3300046674 Bacteria 2298
393 Ga0495588_0313630 3300046674 Bacteria 825
394 Ga0495657_0009667 3300046675 Bacteria 7294
395 Ga0495657_0030095 3300046675 Bacteria 3804
396 Ga0495657_0054680 3300046675 Bacteria 2665
397 Ga0495599_0002554 3300046678 Bacteria 10602
398 Ga0495599_0009836 3300046678 Bacteria 5853
399 Ga0495599_0014028 3300046678 Bacteria 4960
400 Ga0495599_0143721 3300046678 Bacteria 1479
401 Ga0495623_0056104 3300046679 Bacteria 2480
402 Ga0495623_0066963 3300046679 Bacteria 2242
403 Ga0495646_0001269 3300046680 Bacteria 14837
404 Ga0495646_0019232 3300046680 Bacteria 4325
405 Ga0495647_0003521 3300046681 Bacteria 5013
406 Ga0495613_0005449 3300046689 Bacteria 9558
407 Ga0495613_0073481 3300046689 Bacteria 2491
408 Ga0495624_0028233 3300046690 Bacteria 3669
409 Ga0495624_0069730 3300046690 Bacteria 2189
410 Ga0495600_0007449 3300046809 Bacteria 6697
411 Ga0495600_0025422 3300046809 Bacteria 3816
412 Ga0495581_0000716 3300047315 Bacteria 17480
413 Ga0495581_0005138 3300047315 Bacteria 7572
414 Ga0495581_0006345 3300047315 Bacteria 6857
415 Ga0495604_0002571 3300047317 Bacteria 14523
416 Ga0495604_0064605 3300047317 Bacteria 2788
417 Ga0495674_0003063 3300047319 Bacteria 16241
418 Ga0495674_0006923 3300047319 Bacteria 10846
419 Ga0495674_0015365 3300047319 Bacteria 7160
420 Ga0495674_0038285 3300047319 Bacteria 4305
421 Ga0495674_0049466 3300047319 Bacteria 3714
422 Ga0495674_0629857 3300047319 Bacteria 847
423 Ga0495676_0006106 3300047321 Bacteria 11078
424 Ga0495676_0153132 3300047321 Bacteria 1638
425 Ga0495680_0005552 3300047322 Bacteria 11839
426 Ga0495680_0006380 3300047322 Bacteria 10972
427 Ga0495680_0010098 3300047322 Bacteria 8442
428 Ga0495680_0026066 3300047322 Bacteria 4827
429 Ga0495680_0206618 3300047322 Bacteria 1407
430 Ga0495680_0239716 3300047322 Bacteria 1288
431 Ga0495675_0018098 3300047444 Bacteria 4468
432 Ga0495675_0059204 3300047444 Bacteria 2428
433 Ga0495684_0006939 3300047471 Bacteria 8793
434 Ga0495684_0013639 3300047471 Bacteria 6257
435 Ga0495684_0034291 3300047471 Bacteria 3894
436 Ga0495684_0241616 3300047471 Bacteria 1317
437 Ga0495593_0001144 3300047673 Bacteria 15465
438 Ga0495593_0008349 3300047673 Bacteria 6026
439 Ga0495593_0014983 3300047673 Bacteria 4401
440 Ga0495602_0089620 3300048088 Bacteria 2557
441 Ga0495614_0015358 3300048089 Bacteria 3337
442 Ga0495614_0107996 3300048089 Bacteria 1220
443 Ga0496100_0032921 3300048903 Bacteria 3238
444 Ga0496100_0574728 3300048903 Bacteria 873
445 Ga0496101_0092229 3300048904 Bacteria 2255
446 Ga0496101_0490355 3300048904 Bacteria 970
447 Ga0496102_0034534 3300048905 Bacteria 4549
448 Ga0496103_0010833 3300048906 Bacteria 5396
449 Ga0496104_0299361 3300048907 Bacteria 1520
450 Ga0496104_0436335 3300048907 Bacteria 1221
451 Ga0496105_0002382 3300048908 Bacteria 13618
452 Ga0496105_0003325 3300048908 Bacteria 11879
453 Ga0496106_0031933 3300048909 Bacteria 3924
454 Ga0496108_0035960 3300048911 Bacteria 4119
455 Ga0496108_0048955 3300048911 Bacteria 3534
456 Ga0496109_0083525 3300048912 Bacteria 2945
457 Ga0496109_0093765 3300048912 Bacteria 2778
458 Ga0496110_0086677 3300048913 Bacteria 2796
459 Ga0496110_0107136 3300048913 Bacteria 2508
460 Ga0496111_0016098 3300048914 Bacteria 5149
461 Ga0496112_0006790 3300048915 Bacteria 10087
462 Ga0496112_0264113 3300048915 Bacteria 1670
463 Ga0496112_0866979 3300048915 Bacteria 826
464 Ga0496112_0949980 3300048915 Bacteria 780
465 Ga0496113_0051788 3300048916 Bacteria 3064
466 Ga0496114_0028660 3300048917 Bacteria 4570
467 Ga0496114_0088169 3300048917 Bacteria 2632
468 Ga0496115_0012497 3300048918 Bacteria 6392
469 Ga0496115_0056618 3300048918 Bacteria 3151
470 Ga0496115_0130036 3300048918 Bacteria 2075
471 Ga0496126_0047722 3300048929 Bacteria 3919
472 Ga0501047_0005088 3300049581 Bacteria 12335
473 Ga0501044_0479386 3300049823 Bacteria 1147
474 nmdc:mga09592_157365_c1 3300050508 Bacteria 1961
475 nmdc:mga06r32_130272_c1 3300050510 Bacteria 2487
476 nmdc:mga08y16_26715_c1 3300050511 Bacteria 6083
477 nmdc:mga08y16_8447_c1 3300050511 Bacteria 10782
478 nmdc:mga0n895_1595_c1 3300050512 Bacteria 17073
479 nmdc:mga0n895_24667_c1 3300050512 Bacteria 5670
480 nmdc:mga0n895_366558_c1 3300050512 Bacteria 1459
481 nmdc:mga0n895_435529_c1 3300050512 Bacteria 1325
482 nmdc:mga0rr50_20716_c1 3300050513 Bacteria 4472
483 nmdc:mga0rr50_247599_c1 3300050513 Bacteria 1479
484 nmdc:mga0rr50_4093_c1 3300050513 Bacteria 8514
485 nmdc:mga08x19_1894_c1 3300050514 Bacteria 12814
486 nmdc:mga08x19_297628_c1 3300050514 Bacteria 1120
487 nmdc:mga08x19_553244_c1 3300050514 Bacteria 814
488 nmdc:mga08x19_57449_c1 3300050514 Bacteria 2514
489 nmdc:mga08x19_63286_c1 3300050514 Bacteria 2400
490 nmdc:mga08x19_75135_c1 3300050514 Bacteria 2209
491 nmdc:mga08x19_82794_c1 3300050514 Bacteria 2109
492 nmdc:mga0a205_303313_c1 3300050515 Bacteria 1470
493 nmdc:mga0a205_5057_c2 3300050515 Bacteria 8104
494 nmdc:mga0a205_6050_c1 3300050515 Bacteria 10918
495 Ga0495601_0005991 3300053077 Bacteria 7093
496 Ga0495601_0046789 3300053077 Bacteria 2723
497 Ga0495601_0241052 3300053077 Bacteria 1180
498 Ga0495612_0000451 3300053078 Bacteria 16444
499 Ga0495612_0230547 3300053078 Bacteria 821
500 Ga0495595_0066552 3300053084 Bacteria 1696
501 Ga0495619_0010855 3300053085 Bacteria 5733
502 2753265585 2751185782 Bacteria 11227053
503 Ga0207662_10006525
504 Ga0070670_100374884
505 Ga0070666_10013694
506 Ga0070668_100081880
507 Ga0070671_100035513
508 Ga0070667_100068224
509 Ga0070667_100331924
510 Ga0070709_10023160
511 Ga0070709_10098297
512 Ga0070709_10153060
513 Ga0070714_100018182
514 Ga0070714_100018455
515 Ga0070714_100020349
516 Ga0070714_100021540
517 Ga0070714_100074250
518 Ga0070714_100413097
519 Ga0070713_100089415
520 Ga0070713_100404989
521 Ga0070713_100557538
522 Ga0070713_100990433
523 Ga0070710_10020603
524 Ga0070710_10060913
525 Ga0070710_10203109
526 Ga0070711_100055192
527 Ga0070711_100064918
528 Ga0070711_100065088
529 Ga0070711_100129178
530 Ga0070705_100647362
531 Ga0070700_100053605
532 Ga0070694_100064995
533 Ga0070708_100008385
534 Ga0070708_100086556
535 Ga0070708_100217940
536 Ga0070708_100332263
537 Ga0070708_100366868
538 Ga0070708_100373865
539 Ga0070708_100462015
540 Ga0070708_100593972
541 Ga0070708_100980204
542 Ga0070678_100056540
543 Ga0070678_100820452
544 Ga0070662_100406126
545 Ga0070681_10065195
546 Ga0070706_100004506
547 Ga0070706_100006747
548 Ga0070706_100023976
549 Ga0070706_100024797
550 Ga0070706_100042665
551 Ga0070706_100162939
552 Ga0070706_100586118
553 Ga0070707_100011711
554 Ga0070707_100037935
555 Ga0070707_100050684
556 Ga0070707_100061845
557 Ga0070707_100062139
558 Ga0070707_100099355
559 Ga0070707_100104372
560 Ga0070707_100144491
561 Ga0070707_100152374
562 Ga0070707_100345801
563 Ga0070707_100478518
564 Ga0070707_100651784
565 Ga0070707_100891778
566 Ga0070698_100005013
567 Ga0070698_100024121
568 Ga0070698_100030483
569 Ga0070698_100083700
570 Ga0070698_100334586
571 Ga0070698_100381601
572 Ga0070698_100496209
573 Ga0070699_100003650
574 Ga0070699_100175074
575 Ga0070699_100464141
576 Ga0070697_100001486
577 Ga0070686_100054037
578 Ga0070695_100009225
579 Ga0070695_100350680
580 Ga0070696_100044085
581 Ga0070693_100119147
582 Ga0070664_100008028
583 Ga0070664_100519764
584 Ga0068857_100083148
585 Ga0068856_100246544
586 Ga0068856_100440542
587 Ga0070702_100020775
588 Ga0068864_100131532
589 Ga0068861_100624586
590 Ga0068870_10279766
591 Ga0068858_100273241
592 Ga0068860_100199104
593 Ga0068862_100062845
594 Ga0081540_1012672
595 Ga0070717_10020149
596 Ga0070717_10043494
597 Ga0070717_10049745
598 Ga0070717_10068574
599 Ga0070717_10081343
600 Ga0070717_10279540
601 Ga0070717_10282655
602 Ga0070717_10348650
603 Ga0075432_10001009
604 Ga0075432_10053756
605 Ga0070715_10011744
606 Ga0070715_10078246
607 Ga0070716_100008064
608 Ga0070716_100023690
609 Ga0070712_100018865
610 Ga0070712_100023629
611 Ga0070712_100115799
612 Ga0070712_100614845
613 Ga0097621_100087889
614 Ga0068871_100529055
615 Ga0075428_100120812
616 Ga0075428_100181599
617 Ga0075431_100209261
618 Ga0075433_10008775
619 Ga0075433_10342963
620 Ga0075433_11051545
621 Ga0075434_100010880
622 Ga0075434_100126612
623 Ga0075429_100199711
624 Ga0075436_100002603
625 Ga0075436_100085027
626 Ga0075436_100136178
627 Ga0075436_100163332
628 Ga0075436_100514304
629 Ga0075435_100008074
630 Ga0075435_100016758
631 Ga0075435_100098518
632 Ga0099794_10043892
633 Ga0105240_10764120
634 Ga0111539_10003578
635 Ga0111539_10022628
636 Ga0105245_11143463
637 Ga0105247_10036308
638 Ga0114129_10060899
639 Ga0114129_10436618
640 Ga0105241_10401047
641 Ga0105237_10208599
642 Ga0105237_10305089
643 Ga0105249_11257845
644 Ga0105239_10323732
645 Ga0105246_10009013
646 Ga0157373_10126195
647 Ga0157373_10453074
648 Ga0157371_10213920
649 Ga0157375_10217837
650 Ga0163163_10905316
651 Ga0163163_11073345
652 Ga0157377_10042517
653 Ga0207692_10005441
654 Ga0207692_10019469
655 Ga0207692_10058963
656 Ga0207647_10181855
657 Ga0207685_10015272
658 Ga0207685_10309198
659 Ga0207699_10001784
660 Ga0207699_10003494
661 Ga0207699_10021126
662 Ga0207699_10106181
663 Ga0207643_10148298
664 Ga0207684_10000721
665 Ga0207684_10016559
666 Ga0207684_10019714
667 Ga0207684_10019897
668 Ga0207684_10108743
669 Ga0207684_10113890
670 Ga0207684_10119343
671 Ga0207684_10554114
672 Ga0207654_10377687
673 Ga0207693_10015281
674 Ga0207693_10022280
675 Ga0207693_10029465
676 Ga0207693_10069204
677 Ga0207693_10166607
678 Ga0207693_10220544
679 Ga0207693_10576872
680 Ga0207663_10010410
681 Ga0207663_10047113
682 Ga0207663_10370128
683 Ga0207660_10243437
684 Ga0207657_10007155
685 Ga0207649_10160488
686 Ga0207646_10016723
687 Ga0207646_10023238
688 Ga0207646_10035529
689 Ga0207646_10073288
690 Ga0207646_10086531
691 Ga0207646_10153989
692 Ga0207646_10236800
693 Ga0207646_10296396
694 Ga0207646_10357334
695 Ga0207646_10710935
696 Ga0207694_10089172
697 Ga0207700_10012251
698 Ga0207700_10019929
699 Ga0207700_10036807
700 Ga0207700_10050516
701 Ga0207700_10069885
702 Ga0207700_10356576
703 Ga0207700_10397879
704 Ga0207664_10005438
705 Ga0207664_10007621
706 Ga0207664_10041084
707 Ga0207664_10062807
708 Ga0207664_10089227
709 Ga0207664_10095707
710 Ga0207664_10307454
711 Ga0207664_10684276
712 Ga0207644_10153929
713 Ga0207706_10012332
714 Ga0207709_10132271
715 Ga0207665_10032360
716 Ga0207665_10054691
717 Ga0207665_10058062
718 Ga0207665_10137223
719 Ga0207691_10031509
720 Ga0207711_10232397
721 Ga0207689_10009905
722 Ga0207661_10137562
723 Ga0207668_10127047
724 Ga0207658_10035397
725 Ga0207658_10055491
726 Ga0207703_10194107
727 Ga0207678_10025969
728 Ga0207678_10273931
729 Ga0207708_10339989
730 Ga0207702_10091907
731 Ga0207648_10030294
732 Ga0207676_11343951
733 Ga0207674_10007925
734 Ga0207675_100159552
735 Ga0207675_100408784
736 Ga0207683_10002252
737 Ga0207683_10920499
738 Ga0207428_10001136
739 Ga0207428_10075309
740 Ga0268265_10219338
741 Ga0268265_10445029
742 Ga0268264_10079164
743 Ga0268264_10221457
744 Ga0307507_10028329
745 Ga0307507_10028799
746 Ga0373958_0021174
747 Ga0373926_0006769
748 Ga0373934_0072820
749 Ga0373940_0164179
750 Ga0373944_0000664
751 Ga0373951_0034843
752 Ga0373923_0008434
753 Ga0373923_0093215
754 Ga0373932_0089292
755 Ga0373936_0003266
756 Ga0373936_0004125
757 Ga0373936_0028257
758 Ga0373939_0001291
759 Ga0373941_0038090
760 Ga0373945_0078192
761 Ga0373953_0003747
762 Ga0373953_0029997
763 Ga0373954_0021178
764 Ga0373954_0025478
765 Ga0373954_0034825
766 Ga0373956_0003134
767 Ga0373956_0039143
768 Ga0373957_0009430
769 Ga0373957_0030045
770 Ga0373957_0192262
771 Ga0373960_0026327
772 Ga0373943_0009414
773 Ga0373943_0077091
774 Ga0373946_0000982
775 Ga0373946_0223958
776 Ga0373955_0010020
777 Ga0373942_0009235
778 Ga0373924_0000893
779 Ga0373924_0088099
780 Ga0373931_0227579
781 Ga0373935_0080927
782 Ga0373927_0007213
783 Ga0373927_0269154
784 Ga0373933_0001230
785 Ga0373933_0017186
786 Ga0373933_0027092
787 Ga0373947_0007762
788 Ga0373947_0015730
789 Ga0373947_0148468
790 Ga0373937_0004426
791 Ga0373937_0022002
792 Ga0373937_0029932
793 Ga0373937_0055133
794 Ga0373937_0436514
795 Ga0373925_0023217
796 Ga0373925_0047159
797 Ga0373925_0152720
798 Ga0373925_0261236
799 Ga0495592_0134285
800 Ga0495592_0389717
801 Ga0495629_0002045
802 Ga0495629_0004530
803 Ga0495629_0006311
804 Ga0495641_0002955
805 Ga0495641_0005509
806 Ga0495651_0020238
807 Ga0495651_0064772
808 Ga0495651_0145248
809 Ga0495651_0406320
810 Ga0495653_0007041
811 Ga0495653_0020891
812 Ga0495653_0021628
813 Ga0495653_0031681
814 Ga0495653_0591137
815 Ga0495580_0018015
816 Ga0495580_0034130
817 Ga0495580_0383466
818 Ga0495580_0482087
819 Ga0495582_0000377
820 Ga0495582_0005139
821 Ga0495582_0347598
822 Ga0495639_0001240
823 Ga0495639_0030751
824 Ga0495662_0011311
825 Ga0495662_0109024
826 Ga0495662_0158139
827 Ga0495664_0002674
828 Ga0495664_0011836
829 Ga0495664_0014019
830 Ga0495664_0021632
831 Ga0495664_0120286
832 Ga0495664_0184334
833 Ga0495664_0370218
834 Ga0495594_0048835
835 Ga0495594_0247408
836 Ga0495608_0019775
837 Ga0495608_0024400
838 Ga0495608_0047654
839 Ga0495608_0111007
840 Ga0495608_0222204
841 Ga0495618_0013503
842 Ga0495618_0096723
843 Ga0495618_0115631
844 Ga0495618_0122950
845 Ga0495618_0300954
846 Ga0495628_0081084
847 Ga0495628_0126062
848 Ga0495628_0228054
849 Ga0495628_0257715
850 Ga0495628_0406097
851 Ga0495630_0002542
852 Ga0495630_0003300
853 Ga0495630_0075816
854 Ga0495630_0134503
855 Ga0495630_0151772
856 Ga0495666_0031287
857 Ga0495666_0070234
858 Ga0495652_0023981
859 Ga0495652_0053023
860 Ga0495652_0171984
861 Ga0495652_0195944
862 Ga0495652_0298396
863 Ga0495652_0459696
864 Ga0495665_0001479
865 Ga0495665_0011089
866 Ga0495640_0026788
867 Ga0495640_0090684
868 Ga0495640_0227156
869 Ga0495586_0009664
870 Ga0495587_0008354
871 Ga0495587_0036996
872 Ga0495587_0038641
873 Ga0495587_0091704
874 Ga0495587_0220829
875 Ga0495645_0023313
876 Ga0495645_0054285
877 Ga0495645_0059964
878 Ga0495622_0044095
879 Ga0495667_0004794
880 Ga0495667_0015384
881 Ga0495667_0029881
882 Ga0495667_0032929
883 Ga0495667_0098025
884 Ga0495634_0002380
885 Ga0495634_0003827
886 Ga0495634_0006194
887 Ga0495634_0027823
888 Ga0495634_0281322
889 Ga0495635_0003153
890 Ga0495635_0006124
891 Ga0495635_0009246
892 Ga0495635_0032241
893 Ga0495635_0269788
894 Ga0495588_0043521
895 Ga0495588_0313630
896 Ga0495657_0009667
897 Ga0495657_0030095
898 Ga0495657_0054680
899 Ga0495599_0002554
900 Ga0495599_0009836
901 Ga0495599_0014028
902 Ga0495599_0143721
903 Ga0495623_0056104
904 Ga0495623_0066963
905 Ga0495646_0001269
906 Ga0495646_0019232
907 Ga0495647_0003521
908 Ga0495613_0005449
909 Ga0495613_0073481
910 Ga0495624_0028233
911 Ga0495624_0069730
912 Ga0495600_0007449
913 Ga0495600_0025422
914 Ga0495581_0000716
915 Ga0495581_0005138
916 Ga0495581_0006345
917 Ga0495604_0002571
918 Ga0495604_0064605
919 Ga0495674_0003063
920 Ga0495674_0006923
921 Ga0495674_0015365
922 Ga0495674_0038285
923 Ga0495674_0049466
924 Ga0495674_0629857
925 Ga0495676_0006106
926 Ga0495676_0153132
927 Ga0495680_0005552
928 Ga0495680_0006380
929 Ga0495680_0010098
930 Ga0495680_0026066
931 Ga0495680_0206618
932 Ga0495680_0239716
933 Ga0495675_0018098
934 Ga0495675_0059204
935 Ga0495684_0006939
936 Ga0495684_0013639
937 Ga0495684_0034291
938 Ga0495684_0241616
939 Ga0495593_0001144
940 Ga0495593_0008349
941 Ga0495593_0014983
942 Ga0495602_0089620
943 Ga0495614_0015358
944 Ga0495614_0107996
945 Ga0496100_0032921
946 Ga0496100_0574728
947 Ga0496101_0092229
948 Ga0496101_0490355
949 Ga0496102_0034534
950 Ga0496103_0010833
951 Ga0496104_0299361
952 Ga0496104_0436335
953 Ga0496105_0002382
954 Ga0496105_0003325
955 Ga0496106_0031933
956 Ga0496108_0035960
957 Ga0496108_0048955
958 Ga0496109_0083525
959 Ga0496109_0093765
960 Ga0496110_0086677
961 Ga0496110_0107136
962 Ga0496111_0016098
963 Ga0496112_0006790
964 Ga0496112_0264113
965 Ga0496112_0866979
966 Ga0496112_0949980
967 Ga0496113_0051788
968 Ga0496114_0028660
969 Ga0496114_0088169
970 Ga0496115_0012497
971 Ga0496115_0056618
972 Ga0496115_0130036
973 Ga0496126_0047722
974 Ga0501047_0005088
975 Ga0501044_0479386
976 nmdc:mga09592_157365_c1
977 nmdc:mga06r32_130272_c1
978 nmdc:mga08y16_26715_c1
979 nmdc:mga08y16_8447_c1
980 nmdc:mga0n895_1595_c1
981 nmdc:mga0n895_24667_c1
982 nmdc:mga0n895_366558_c1
983 nmdc:mga0n895_435529_c1
984 nmdc:mga0rr50_20716_c1
985 nmdc:mga0rr50_247599_c1
986 nmdc:mga0rr50_4093_c1
987 nmdc:mga08x19_1894_c1
988 nmdc:mga08x19_297628_c1
989 nmdc:mga08x19_553244_c1
990 nmdc:mga08x19_57449_c1
991 nmdc:mga08x19_63286_c1
992 nmdc:mga08x19_75135_c1
993 nmdc:mga08x19_82794_c1
994 nmdc:mga0a205_303313_c1
995 nmdc:mga0a205_5057_c2
996 nmdc:mga0a205_6050_c1
997 Ga0495601_0005991
998 Ga0495601_0046789
999 Ga0495601_0241052
1000 Ga0495612_0000451
1001 Ga0495612_0230547
1002 Ga0495595_0066552
1003 Ga0495619_0010855
1004 2753265585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

38

127

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.917 5 32
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9147 5 32
7e7h-assembly2.cif.gz_B crystal structure of a pseudooxynicotine amine oxidase pnao from pseudomonas putida s16 0.9133 6 33
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.9051 5 34
3urh-assembly1.cif.gz_A crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021 0.9014 6 33
ID Description Score Start End Superfamily
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9197 7 33 3.50.50.60
af_B0G160_35_582_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9065 7 33 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9026 5 34 3.50.50.60
3g5sA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8927 6 32 3.50.50.60
af_P9WM51_4_357_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8869 8 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A259S0I1-F1-model_v4 NADP oxidoreductase 0.9827 111 211
AF-A0A7W4T1D8-F1-model_v4 deleted 0.9697 117 210
AF-A0A379LTV6-F1-model_v4 Uncharacterized protein 0.9692 123 210
AF-A0A1H9SUV5-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9675 8 203
AF-A0A851I8Q9-F1-model_v4 deleted 0.9672 134 211

Map