F455804

General Info

Members Datasets Scaffolds Average Seq Length
502 225 491 311

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100139213|Ga0068868_1001392132
Length 350
Sequence MASSPCRAERPGTKGIDIDTREREEAAGLDILAYGEPMVEFNQTGEGGGRLYLQGFGGDSSNFAIAAARQGARVGYFSALGDDGNGRMLRALWDEEGVDHGDVRNDAGAFTAVYFVTHGARGHEFHFFRNGSAASRITAADVPRGRIAAAKVLHLSGISLAISANACDAGYAAIEVARDAGVRVSFDTNLRLGLWSIDRARAVMSDVMQRADICLPSYDDVRAITGLDDDDALVDRCLRLGAKTVALKMGERGALVFDGERRVALAPHPCKPVDATGAGDTFGGSLLARLVAGDGLVEAASYAGVAAALSTEGYGAVEPIPLGEQVRAARAAQAPRPSGSTTPRSRPRSA

Samples

Sample ID Description Type Environment
1 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
2 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
3 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
4 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
5 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
6 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
7 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
8 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
9 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
10 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
11 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.77
Nodule 0
Rhizoplane 3.98
Rhizosphere 87.05
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10010606 3300003322 Bacteria 3977
2 Ga0055538_1000155 3300003751 Bacteria 46426
3 Ga0055539_1000205 3300003752 Bacteria 46426
4 Ga0055533_1000207 3300003756 Bacteria 46426
5 Ga0055525_1000284 3300003759 Bacteria 46426
6 Ga0055526_1019969 3300003771 Bacteria 2411
7 Ga0055524_1007305 3300003775 Bacteria 4712
8 Ga0055536_1006351 3300003781 Bacteria 5543
9 Ga0055541_1000133 3300003841 Bacteria 46426
10 Ga0070658_10053813 3300005327 Bacteria 3268
11 Ga0070658_10088303 3300005327 Bacteria 2553
12 Ga0070658_10198594 3300005327 Bacteria 1692
13 Ga0070676_10004086 3300005328 Bacteria 7676
14 Ga0070676_10010250 3300005328 Bacteria 5083
15 Ga0070683_100012316 3300005329 Bacteria 7429
16 Ga0070690_100018066 3300005330 Bacteria 4253
17 Ga0070670_100001996 3300005331 Bacteria 16678
18 Ga0070670_100025318 3300005331 Bacteria 5106
19 Ga0070670_100036389 3300005331 Bacteria 4236
20 Ga0070670_100046708 3300005331 Bacteria 3724
21 Ga0070670_100072838 3300005331 Bacteria 2951
22 Ga0070670_100092373 3300005331 Bacteria 2602
23 Ga0070677_10007604 3300005333 Bacteria 3623
24 Ga0070677_10012390 3300005333 Bacteria 2962
25 Ga0070677_10025038 3300005333 Bacteria 2224
26 Ga0068869_100002609 3300005334 Bacteria 10881
27 Ga0068869_100022167 3300005334 Bacteria 4373
28 Ga0070666_10003932 3300005335 Bacteria 9025
29 Ga0070666_10066303 3300005335 Bacteria 2450
30 Ga0070680_100006496 3300005336 Bacteria 8895
31 Ga0068868_100006084 3300005338 Bacteria 8521
32 Ga0068868_100012140 3300005338 Bacteria 6291
33 Ga0068868_100139213 3300005338 Bacteria 1991
34 Ga0068868_100243628 3300005338 Bacteria 1511
35 Ga0070689_100022614 3300005340 Bacteria 4697
36 Ga0070689_100164536 3300005340 Bacteria 1795
37 Ga0070687_100013399 3300005343 Bacteria 3653
38 Ga0070661_100004582 3300005344 Bacteria 9506
39 Ga0070661_100106301 3300005344 Bacteria 2092
40 Ga0070661_100118925 3300005344 Bacteria 1977
41 Ga0070661_100330002 3300005344 Bacteria 1193
42 Ga0070668_100001912 3300005347 Bacteria 15233
43 Ga0070668_100074824 3300005347 Bacteria 2643
44 Ga0070668_100194344 3300005347 Bacteria 1663
45 Ga0070668_100268022 3300005347 Bacteria 1422
46 Ga0070669_100004154 3300005353 Bacteria 10502
47 Ga0070669_100005334 3300005353 Bacteria 9281
48 Ga0070669_100015849 3300005353 Bacteria 5376
49 Ga0070669_100049060 3300005353 Bacteria 3082
50 Ga0070675_100005905 3300005354 Bacteria 9377
51 Ga0070675_100008064 3300005354 Bacteria 8163
52 Ga0070675_100019464 3300005354 Bacteria 5411
53 Ga0070675_100021501 3300005354 Bacteria 5157
54 Ga0070675_100080988 3300005354 Bacteria 2707
55 Ga0070671_100009117 3300005355 Bacteria 7966
56 Ga0070671_100011396 3300005355 Bacteria 7148
57 Ga0070671_100034873 3300005355 Bacteria 4166
58 Ga0070671_100079188 3300005355 Bacteria 2746
59 Ga0070671_100187725 3300005355 Bacteria 1751
60 Ga0070671_100205355 3300005355 Bacteria 1671
61 Ga0070674_100000422 3300005356 Bacteria 21348
62 Ga0070674_100004419 3300005356 Bacteria 8016
63 Ga0070674_100009593 3300005356 Bacteria 5801
64 Ga0070673_100006380 3300005364 Bacteria 7665
65 Ga0070673_100014753 3300005364 Bacteria 5460
66 Ga0070673_100037703 3300005364 Bacteria 3685
67 Ga0070673_100117341 3300005364 Bacteria 2215
68 Ga0070673_100143955 3300005364 Bacteria 2013
69 Ga0070673_100245418 3300005364 Bacteria 1559
70 Ga0070659_100028246 3300005366 Bacteria 4330
71 Ga0070659_100071997 3300005366 Bacteria 2750
72 Ga0070667_100001966 3300005367 Bacteria 18245
73 Ga0070667_100013141 3300005367 Bacteria 6844
74 Ga0070667_100065294 3300005367 Bacteria 3090
75 Ga0070667_100516799 3300005367 Bacteria 1095
76 Ga0070701_10095368 3300005438 Bacteria 1638
77 Ga0070663_100024822 3300005455 Bacteria 4039
78 Ga0070663_100244078 3300005455 Bacteria 1419
79 Ga0070678_100000623 3300005456 Bacteria 17360
80 Ga0070678_100004960 3300005456 Bacteria 7620
81 Ga0070678_100008442 3300005456 Bacteria 6171
82 Ga0070678_100016066 3300005456 Bacteria 4775
83 Ga0070678_100114580 3300005456 Bacteria 2115
84 Ga0070678_100153827 3300005456 Bacteria 1856
85 Ga0070678_100222800 3300005456 Bacteria 1568
86 Ga0070662_100002386 3300005457 Bacteria 11541
87 Ga0070662_100006293 3300005457 Bacteria 7647
88 Ga0070662_100072632 3300005457 Bacteria 2541
89 Ga0070662_100120507 3300005457 Bacteria 2010
90 Ga0068867_100001767 3300005459 Bacteria 15038
91 Ga0068867_100005710 3300005459 Bacteria 8823
92 Ga0068867_100063221 3300005459 Bacteria 2751
93 Ga0068867_100179216 3300005459 Bacteria 1684
94 Ga0070679_100005291 3300005530 Bacteria 11945
95 Ga0070684_100018857 3300005535 Bacteria 5695
96 Ga0070684_100120860 3300005535 Bacteria 2356
97 Ga0068853_100019645 3300005539 Bacteria 5608
98 Ga0068853_100094673 3300005539 Bacteria 2632
99 Ga0070672_100002705 3300005543 Bacteria 11328
100 Ga0070672_100003225 3300005543 Bacteria 10557
101 Ga0070672_100006272 3300005543 Bacteria 7968
102 Ga0070672_100009849 3300005543 Bacteria 6605
103 Ga0070672_100011867 3300005543 Bacteria 6089
104 Ga0070672_100169157 3300005543 Bacteria 1817
105 Ga0070672_100173134 3300005543 Bacteria 1796
106 Ga0070672_100327272 3300005543 Bacteria 1303
107 Ga0070686_100255560 3300005544 Bacteria 1282
108 Ga0068855_100045864 3300005563 Bacteria 5168
109 Ga0068855_100094018 3300005563 Bacteria 3457
110 Ga0070664_100043522 3300005564 Bacteria 3788
111 Ga0070664_100220298 3300005564 Bacteria 1698
112 Ga0068857_100007335 3300005577 Bacteria 9495
113 Ga0068854_100010163 3300005578 Bacteria 6098
114 Ga0068854_100010945 3300005578 Bacteria 5887
115 Ga0068854_100046508 3300005578 Bacteria 3090
116 Ga0068854_100218539 3300005578 Bacteria 1506
117 Ga0068856_100021624 3300005614 Bacteria 6252
118 Ga0070702_100366960 3300005615 Bacteria 1019
119 Ga0068852_100011610 3300005616 Bacteria 6644
120 Ga0068852_100012671 3300005616 Bacteria 6413
121 Ga0068852_100032471 3300005616 Bacteria 4323
122 Ga0068852_100073244 3300005616 Bacteria 3013
123 Ga0068852_100115543 3300005616 Bacteria 2447
124 Ga0068852_100188692 3300005616 Bacteria 1943
125 Ga0068852_100270939 3300005616 Bacteria 1634
126 Ga0068859_100056963 3300005617 Bacteria 3936
127 Ga0068859_100227142 3300005617 Bacteria 1955
128 Ga0068864_100000817 3300005618 Bacteria 26204
129 Ga0068864_100001915 3300005618 Bacteria 17082
130 Ga0068864_100008913 3300005618 Bacteria 8269
131 Ga0068864_100013259 3300005618 Bacteria 6828
132 Ga0068864_100022083 3300005618 Bacteria 5334
133 Ga0068864_100066794 3300005618 Bacteria 3122
134 Ga0068864_100308726 3300005618 Bacteria 1483
135 Ga0068866_10027216 3300005718 Bacteria 2709
136 Ga0068866_10040147 3300005718 Bacteria 2315
137 Ga0068861_100003183 3300005719 Bacteria 10860
138 Ga0068861_100008700 3300005719 Bacteria 6983
139 Ga0068851_10017222 3300005834 Bacteria 3467
140 Ga0068870_10039892 3300005840 Bacteria 2432
141 Ga0068870_10055376 3300005840 Bacteria 2113
142 Ga0068863_100011347 3300005841 Bacteria 8627
143 Ga0068863_100012732 3300005841 Bacteria 8111
144 Ga0068863_100013120 3300005841 Bacteria 7995
145 Ga0068863_100058832 3300005841 Bacteria 3637
146 Ga0068858_100004486 3300005842 Bacteria 13686
147 Ga0068858_100004529 3300005842 Bacteria 13626
148 Ga0068858_100007226 3300005842 Bacteria 10764
149 Ga0068858_100038738 3300005842 Bacteria 4422
150 Ga0068858_100395114 3300005842 Bacteria 1328
151 Ga0068860_100002683 3300005843 Bacteria 18524
152 Ga0068860_100003994 3300005843 Bacteria 15140
153 Ga0068860_100217901 3300005843 Bacteria 1853
154 Ga0068862_100015060 3300005844 Bacteria 6423
155 Ga0068862_100219468 3300005844 Bacteria 1721
156 Ga0081538_10049508 3300005981 Bacteria 2548
157 Ga0075365_10003405 3300006038 Bacteria 8181
158 Ga0075368_10007521 3300006042 Bacteria 3844
159 Ga0075364_10009796 3300006051 Bacteria 5763
160 Ga0075366_10029651 3300006195 Bacteria 3215
161 Ga0097621_100003755 3300006237 Bacteria 10524
162 Ga0097621_100004171 3300006237 Bacteria 10025
163 Ga0097621_100004884 3300006237 Bacteria 9398
164 Ga0075370_10100444 3300006353 Bacteria 1674
165 Ga0068871_100001394 3300006358 Bacteria 16183
166 Ga0068871_100017063 3300006358 Bacteria 5486
167 Ga0068871_100017652 3300006358 Bacteria 5405
168 Ga0068871_100021820 3300006358 Bacteria 4929
169 Ga0068871_100123456 3300006358 Bacteria 2190
170 Ga0075434_100042804 3300006871 Bacteria 4491
171 Ga0068865_100008939 3300006881 Bacteria 6199
172 Ga0068865_100017013 3300006881 Bacteria 4667
173 Ga0068865_100027541 3300006881 Bacteria 3755
174 Ga0097620_100056960 3300006931 Bacteria 3936
175 Ga0097620_100227123 3300006931 Bacteria 1955
176 Ga0105240_10454650 3300009093 Bacteria 1432
177 Ga0105240_10652711 3300009093 Bacteria 1153
178 Ga0105245_10083198 3300009098 Bacteria 2929
179 Ga0105243_10264180 3300009148 Bacteria 1542
180 Ga0105241_10213294 3300009174 Bacteria 1619
181 Ga0105248_10010348 3300009177 Bacteria 10269
182 Ga0105248_10010604 3300009177 Bacteria 10158
183 Ga0105248_10012543 3300009177 Bacteria 9348
184 Ga0105248_10043854 3300009177 Bacteria 5016
185 Ga0105248_10085669 3300009177 Bacteria 3545
186 Ga0105248_10138163 3300009177 Bacteria 2749
187 Ga0105248_10417484 3300009177 Bacteria 1511
188 Ga0105248_10475689 3300009177 Bacteria 1408
189 Ga0105237_10035832 3300009545 Bacteria 5019
190 Ga0105237_10329799 3300009545 Bacteria 1530
191 Ga0105238_10001273 3300009551 Bacteria 25347
192 Ga0105238_10013227 3300009551 Bacteria 8326
193 Ga0105249_10053090 3300009553 Bacteria 3704
194 Ga0105239_10131252 3300010375 Bacteria 2787
195 Ga0105239_10186196 3300010375 Bacteria 2323
196 Ga0157373_10033739 3300013100 Bacteria 3679
197 Ga0157371_10066214 3300013102 Bacteria 2558
198 Ga0157369_10431707 3300013105 Bacteria 1365
199 Ga0157374_10007118 3300013296 Bacteria 9528
200 Ga0157374_10267039 3300013296 Bacteria 1687
201 Ga0163162_10001310 3300013306 Bacteria 23257
202 Ga0163162_10049801 3300013306 Bacteria 4200
203 Ga0163162_10187432 3300013306 Bacteria 2196
204 Ga0163162_10199922 3300013306 Bacteria 2127
205 Ga0163162_10404199 3300013306 Bacteria 1498
206 Ga0163162_10478460 3300013306 Bacteria 1377
207 Ga0157372_10006557 3300013307 Bacteria 12385
208 Ga0157372_10010659 3300013307 Bacteria 9778
209 Ga0157372_10710048 3300013307 Bacteria 1170
210 Ga0157375_10004510 3300013308 Bacteria 12107
211 Ga0157375_10005098 3300013308 Bacteria 11399
212 Ga0157375_10023842 3300013308 Bacteria 5653
213 Ga0157375_10034836 3300013308 Bacteria 4799
214 Ga0157375_10087018 3300013308 Bacteria 3176
215 Ga0163163_10002325 3300014325 Bacteria 16062
216 Ga0163163_10103317 3300014325 Bacteria 2874
217 Ga0163163_10133606 3300014325 Bacteria 2522
218 Ga0163163_10566906 3300014325 Bacteria 1198
219 Ga0157380_10002416 3300014326 Bacteria 12576
220 Ga0157380_10180794 3300014326 Bacteria 1853
221 Ga0157377_10004115 3300014745 Bacteria 6645
222 Ga0157379_10007020 3300014968 Bacteria 9733
223 Ga0157379_10025641 3300014968 Bacteria 5239
224 Ga0157379_10028945 3300014968 Bacteria 4926
225 Ga0157376_10005186 3300014969 Bacteria 9089
226 Ga0157376_10021803 3300014969 Bacteria 4979
227 Ga0157376_10022375 3300014969 Bacteria 4926
228 Ga0157376_10285474 3300014969 Bacteria 1556
229 Ga0157376_10516023 3300014969 Bacteria 1177
230 Ga0182006_1001264 3300015261 Bacteria 15627
231 Ga0163161_10005205 3300017792 Bacteria 9048
232 Ga0163161_10011133 3300017792 Bacteria 6233
233 Ga0163161_10032156 3300017792 Bacteria 3744
234 Ga0163161_10140462 3300017792 Bacteria 1829
235 Ga0213876_10016973 3300021384 Bacteria 3845
236 Ga0213876_10114968 3300021384 Bacteria 1428
237 Ga0209784_100002 3300025224 Bacteria 1753105
238 Ga0209566_100003 3300025225 Bacteria 1753105
239 Ga0209674_100004 3300025226 Bacteria 1753105
240 Ga0209563_100006 3300025230 Bacteria 1753105
241 Ga0209677_100003 3300025253 Bacteria 1753105
242 Ga0209675_1002614 3300025291 Bacteria 9124
243 Ga0209676_1000547 3300025292 Bacteria 57868
244 Ga0209025_1004773 3300025294 Bacteria 11508
245 Ga0209256_1004400 3300025299 Bacteria 8878
246 Ga0207656_10001853 3300025321 Bacteria 7030
247 Ga0207656_10091993 3300025321 Bacteria 1378
248 Ga0207682_10000414 3300025893 Bacteria 19591
249 Ga0207682_10005419 3300025893 Bacteria 5195
250 Ga0207682_10013852 3300025893 Bacteria 3140
251 Ga0207682_10033652 3300025893 Bacteria 2064
252 Ga0207642_10015183 3300025899 Bacteria 2862
253 Ga0207688_10070045 3300025901 Bacteria 1988
254 Ga0207688_10076066 3300025901 Bacteria 1911
255 Ga0207680_10014250 3300025903 Bacteria 4108
256 Ga0207680_10023176 3300025903 Bacteria 3386
257 Ga0207680_10144987 3300025903 Bacteria 1578
258 Ga0207645_10007675 3300025907 Bacteria 7602
259 Ga0207645_10014837 3300025907 Bacteria 5199
260 Ga0207645_10028965 3300025907 Bacteria 3571
261 Ga0207645_10074205 3300025907 Bacteria 2177
262 Ga0207705_10008377 3300025909 Bacteria 7549
263 Ga0207705_10372426 3300025909 Bacteria 1102
264 Ga0207707_10272856 3300025912 Bacteria 1466
265 Ga0207695_10002435 3300025913 Bacteria 27506
266 Ga0207695_10428935 3300025913 Bacteria 1206
267 Ga0207671_10008088 3300025914 Bacteria 8981
268 Ga0207662_10005054 3300025918 Bacteria 6988
269 Ga0207657_10018197 3300025919 Bacteria 6722
270 Ga0207657_10116936 3300025919 Bacteria 2196
271 Ga0207657_10275495 3300025919 Bacteria 1337
272 Ga0207649_10003773 3300025920 Bacteria 8263
273 Ga0207652_10143727 3300025921 Bacteria 2134
274 Ga0207681_10000473 3300025923 Bacteria 28146
275 Ga0207681_10009896 3300025923 Bacteria 5834
276 Ga0207681_10021375 3300025923 Bacteria 4112
277 Ga0207681_10114828 3300025923 Bacteria 1965
278 Ga0207694_10001091 3300025924 Bacteria 23538
279 Ga0207650_10005579 3300025925 Bacteria 8591
280 Ga0207650_10010106 3300025925 Bacteria 6467
281 Ga0207650_10017541 3300025925 Bacteria 5015
282 Ga0207650_10020666 3300025925 Bacteria 4646
283 Ga0207650_10135234 3300025925 Bacteria 1933
284 Ga0207650_10234133 3300025925 Bacteria 1482
285 Ga0207650_10413506 3300025925 Bacteria 1118
286 Ga0207659_10002984 3300025926 Bacteria 10084
287 Ga0207659_10005423 3300025926 Bacteria 7728
288 Ga0207659_10016084 3300025926 Bacteria 4863
289 Ga0207659_10040475 3300025926 Bacteria 3259
290 Ga0207659_10073427 3300025926 Bacteria 2504
291 Ga0207659_10083661 3300025926 Bacteria 2366
292 Ga0207659_10088037 3300025926 Bacteria 2312
293 Ga0207687_10081434 3300025927 Bacteria 2339
294 Ga0207687_10119967 3300025927 Bacteria 1965
295 Ga0207644_10002025 3300025931 Bacteria 13102
296 Ga0207644_10011603 3300025931 Bacteria 5833
297 Ga0207644_10027083 3300025931 Bacteria 3957
298 Ga0207690_10005896 3300025932 Bacteria 7253
299 Ga0207706_10008424 3300025933 Bacteria 9516
300 Ga0207706_10009492 3300025933 Bacteria 8935
301 Ga0207706_10056682 3300025933 Bacteria 3454
302 Ga0207706_10070319 3300025933 Bacteria 3079
303 Ga0207706_10368879 3300025933 Bacteria 1247
304 Ga0207709_10017443 3300025935 Bacteria 4007
305 Ga0207670_10244256 3300025936 Bacteria 1384
306 Ga0207669_10004750 3300025937 Bacteria 6015
307 Ga0207669_10007170 3300025937 Bacteria 5134
308 Ga0207669_10154472 3300025937 Bacteria 1612
309 Ga0207704_10006202 3300025938 Bacteria 5557
310 Ga0207704_10228788 3300025938 Bacteria 1381
311 Ga0207691_10000186 3300025940 Bacteria 58949
312 Ga0207691_10010046 3300025940 Bacteria 9083
313 Ga0207691_10011461 3300025940 Bacteria 8507
314 Ga0207691_10013124 3300025940 Bacteria 7931
315 Ga0207691_10016270 3300025940 Bacteria 7062
316 Ga0207691_10023935 3300025940 Bacteria 5747
317 Ga0207691_10026819 3300025940 Bacteria 5406
318 Ga0207691_10034598 3300025940 Bacteria 4696
319 Ga0207691_10053680 3300025940 Bacteria 3679
320 Ga0207691_10254808 3300025940 Bacteria 1514
321 Ga0207691_10447478 3300025940 Bacteria 1099
322 Ga0207711_10017485 3300025941 Bacteria 5957
323 Ga0207711_10022995 3300025941 Bacteria 5217
324 Ga0207711_10198895 3300025941 Bacteria 1828
325 Ga0207711_10219149 3300025941 Bacteria 1740
326 Ga0207689_10000550 3300025942 Bacteria 35746
327 Ga0207689_10012799 3300025942 Bacteria 7165
328 Ga0207679_10003726 3300025945 Bacteria 9451
329 Ga0207679_10146798 3300025945 Bacteria 1914
330 Ga0207667_10000438 3300025949 Bacteria 55784
331 Ga0207667_10027709 3300025949 Bacteria 6163
332 Ga0207667_10071265 3300025949 Bacteria 3614
333 Ga0207651_10000508 3300025960 Bacteria 16359
334 Ga0207651_10007427 3300025960 Bacteria 5840
335 Ga0207651_10011223 3300025960 Bacteria 5005
336 Ga0207651_10069417 3300025960 Bacteria 2488
337 Ga0207651_10071443 3300025960 Bacteria 2460
338 Ga0207651_10174245 3300025960 Bacteria 1700
339 Ga0207651_10206411 3300025960 Bacteria 1578
340 Ga0207712_10008643 3300025961 Bacteria 6438
341 Ga0207668_10004414 3300025972 Bacteria 8261
342 Ga0207668_10122803 3300025972 Bacteria 1969
343 Ga0207640_10019823 3300025981 Bacteria 3981
344 Ga0207640_10051698 3300025981 Bacteria 2672
345 Ga0207640_10061126 3300025981 Bacteria 2494
346 Ga0207640_10162440 3300025981 Bacteria 1654
347 Ga0207640_10350208 3300025981 Bacteria 1186
348 Ga0207658_10002217 3300025986 Bacteria 14426
349 Ga0207658_10062250 3300025986 Bacteria 2792
350 Ga0207658_10174616 3300025986 Bacteria 1773
351 Ga0207658_10257441 3300025986 Bacteria 1486
352 Ga0207658_10263242 3300025986 Bacteria 1470
353 Ga0207677_10000871 3300026023 Bacteria 17171
354 Ga0207677_10057159 3300026023 Bacteria 2677
355 Ga0207677_10146583 3300026023 Bacteria 1815
356 Ga0207677_10233314 3300026023 Bacteria 1484
357 Ga0207703_10000277 3300026035 Bacteria 56761
358 Ga0207703_10012355 3300026035 Bacteria 6656
359 Ga0207703_10028691 3300026035 Bacteria 4390
360 Ga0207703_10051599 3300026035 Bacteria 3334
361 Ga0207639_10007798 3300026041 Bacteria 7312
362 Ga0207639_10159520 3300026041 Bacteria 1899
363 Ga0207678_10014287 3300026067 Bacteria 6981
364 Ga0207678_10046638 3300026067 Bacteria 3747
365 Ga0207678_10109904 3300026067 Bacteria 2351
366 Ga0207678_10156847 3300026067 Bacteria 1943
367 Ga0207708_10063298 3300026075 Bacteria 2826
368 Ga0207708_10107991 3300026075 Bacteria 2158
369 Ga0207702_10004454 3300026078 Bacteria 12446
370 Ga0207641_10002779 3300026088 Bacteria 15944
371 Ga0207641_10047303 3300026088 Bacteria 3627
372 Ga0207641_10058278 3300026088 Bacteria 3286
373 Ga0207641_10065747 3300026088 Bacteria 3102
374 Ga0207641_10140430 3300026088 Bacteria 2179
375 Ga0207641_10408165 3300026088 Bacteria 1305
376 Ga0207648_10002813 3300026089 Bacteria 18446
377 Ga0207648_10009743 3300026089 Bacteria 9186
378 Ga0207648_10018173 3300026089 Bacteria 6369
379 Ga0207648_10037720 3300026089 Bacteria 4256
380 Ga0207648_10073125 3300026089 Bacteria 2988
381 Ga0207648_10082017 3300026089 Bacteria 2812
382 Ga0207676_10006632 3300026095 Bacteria 8183
383 Ga0207676_10007048 3300026095 Bacteria 7968
384 Ga0207676_10018564 3300026095 Bacteria 5058
385 Ga0207676_10084138 3300026095 Bacteria 2592
386 Ga0207676_10109296 3300026095 Bacteria 2310
387 Ga0207676_10247691 3300026095 Bacteria 1602
388 Ga0207674_10023446 3300026116 Bacteria 6611
389 Ga0207674_10121300 3300026116 Bacteria 2581
390 Ga0207675_100000576 3300026118 Bacteria 35873
391 Ga0207675_100002372 3300026118 Bacteria 18650
392 Ga0207675_100055728 3300026118 Bacteria 3689
393 Ga0207683_10002558 3300026121 Bacteria 15875
394 Ga0207683_10008937 3300026121 Bacteria 8535
395 Ga0207683_10020305 3300026121 Bacteria 5681
396 Ga0207683_10022185 3300026121 Bacteria 5449
397 Ga0207683_10032351 3300026121 Bacteria 4543
398 Ga0207683_10043731 3300026121 Bacteria 3915
399 Ga0207683_10054152 3300026121 Bacteria 3517
400 Ga0207683_10152139 3300026121 Bacteria 2088
401 Ga0207683_10279819 3300026121 Bacteria 1525
402 Ga0207698_10007391 3300026142 Bacteria 6882
403 Ga0207698_10086569 3300026142 Bacteria 2548
404 Ga0207698_10087984 3300026142 Bacteria 2532
405 Ga0207698_10121910 3300026142 Bacteria 2209
406 Ga0207698_10275994 3300026142 Bacteria 1552
407 Ga0207698_10333258 3300026142 Bacteria 1426
408 Ga0209970_1000358 3300027614 Bacteria 7658
409 Ga0209813_10004728 3300027866 Bacteria 3264
410 Ga0268265_10010050 3300028380 Bacteria 6389
411 Ga0268265_10041588 3300028380 Bacteria 3403
412 Ga0268264_10002728 3300028381 Bacteria 15415
413 Ga0268264_10005650 3300028381 Bacteria 10599
414 Ga0265314_10003924 3300031711 Bacteria 14131
415 Ga0265342_10082926 3300031712 Bacteria 1849
416 Ga0307405_10037698 3300031731 Bacteria 2907
417 Ga0307413_10006366 3300031824 Bacteria 5382
418 Ga0307413_10146509 3300031824 Bacteria 1640
419 Ga0307406_10006978 3300031901 Bacteria 6254
420 Ga0307406_10012222 3300031901 Bacteria 4893
421 Ga0307412_10011706 3300031911 Bacteria 5088
422 Ga0307412_10029800 3300031911 Bacteria 3428
423 Ga0307409_100000680 3300031995 Bacteria 15083
424 Ga0307409_100206627 3300031995 Bacteria 1761
425 Ga0307416_100001182 3300032002 Bacteria 14007
426 Ga0307416_100034721 3300032002 Bacteria 3842
427 Ga0307411_10007142 3300032005 Bacteria 5658
428 Ga0307415_100015183 3300032126 Bacteria 4552
429 Ga0307510_10030567 3300033180 Bacteria 6104
430 Ga0373929_0005882 3300035085 Bacteria 2215
431 Ga0373944_0010859 3300035089 Bacteria 2489
432 Ga0373943_0176996 3300035170 Bacteria 1170
433 Ga0373946_0054374 3300035171 Bacteria 1685
434 Ga0373931_0009502 3300035691 Bacteria 4650
435 Ga0373937_0050114 3300036401 Bacteria 3824
436 Ga0395900_0023206 3300037418 Bacteria 6351
437 Ga0395898_0015152 3300037466 Bacteria 7913
438 Ga0395905_0000025 3300037471 Bacteria 317571
439 Ga0395905_0687735 3300037471 Bacteria 925
440 Ga0395901_0023751 3300038443 Bacteria 6286
441 Ga0395901_0438997 3300038443 Bacteria 1336
442 Ga0436365_1466894 3300039437 Bacteria 13672
443 Ga0466969_0012132 3300044656 Bacteria 4554
444 Ga0466966_0011924 3300044684 Bacteria 5761
445 Ga0466961_0016813 3300044693 Bacteria 4703
446 Ga0466968_0131538 3300044735 Bacteria 1139
447 Ga0495629_0053161 3300046459 Bacteria 2834
448 Ga0495620_0031131 3300046515 Bacteria 2448
449 Ga0495628_0137313 3300046516 Bacteria 1868
450 Ga0495632_0031298 3300046519 Bacteria 2752
451 Ga0495647_0014196 3300046681 Bacteria 2772
452 Ga0495647_0110458 3300046681 Bacteria 1147
453 Ga0495658_0033191 3300046683 Bacteria 2825
454 Ga0495684_0099250 3300047471 Bacteria 2202
455 Ga0496100_0036990 3300048903 Bacteria 3083
456 Ga0496101_0106940 3300048904 Bacteria 2101
457 Ga0496102_0000771 3300048905 Bacteria 31181
458 Ga0496104_0214501 3300048907 Bacteria 1837
459 Ga0496104_0289733 3300048907 Bacteria 1549
460 Ga0496106_0011948 3300048909 Bacteria 6411
461 Ga0496107_0009894 3300048910 Bacteria 6616
462 Ga0496108_0029383 3300048911 Bacteria 4551
463 Ga0496108_0063493 3300048911 Bacteria 3110
464 Ga0496108_0154217 3300048911 Bacteria 1983
465 Ga0496108_0220969 3300048911 Bacteria 1646
466 Ga0496109_0064653 3300048912 Bacteria 3348
467 Ga0496109_0090403 3300048912 Bacteria 2832
468 Ga0496109_0171419 3300048912 Bacteria 2036
469 Ga0496110_0002997 3300048913 Bacteria 12811
470 Ga0496110_0151107 3300048913 Bacteria 2103
471 Ga0496110_0469358 3300048913 Bacteria 1147
472 Ga0496114_0076139 3300048917 Bacteria 2827
473 Ga0496114_0141127 3300048917 Bacteria 2086
474 Ga0496115_0024126 3300048918 Bacteria 4725
475 Ga0501075_0145256 3300049591 Bacteria 1808
476 Ga0501076_0076070 3300049592 Bacteria 2692
477 Ga0501045_0051844 3300049824 Bacteria 2995
478 nmdc:mga03n38_125556_c1 3300050490 Bacteria 1266
479 nmdc:mga00v17_8336_c1 3300050491 Bacteria 5576
480 nmdc:mga0k408_28056_c1 3300050493 Bacteria 3199
481 nmdc:mga06z11_2269_c1 3300050494 Bacteria 7318
482 nmdc:mga04h51_4290_c1 3300050495 Bacteria 3534
483 nmdc:mga07m45_43454_c1 3300050496 Bacteria 2519
484 nmdc:mga08y16_645600_c1 3300050511 Bacteria 1063
485 nmdc:mga0n895_295943_c1 3300050512 Bacteria 1641
486 Ga0495595_0143394 3300053084 Bacteria 1173
487 Ga0500644_0002584 3300053088 Bacteria 4523
488 Ga0500651_0043827 3300053093 Bacteria 2817
489 Ga0500559_0000022 3300053136 Bacteria 128071
490 Ga0500559_0016414 3300053136 Bacteria 3126
491 Ga0500622_0000498 3300053156 Bacteria 36624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025901 Ga0207688_10070045 Ga0207688_100700453 273
2 3300005338 Ga0068868_100243628 Ga0068868_1002436282 292
3 3300005355 Ga0070671_100011396 Ga0070671_1000113965 292
4 3300009177 Ga0105248_10043854 Ga0105248_100438542 292
5 3300014969 Ga0157376_10516023 Ga0157376_105160231 292
6 3300026023 Ga0207677_10233314 Ga0207677_102333142 292
7 3300037471 Ga0395905_0687735 Ga0395905_0687735_14_910 293
8 3300026067 Ga0207678_10046638 Ga0207678_100466385 294
9 3300006195 Ga0075366_10029651 Ga0075366_100296512 298
10 3300050493 nmdc:mga0k408_28056_c1 nmdc:mga0k408_28056_c1_1420_2340 298
11 3300005459 Ga0068867_100063221 Ga0068867_1000632212 299
12 3300005543 Ga0070672_100011867 Ga0070672_1000118673 299
13 3300021384 Ga0213876_10016973 Ga0213876_100169733 299
14 3300025940 Ga0207691_10026819 Ga0207691_100268194 299
15 3300026089 Ga0207648_10037720 Ga0207648_100377202 299
16 3300037418 Ga0395900_0023206 Ga0395900_0023206_1584_2522 299
17 3300037466 Ga0395898_0015152 Ga0395898_0015152_3075_4013 299
18 3300038443 Ga0395901_0023751 Ga0395901_0023751_4885_5823 299
19 3300039437 Ga0436365_1466894 Ga0436365_1466894_3342_4259 299
20 3300005328 Ga0070676_10004086 Ga0070676_100040866 300
21 3300005330 Ga0070690_100018066 Ga0070690_1000180662 300
22 3300005331 Ga0070670_100001996 Ga0070670_10000199611 300
23 3300005331 Ga0070670_100036389 Ga0070670_1000363892 300
24 3300005331 Ga0070670_100046708 Ga0070670_1000467083 300
25 3300005333 Ga0070677_10012390 Ga0070677_100123902 300
26 3300005334 Ga0068869_100022167 Ga0068869_1000221672 300
27 3300005335 Ga0070666_10066303 Ga0070666_100663033 300
28 3300005340 Ga0070689_100022614 Ga0070689_1000226144 300
29 3300005343 Ga0070687_100013399 Ga0070687_1000133994 300
30 3300005344 Ga0070661_100106301 Ga0070661_1001063012 300
31 3300005347 Ga0070668_100001912 Ga0070668_1000019127 300
32 3300005353 Ga0070669_100004154 Ga0070669_1000041548 300
33 3300005354 Ga0070675_100019464 Ga0070675_1000194643 300
34 3300005355 Ga0070671_100079188 Ga0070671_1000791883 300
35 3300005355 Ga0070671_100187725 Ga0070671_1001877252 300
36 3300005356 Ga0070674_100000422 Ga0070674_1000004225 300
37 3300005364 Ga0070673_100117341 Ga0070673_1001173412 300
38 3300005364 Ga0070673_100143955 Ga0070673_1001439552 300
39 3300005364 Ga0070673_100245418 Ga0070673_1002454182 300
40 3300005367 Ga0070667_100013141 Ga0070667_1000131412 300
41 3300005367 Ga0070667_100516799 Ga0070667_1005167991 300
42 3300005455 Ga0070663_100244078 Ga0070663_1002440782 300
43 3300005456 Ga0070678_100008442 Ga0070678_1000084425 300
44 3300005456 Ga0070678_100016066 Ga0070678_1000160663 300
45 3300005456 Ga0070678_100222800 Ga0070678_1002228003 300
46 3300005457 Ga0070662_100002386 Ga0070662_1000023866 300
47 3300005457 Ga0070662_100072632 Ga0070662_1000726323 300
48 3300005459 Ga0068867_100005710 Ga0068867_1000057107 300
49 3300005543 Ga0070672_100002705 Ga0070672_1000027056 300
50 3300005543 Ga0070672_100006272 Ga0070672_1000062725 300
51 3300005543 Ga0070672_100327272 Ga0070672_1003272722 300
52 3300005544 Ga0070686_100255560 Ga0070686_1002555601 300
53 3300005564 Ga0070664_100043522 Ga0070664_1000435223 300
54 3300005564 Ga0070664_100220298 Ga0070664_1002202982 300
55 3300005578 Ga0068854_100218539 Ga0068854_1002185392 300
56 3300005616 Ga0068852_100115543 Ga0068852_1001155433 300
57 3300005616 Ga0068852_100188692 Ga0068852_1001886923 300
58 3300005616 Ga0068852_100270939 Ga0068852_1002709392 300
59 3300005618 Ga0068864_100001915 Ga0068864_10000191518 300
60 3300005618 Ga0068864_100022083 Ga0068864_1000220834 300
61 3300005618 Ga0068864_100308726 Ga0068864_1003087262 300
62 3300005718 Ga0068866_10027216 Ga0068866_100272162 300
63 3300005718 Ga0068866_10040147 Ga0068866_100401472 300
64 3300005719 Ga0068861_100008700 Ga0068861_1000087004 300
65 3300005840 Ga0068870_10039892 Ga0068870_100398922 300
66 3300005841 Ga0068863_100011347 Ga0068863_1000113473 300
67 3300005842 Ga0068858_100004486 Ga0068858_1000044867 300
68 3300005842 Ga0068858_100395114 Ga0068858_1003951142 300
69 3300005843 Ga0068860_100003994 Ga0068860_1000039945 300
70 3300005844 Ga0068862_100219468 Ga0068862_1002194682 300
71 3300006237 Ga0097621_100003755 Ga0097621_1000037556 300
72 3300006358 Ga0068871_100017063 Ga0068871_1000170635 300
73 3300006881 Ga0068865_100017013 Ga0068865_1000170134 300
74 3300009098 Ga0105245_10083198 Ga0105245_100831982 300
75 3300009148 Ga0105243_10264180 Ga0105243_102641801 300
76 3300009177 Ga0105248_10085669 Ga0105248_100856692 300
77 3300009177 Ga0105248_10138163 Ga0105248_101381633 300
78 3300009177 Ga0105248_10417484 Ga0105248_104174841 300
79 3300009177 Ga0105248_10475689 Ga0105248_104756892 300
80 3300009553 Ga0105249_10053090 Ga0105249_100530905 300
81 3300013102 Ga0157371_10066214 Ga0157371_100662142 300
82 3300013105 Ga0157369_10431707 Ga0157369_104317072 300
83 3300013306 Ga0163162_10001310 Ga0163162_1000131013 300
84 3300013306 Ga0163162_10404199 Ga0163162_104041992 300
85 3300013307 Ga0157372_10710048 Ga0157372_107100482 300
86 3300013308 Ga0157375_10004510 Ga0157375_100045106 300
87 3300013308 Ga0157375_10023842 Ga0157375_100238424 300
88 3300014325 Ga0163163_10103317 Ga0163163_101033172 300
89 3300014325 Ga0163163_10133606 Ga0163163_101336062 300
90 3300014326 Ga0157380_10002416 Ga0157380_100024164 300
91 3300014968 Ga0157379_10007020 Ga0157379_100070204 300
92 3300014969 Ga0157376_10021803 Ga0157376_100218032 300
93 3300017792 Ga0163161_10005205 Ga0163161_100052056 300
94 3300017792 Ga0163161_10140462 Ga0163161_101404622 300
95 3300025893 Ga0207682_10013852 Ga0207682_100138522 300
96 3300025893 Ga0207682_10033652 Ga0207682_100336523 300
97 3300025899 Ga0207642_10015183 Ga0207642_100151832 300
98 3300025901 Ga0207688_10076066 Ga0207688_100760661 300
99 3300025903 Ga0207680_10023176 Ga0207680_100231764 300
100 3300025903 Ga0207680_10144987 Ga0207680_101449874 300
101 3300025907 Ga0207645_10014837 Ga0207645_100148372 300
102 3300025907 Ga0207645_10074205 Ga0207645_100742052 300
103 3300025909 Ga0207705_10372426 Ga0207705_103724261 300
104 3300025918 Ga0207662_10005054 Ga0207662_100050544 300
105 3300025923 Ga0207681_10000473 Ga0207681_1000047318 300
106 3300025925 Ga0207650_10010106 Ga0207650_100101062 300
107 3300025925 Ga0207650_10135234 Ga0207650_101352342 300
108 3300025925 Ga0207650_10234133 Ga0207650_102341332 300
109 3300025925 Ga0207650_10413506 Ga0207650_104135061 300
110 3300025926 Ga0207659_10005423 Ga0207659_100054237 300
111 3300025926 Ga0207659_10040475 Ga0207659_100404753 300
112 3300025926 Ga0207659_10083661 Ga0207659_100836613 300
113 3300025927 Ga0207687_10081434 Ga0207687_100814342 300
114 3300025933 Ga0207706_10009492 Ga0207706_100094926 300
115 3300025933 Ga0207706_10056682 Ga0207706_100566822 300
116 3300025935 Ga0207709_10017443 Ga0207709_100174433 300
117 3300025937 Ga0207669_10004750 Ga0207669_100047505 300
118 3300025938 Ga0207704_10006202 Ga0207704_100062024 300
119 3300025940 Ga0207691_10010046 Ga0207691_100100466 300
120 3300025940 Ga0207691_10011461 Ga0207691_100114617 300
121 3300025940 Ga0207691_10013124 Ga0207691_100131245 300
122 3300025940 Ga0207691_10254808 Ga0207691_102548082 300
123 3300025940 Ga0207691_10447478 Ga0207691_104474782 300
124 3300025941 Ga0207711_10219149 Ga0207711_102191492 300
125 3300025942 Ga0207689_10012799 Ga0207689_100127993 300
126 3300025960 Ga0207651_10007427 Ga0207651_100074272 300
127 3300025960 Ga0207651_10071443 Ga0207651_100714432 300
128 3300025961 Ga0207712_10008643 Ga0207712_100086435 300
129 3300025972 Ga0207668_10004414 Ga0207668_100044144 300
130 3300025981 Ga0207640_10162440 Ga0207640_101624403 300
131 3300025981 Ga0207640_10350208 Ga0207640_103502082 300
132 3300025986 Ga0207658_10002217 Ga0207658_100022176 300
133 3300025986 Ga0207658_10257441 Ga0207658_102574411 300
134 3300026035 Ga0207703_10051599 Ga0207703_100515992 300
135 3300026067 Ga0207678_10156847 Ga0207678_101568473 300
136 3300026075 Ga0207708_10063298 Ga0207708_100632982 300
137 3300026088 Ga0207641_10002779 Ga0207641_100027799 300
138 3300026088 Ga0207641_10140430 Ga0207641_101404303 300
139 3300026089 Ga0207648_10018173 Ga0207648_100181732 300
140 3300026089 Ga0207648_10082017 Ga0207648_100820172 300
141 3300026095 Ga0207676_10006632 Ga0207676_100066325 300
142 3300026095 Ga0207676_10109296 Ga0207676_101092962 300
143 3300026095 Ga0207676_10247691 Ga0207676_102476912 300
144 3300026118 Ga0207675_100002372 Ga0207675_10000237210 300
145 3300026121 Ga0207683_10020305 Ga0207683_100203053 300
146 3300026121 Ga0207683_10032351 Ga0207683_100323513 300
147 3300026121 Ga0207683_10043731 Ga0207683_100437312 300
148 3300026121 Ga0207683_10054152 Ga0207683_100541522 300
149 3300026121 Ga0207683_10279819 Ga0207683_102798191 300
150 3300026142 Ga0207698_10087984 Ga0207698_100879842 300
151 3300026142 Ga0207698_10275994 Ga0207698_102759942 300
152 3300026142 Ga0207698_10333258 Ga0207698_103332582 300
153 3300028380 Ga0268265_10010050 Ga0268265_100100502 300
154 3300028381 Ga0268264_10002728 Ga0268264_100027288 300
155 3300035089 Ga0373944_0010859 Ga0373944_0010859_1130_2056 300
156 3300035170 Ga0373943_0176996 Ga0373943_0176996_185_1111 300
157 3300035171 Ga0373946_0054374 Ga0373946_0054374_90_1007 300
158 3300036401 Ga0373937_0050114 Ga0373937_0050114_1774_2706 300
159 3300046459 Ga0495629_0053161 Ga0495629_0053161_1730_2656 300
160 3300046516 Ga0495628_0137313 Ga0495628_0137313_113_1045 300
161 3300046681 Ga0495647_0014196 Ga0495647_0014196_1457_2389 300
162 3300046681 Ga0495647_0110458 Ga0495647_0110458_115_1041 300
163 3300046683 Ga0495658_0033191 Ga0495658_0033191_505_1437 300
164 3300047471 Ga0495684_0099250 Ga0495684_0099250_1254_2180 300
165 3300048907 Ga0496104_0214501 Ga0496104_0214501_696_1622 300
166 3300048911 Ga0496108_0220969 Ga0496108_0220969_163_1089 300
167 3300048912 Ga0496109_0090403 Ga0496109_0090403_1674_2600 300
168 3300048913 Ga0496110_0151107 Ga0496110_0151107_41_967 300
169 3300048917 Ga0496114_0076139 Ga0496114_0076139_1224_2150 300
170 3300050511 nmdc:mga08y16_645600_c1 nmdc:mga08y16_645600_c1_127_1053 300
171 3300053084 Ga0495595_0143394 Ga0495595_0143394_79_1011 300
172 3300003781 Ga0055536_1006351 Ga0055536_10063514 301
173 3300005327 Ga0070658_10088303 Ga0070658_100883031 301
174 3300005329 Ga0070683_100012316 Ga0070683_1000123167 301
175 3300005344 Ga0070661_100004582 Ga0070661_1000045825 301
176 3300005355 Ga0070671_100009117 Ga0070671_1000091173 301
177 3300005355 Ga0070671_100205355 Ga0070671_1002053552 301
178 3300005366 Ga0070659_100071997 Ga0070659_1000719972 301
179 3300005456 Ga0070678_100153827 Ga0070678_1001538272 301
180 3300005535 Ga0070684_100018857 Ga0070684_1000188575 301
181 3300005543 Ga0070672_100169157 Ga0070672_1001691572 301
182 3300005577 Ga0068857_100007335 Ga0068857_1000073357 301
183 3300005578 Ga0068854_100046508 Ga0068854_1000465084 301
184 3300005614 Ga0068856_100021624 Ga0068856_1000216247 301
185 3300005616 Ga0068852_100032471 Ga0068852_1000324713 301
186 3300005616 Ga0068852_100073244 Ga0068852_1000732442 301
187 3300005618 Ga0068864_100013259 Ga0068864_1000132593 301
188 3300005834 Ga0068851_10017222 Ga0068851_100172223 301
189 3300005841 Ga0068863_100013120 Ga0068863_1000131205 301
190 3300005841 Ga0068863_100058832 Ga0068863_1000588322 301
191 3300006237 Ga0097621_100004171 Ga0097621_1000041715 301
192 3300006358 Ga0068871_100021820 Ga0068871_1000218205 301
193 3300006358 Ga0068871_100123456 Ga0068871_1001234562 301
194 3300009093 Ga0105240_10454650 Ga0105240_104546502 301
195 3300009177 Ga0105248_10010348 Ga0105248_100103485 301
196 3300009551 Ga0105238_10013227 Ga0105238_100132277 301
197 3300013100 Ga0157373_10033739 Ga0157373_100337394 301
198 3300013296 Ga0157374_10267039 Ga0157374_102670392 301
199 3300013307 Ga0157372_10010659 Ga0157372_100106595 301
200 3300013308 Ga0157375_10005098 Ga0157375_100050983 301
201 3300014325 Ga0163163_10566906 Ga0163163_105669062 301
202 3300014969 Ga0157376_10285474 Ga0157376_102854741 301
203 3300025292 Ga0209676_1000547 Ga0209676_100054755 301
204 3300025321 Ga0207656_10091993 Ga0207656_100919932 301
205 3300025909 Ga0207705_10008377 Ga0207705_100083776 301
206 3300025913 Ga0207695_10428935 Ga0207695_104289351 301
207 3300025919 Ga0207657_10018197 Ga0207657_100181976 301
208 3300025920 Ga0207649_10003773 Ga0207649_100037736 301
209 3300025925 Ga0207650_10020666 Ga0207650_100206663 301
210 3300025931 Ga0207644_10002025 Ga0207644_100020257 301
211 3300025940 Ga0207691_10034598 Ga0207691_100345983 301
212 3300025941 Ga0207711_10017485 Ga0207711_100174852 301
213 3300025945 Ga0207679_10003726 Ga0207679_100037266 301
214 3300026023 Ga0207677_10146583 Ga0207677_101465832 301
215 3300026078 Ga0207702_10004454 Ga0207702_100044546 301
216 3300026088 Ga0207641_10047303 Ga0207641_100473034 301
217 3300026088 Ga0207641_10065747 Ga0207641_100657473 301
218 3300026116 Ga0207674_10023446 Ga0207674_100234463 301
219 3300026121 Ga0207683_10152139 Ga0207683_101521393 301
220 3300026142 Ga0207698_10086569 Ga0207698_100865691 301
221 3300026142 Ga0207698_10121910 Ga0207698_101219101 301
222 3300027614 Ga0209970_1000358 Ga0209970_10003584 301
223 3300053136 Ga0500559_0016414 Ga0500559_0016414_200_1123 301
224 3300005334 Ga0068869_100002609 Ga0068869_1000026095 302
225 3300005336 Ga0070680_100006496 Ga0070680_1000064969 302
226 3300005347 Ga0070668_100194344 Ga0070668_1001943442 302
227 3300005353 Ga0070669_100005334 Ga0070669_1000053349 302
228 3300005354 Ga0070675_100021501 Ga0070675_1000215015 302
229 3300005366 Ga0070659_100028246 Ga0070659_1000282464 302
230 3300005367 Ga0070667_100065294 Ga0070667_1000652942 302
231 3300005438 Ga0070701_10095368 Ga0070701_100953681 302
232 3300005455 Ga0070663_100024822 Ga0070663_1000248222 302
233 3300005457 Ga0070662_100006293 Ga0070662_1000062935 302
234 3300005530 Ga0070679_100005291 Ga0070679_1000052918 302
235 3300005535 Ga0070684_100120860 Ga0070684_1001208603 302
236 3300005539 Ga0068853_100019645 Ga0068853_1000196455 302
237 3300005539 Ga0068853_100094673 Ga0068853_1000946732 302
238 3300005543 Ga0070672_100003225 Ga0070672_10000322511 302
239 3300005563 Ga0068855_100045864 Ga0068855_1000458644 302
240 3300005578 Ga0068854_100010163 Ga0068854_1000101633 302
241 3300005616 Ga0068852_100011610 Ga0068852_1000116104 302
242 3300005616 Ga0068852_100012671 Ga0068852_1000126715 302
243 3300005617 Ga0068859_100227142 Ga0068859_1002271423 302
244 3300005618 Ga0068864_100008913 Ga0068864_1000089135 302
245 3300005719 Ga0068861_100003183 Ga0068861_1000031835 302
246 3300005842 Ga0068858_100007226 Ga0068858_1000072267 302
247 3300005842 Ga0068858_100038738 Ga0068858_1000387382 302
248 3300005843 Ga0068860_100002683 Ga0068860_10000268314 302
249 3300005843 Ga0068860_100217901 Ga0068860_1002179012 302
250 3300006358 Ga0068871_100017652 Ga0068871_1000176525 302
251 3300006871 Ga0075434_100042804 Ga0075434_1000428044 302
252 3300006931 Ga0097620_100227123 Ga0097620_1002271233 302
253 3300013306 Ga0163162_10478460 Ga0163162_104784602 302
254 3300013308 Ga0157375_10087018 Ga0157375_100870184 302
255 3300014968 Ga0157379_10028945 Ga0157379_100289453 302
256 3300017792 Ga0163161_10032156 Ga0163161_100321564 302
257 3300021384 Ga0213876_10114968 Ga0213876_101149682 302
258 3300025321 Ga0207656_10001853 Ga0207656_100018532 302
259 3300025907 Ga0207645_10028965 Ga0207645_100289654 302
260 3300025912 Ga0207707_10272856 Ga0207707_102728562 302
261 3300025919 Ga0207657_10116936 Ga0207657_101169362 302
262 3300025919 Ga0207657_10275495 Ga0207657_102754952 302
263 3300025921 Ga0207652_10143727 Ga0207652_101437272 302
264 3300025923 Ga0207681_10009896 Ga0207681_100098965 302
265 3300025926 Ga0207659_10073427 Ga0207659_100734272 302
266 3300025927 Ga0207687_10119967 Ga0207687_101199673 302
267 3300025932 Ga0207690_10005896 Ga0207690_100058965 302
268 3300025933 Ga0207706_10008424 Ga0207706_100084246 302
269 3300025938 Ga0207704_10228788 Ga0207704_102287882 302
270 3300025940 Ga0207691_10016270 Ga0207691_100162704 302
271 3300025941 Ga0207711_10022995 Ga0207711_100229954 302
272 3300025942 Ga0207689_10000550 Ga0207689_1000055030 302
273 3300025945 Ga0207679_10146798 Ga0207679_101467982 302
274 3300025949 Ga0207667_10027709 Ga0207667_100277094 302
275 3300025981 Ga0207640_10019823 Ga0207640_100198233 302
276 3300025986 Ga0207658_10263242 Ga0207658_102632422 302
277 3300026023 Ga0207677_10057159 Ga0207677_100571593 302
278 3300026035 Ga0207703_10012355 Ga0207703_100123552 302
279 3300026035 Ga0207703_10028691 Ga0207703_100286915 302
280 3300026041 Ga0207639_10007798 Ga0207639_100077985 302
281 3300026041 Ga0207639_10159520 Ga0207639_101595203 302
282 3300026067 Ga0207678_10014287 Ga0207678_100142875 302
283 3300026088 Ga0207641_10408165 Ga0207641_104081652 302
284 3300026095 Ga0207676_10007048 Ga0207676_100070484 302
285 3300026116 Ga0207674_10121300 Ga0207674_101213002 302
286 3300026118 Ga0207675_100000576 Ga0207675_10000057630 302
287 3300026142 Ga0207698_10007391 Ga0207698_100073913 302
288 3300028381 Ga0268264_10005650 Ga0268264_100056506 302
289 3300031711 Ga0265314_10003924 Ga0265314_100039245 302
290 3300031712 Ga0265342_10082926 Ga0265342_100829262 302
291 3300033180 Ga0307510_10030567 Ga0307510_100305673 302
292 3300035085 Ga0373929_0005882 Ga0373929_0005882_818_1741 302
293 3300038443 Ga0395901_0438997 Ga0395901_0438997_300_1247 302
294 3300044656 Ga0466969_0012132 Ga0466969_0012132_626_1576 302
295 3300044684 Ga0466966_0011924 Ga0466966_0011924_2773_3723 302
296 3300044693 Ga0466961_0016813 Ga0466961_0016813_2195_3145 302
297 3300046515 Ga0495620_0031131 Ga0495620_0031131_434_1372 302
298 3300046519 Ga0495632_0031298 Ga0495632_0031298_56_994 302
299 3300048904 Ga0496101_0106940 Ga0496101_0106940_984_1907 302
300 3300048905 Ga0496102_0000771 Ga0496102_0000771_30209_31147 302
301 3300053088 Ga0500644_0002584 Ga0500644_0002584_1807_2745 302
302 3300053093 Ga0500651_0043827 Ga0500651_0043827_870_1808 302
303 3300053136 Ga0500559_0000022 Ga0500559_0000022_23117_24055 302
304 3300053156 Ga0500622_0000498 Ga0500622_0000498_18806_19744 302
305 3300005327 Ga0070658_10053813 Ga0070658_100538132 303
306 3300005328 Ga0070676_10010250 Ga0070676_100102502 303
307 3300005331 Ga0070670_100025318 Ga0070670_1000253183 303
308 3300005331 Ga0070670_100072838 Ga0070670_1000728382 303
309 3300005333 Ga0070677_10025038 Ga0070677_100250382 303
310 3300005335 Ga0070666_10003932 Ga0070666_100039323 303
311 3300005338 Ga0068868_100006084 Ga0068868_1000060842 303
312 3300005340 Ga0070689_100164536 Ga0070689_1001645362 303
313 3300005344 Ga0070661_100118925 Ga0070661_1001189251 303
314 3300005344 Ga0070661_100330002 Ga0070661_1003300021 303
315 3300005347 Ga0070668_100268022 Ga0070668_1002680222 303
316 3300005353 Ga0070669_100049060 Ga0070669_1000490604 303
317 3300005354 Ga0070675_100008064 Ga0070675_1000080643 303
318 3300005354 Ga0070675_100080988 Ga0070675_1000809882 303
319 3300005364 Ga0070673_100006380 Ga0070673_1000063806 303
320 3300005364 Ga0070673_100037703 Ga0070673_1000377033 303
321 3300005367 Ga0070667_100001966 Ga0070667_1000019668 303
322 3300005456 Ga0070678_100004960 Ga0070678_1000049605 303
323 3300005456 Ga0070678_100114580 Ga0070678_1001145801 303
324 3300005457 Ga0070662_100120507 Ga0070662_1001205072 303
325 3300005459 Ga0068867_100179216 Ga0068867_1001792162 303
326 3300005543 Ga0070672_100173134 Ga0070672_1001731342 303
327 3300005617 Ga0068859_100056963 Ga0068859_1000569632 303
328 3300005618 Ga0068864_100000817 Ga0068864_1000008178 303
329 3300005841 Ga0068863_100012732 Ga0068863_1000127327 303
330 3300005842 Ga0068858_100004529 Ga0068858_1000045298 303
331 3300005844 Ga0068862_100015060 Ga0068862_1000150605 303
332 3300006042 Ga0075368_10007521 Ga0075368_100075212 303
333 3300006237 Ga0097621_100004884 Ga0097621_1000048847 303
334 3300006353 Ga0075370_10100444 Ga0075370_101004442 303
335 3300006881 Ga0068865_100008939 Ga0068865_1000089395 303
336 3300006931 Ga0097620_100056960 Ga0097620_1000569602 303
337 3300009174 Ga0105241_10213294 Ga0105241_102132942 303
338 3300009177 Ga0105248_10010604 Ga0105248_100106047 303
339 3300009177 Ga0105248_10012543 Ga0105248_100125436 303
340 3300010375 Ga0105239_10186196 Ga0105239_101861963 303
341 3300013296 Ga0157374_10007118 Ga0157374_100071185 303
342 3300013306 Ga0163162_10049801 Ga0163162_100498014 303
343 3300013306 Ga0163162_10187432 Ga0163162_101874322 303
344 3300013307 Ga0157372_10006557 Ga0157372_100065575 303
345 3300014325 Ga0163163_10002325 Ga0163163_100023258 303
346 3300014745 Ga0157377_10004115 Ga0157377_100041154 303
347 3300014968 Ga0157379_10025641 Ga0157379_100256414 303
348 3300014969 Ga0157376_10005186 Ga0157376_100051865 303
349 3300025893 Ga0207682_10005419 Ga0207682_100054193 303
350 3300025903 Ga0207680_10014250 Ga0207680_100142505 303
351 3300025907 Ga0207645_10007675 Ga0207645_100076753 303
352 3300025923 Ga0207681_10114828 Ga0207681_101148283 303
353 3300025925 Ga0207650_10017541 Ga0207650_100175415 303
354 3300025926 Ga0207659_10002984 Ga0207659_100029842 303
355 3300025926 Ga0207659_10088037 Ga0207659_100880373 303
356 3300025931 Ga0207644_10027083 Ga0207644_100270834 303
357 3300025933 Ga0207706_10070319 Ga0207706_100703192 303
358 3300025933 Ga0207706_10368879 Ga0207706_103688792 303
359 3300025936 Ga0207670_10244256 Ga0207670_102442562 303
360 3300025940 Ga0207691_10023935 Ga0207691_100239353 303
361 3300025940 Ga0207691_10053680 Ga0207691_100536804 303
362 3300025941 Ga0207711_10198895 Ga0207711_101988952 303
363 3300025960 Ga0207651_10000508 Ga0207651_100005087 303
364 3300025960 Ga0207651_10069417 Ga0207651_100694172 303
365 3300025960 Ga0207651_10174245 Ga0207651_101742452 303
366 3300025981 Ga0207640_10061126 Ga0207640_100611262 303
367 3300025986 Ga0207658_10174616 Ga0207658_101746162 303
368 3300026023 Ga0207677_10000871 Ga0207677_1000087110 303
369 3300026035 Ga0207703_10000277 Ga0207703_1000027748 303
370 3300026075 Ga0207708_10107991 Ga0207708_101079912 303
371 3300026088 Ga0207641_10058278 Ga0207641_100582781 303
372 3300026089 Ga0207648_10009743 Ga0207648_100097432 303
373 3300026095 Ga0207676_10018564 Ga0207676_100185645 303
374 3300026118 Ga0207675_100055728 Ga0207675_1000557282 303
375 3300026121 Ga0207683_10008937 Ga0207683_100089374 303
376 3300026121 Ga0207683_10022185 Ga0207683_100221854 303
377 3300027866 Ga0209813_10004728 Ga0209813_100047283 303
378 3300028380 Ga0268265_10041588 Ga0268265_100415884 303
379 3300031731 Ga0307405_10037698 Ga0307405_100376984 303
380 3300031824 Ga0307413_10006366 Ga0307413_100063662 303
381 3300031901 Ga0307406_10006978 Ga0307406_100069784 303
382 3300031901 Ga0307406_10012222 Ga0307406_100122225 303
383 3300031911 Ga0307412_10011706 Ga0307412_100117063 303
384 3300031911 Ga0307412_10029800 Ga0307412_100298004 303
385 3300031995 Ga0307409_100000680 Ga0307409_1000006803 303
386 3300031995 Ga0307409_100206627 Ga0307409_1002066272 303
387 3300032002 Ga0307416_100001182 Ga0307416_1000011821 303
388 3300032002 Ga0307416_100034721 Ga0307416_1000347216 303
389 3300032005 Ga0307411_10007142 Ga0307411_100071422 303
390 3300032126 Ga0307415_100015183 Ga0307415_1000151834 303
391 3300035691 Ga0373931_0009502 Ga0373931_0009502_3064_4056 303
392 3300037471 Ga0395905_0000025 Ga0395905_0000025_220017_220979 303
393 3300044735 Ga0466968_0131538 Ga0466968_0131538_180_1127 303
394 3300048903 Ga0496100_0036990 Ga0496100_0036990_1301_2293 303
395 3300048907 Ga0496104_0289733 Ga0496104_0289733_263_1195 303
396 3300048909 Ga0496106_0011948 Ga0496106_0011948_3049_4041 303
397 3300048910 Ga0496107_0009894 Ga0496107_0009894_1464_2456 303
398 3300048911 Ga0496108_0029383 Ga0496108_0029383_1010_2002 303
399 3300048911 Ga0496108_0063493 Ga0496108_0063493_2162_3094 303
400 3300048912 Ga0496109_0064653 Ga0496109_0064653_895_1887 303
401 3300048912 Ga0496109_0171419 Ga0496109_0171419_750_1682 303
402 3300048913 Ga0496110_0002997 Ga0496110_0002997_9266_10258 303
403 3300048918 Ga0496115_0024126 Ga0496115_0024126_1346_2338 303
404 3300050490 nmdc:mga03n38_125556_c1 nmdc:mga03n38_125556_c1_182_1108 303
405 3300050494 nmdc:mga06z11_2269_c1 nmdc:mga06z11_2269_c1_4612_5538 303
406 3300050495 nmdc:mga04h51_4290_c1 nmdc:mga04h51_4290_c1_972_1898 303
407 3300050496 nmdc:mga07m45_43454_c1 nmdc:mga07m45_43454_c1_120_1046 303
408 3300050512 nmdc:mga0n895_295943_c1 nmdc:mga0n895_295943_c1_189_1181 303
409 iso_pu_bacteria 2818991449 2819615166 303
410 iso_pu_bacteria 2904439833 2904441560 303
411 iso_pu_bacteria 2904530477 2904531511 303
412 iso_pu_bacteria 2904584206 2904586852 303
413 iso_pu_bacteria 2904589729 2904593115 303
414 iso_pu_bacteria 2904601388 2904603039 303
415 iso_pu_bacteria 2919046199 2919050864 303
416 iso_pu_bacteria 2919079590 2919083940 303
417 3300005356 Ga0070674_100004419 Ga0070674_1000044198 304
418 3300026089 Ga0207648_10073125 Ga0207648_100731251 304
419 3300048917 Ga0496114_0141127 Ga0496114_0141127_529_1488 304
420 iso_pu_bacteria 2990710928 2990713838 304
421 3300003751 Ga0055538_1000155 Ga0055538_100015511 305
422 3300003752 Ga0055539_1000205 Ga0055539_100020511 305
423 3300003756 Ga0055533_1000207 Ga0055533_100020711 305
424 3300003759 Ga0055525_1000284 Ga0055525_100028411 305
425 3300003841 Ga0055541_1000133 Ga0055541_100013338 305
426 3300005327 Ga0070658_10198594 Ga0070658_101985942 305
427 3300005331 Ga0070670_100092373 Ga0070670_1000923732 305
428 3300005333 Ga0070677_10007604 Ga0070677_100076043 305
429 3300005338 Ga0068868_100012140 Ga0068868_1000121404 305
430 3300005347 Ga0070668_100074824 Ga0070668_1000748243 305
431 3300005353 Ga0070669_100015849 Ga0070669_1000158493 305
432 3300005354 Ga0070675_100005905 Ga0070675_1000059055 305
433 3300005355 Ga0070671_100034873 Ga0070671_1000348732 305
434 3300005356 Ga0070674_100009593 Ga0070674_1000095933 305
435 3300005364 Ga0070673_100014753 Ga0070673_1000147532 305
436 3300005456 Ga0070678_100000623 Ga0070678_10000062316 305
437 3300005459 Ga0068867_100001767 Ga0068867_10000176713 305
438 3300005543 Ga0070672_100009849 Ga0070672_1000098493 305
439 3300005615 Ga0070702_100366960 Ga0070702_1003669601 305
440 3300005618 Ga0068864_100066794 Ga0068864_1000667943 305
441 3300005840 Ga0068870_10055376 Ga0068870_100553763 305
442 3300005981 Ga0081538_10049508 Ga0081538_100495083 305
443 3300006038 Ga0075365_10003405 Ga0075365_100034056 305
444 3300006051 Ga0075364_10009796 Ga0075364_100097965 305
445 3300006358 Ga0068871_100001394 Ga0068871_1000013949 305
446 3300006881 Ga0068865_100027541 Ga0068865_1000275413 305
447 3300013306 Ga0163162_10199922 Ga0163162_101999223 305
448 3300013308 Ga0157375_10034836 Ga0157375_100348362 305
449 3300014326 Ga0157380_10180794 Ga0157380_101807942 305
450 3300014969 Ga0157376_10022375 Ga0157376_100223752 305
451 3300017792 Ga0163161_10011133 Ga0163161_100111332 305
452 3300025224 Ga0209784_100002 Ga0209784_1000021191 305
453 3300025225 Ga0209566_100003 Ga0209566_1000031191 305
454 3300025226 Ga0209674_100004 Ga0209674_1000041191 305
455 3300025230 Ga0209563_100006 Ga0209563_1000061191 305
456 3300025253 Ga0209677_100003 Ga0209677_1000031191 305
457 3300025893 Ga0207682_10000414 Ga0207682_100004143 305
458 3300025923 Ga0207681_10021375 Ga0207681_100213753 305
459 3300025925 Ga0207650_10005579 Ga0207650_100055793 305
460 3300025926 Ga0207659_10016084 Ga0207659_100160845 305
461 3300025931 Ga0207644_10011603 Ga0207644_100116033 305
462 3300025937 Ga0207669_10007170 Ga0207669_100071703 305
463 3300025937 Ga0207669_10154472 Ga0207669_101544722 305
464 3300025940 Ga0207691_10000186 Ga0207691_1000018655 305
465 3300025960 Ga0207651_10011223 Ga0207651_100112232 305
466 3300025960 Ga0207651_10206411 Ga0207651_102064112 305
467 3300025972 Ga0207668_10122803 Ga0207668_101228033 305
468 3300025986 Ga0207658_10062250 Ga0207658_100622503 305
469 3300026067 Ga0207678_10109904 Ga0207678_101099043 305
470 3300026089 Ga0207648_10002813 Ga0207648_1000281316 305
471 3300026095 Ga0207676_10084138 Ga0207676_100841383 305
472 3300026121 Ga0207683_10002558 Ga0207683_100025589 305
473 3300048911 Ga0496108_0154217 Ga0496108_0154217_451_1407 305
474 3300048913 Ga0496110_0469358 Ga0496110_0469358_147_1112 305
475 3300050491 nmdc:mga00v17_8336_c1 nmdc:mga00v17_8336_c1_673_1614 305
476 iso_pu_bacteria 2856287931 2856293607 305
477 3300049591 Ga0501075_0145256 Ga0501075_0145256_129_1124 306
478 3300049592 Ga0501076_0076070 Ga0501076_0076070_1273_2268 306
479 3300049824 Ga0501045_0051844 Ga0501045_0051844_1395_2390 306
480 iso_pu_bacteria 2923510766 2923510904 306
481 3300005338 Ga0068868_100139213 Ga0068868_1001392132 307
482 3300005563 Ga0068855_100094018 Ga0068855_1000940182 307
483 3300005578 Ga0068854_100010945 Ga0068854_1000109455 307
484 3300009093 Ga0105240_10652711 Ga0105240_106527111 307
485 3300009545 Ga0105237_10035832 Ga0105237_100358323 307
486 3300009545 Ga0105237_10329799 Ga0105237_103297992 307
487 3300009551 Ga0105238_10001273 Ga0105238_100012739 307
488 3300010375 Ga0105239_10131252 Ga0105239_101312523 307
489 3300015261 Ga0182006_1001264 Ga0182006_10012649 307
490 3300025913 Ga0207695_10002435 Ga0207695_1000243517 307
491 3300025914 Ga0207671_10008088 Ga0207671_100080886 307
492 3300025924 Ga0207694_10001091 Ga0207694_1000109117 307
493 3300025949 Ga0207667_10071265 Ga0207667_100712652 307
494 3300025981 Ga0207640_10051698 Ga0207640_100516982 307
495 3300031824 Ga0307413_10146509 Ga0307413_101465091 307
496 3300025949 Ga0207667_10000438 Ga0207667_1000043813 308
497 3300003322 rootL2_10010606 rootL2_100106061 311
498 3300003771 Ga0055526_1019969 Ga0055526_10199692 311
499 3300003775 Ga0055524_1007305 Ga0055524_10073052 311
500 3300025291 Ga0209675_1002614 Ga0209675_10026148 311
501 3300025294 Ga0209025_1004773 Ga0209025_10047732 311
502 3300025299 Ga0209256_1004400 Ga0209256_10044006 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

29

322

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v78-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase 0.9334 3 304
2dcn-assembly1.cif.gz_D crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form) 0.9323 4 304
4du5-assembly2.cif.gz_C crystal structure of pfkb protein from polaromonas sp. js666 0.9268 3 301
4du5-assembly1.cif.gz_A crystal structure of pfkb protein from polaromonas sp. js666 0.9249 3 301
3lki-assembly2.cif.gz_B crystal structure of fructokinase with bound atp from xylella fastidiosa 0.924 1 307
ID Description Score Start End Superfamily
af_C6TGN8_61_381_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.947 5 303 3.40.1190.20
af_Q2FWM2_2_319_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9346 4 301 3.40.1190.20
2varB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9315 3 304 3.40.1190.20
3pl2D01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.927 4 301 3.40.1190.20
4du5C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9211 3 301 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7H4PXP7-F1-model_v4 Sugar kinase 0.9904 3 304 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A108GDH4-F1-model_v4 2-dehydro-3-deoxygluconokinase 0.99 3 304 GO:0016301
AF-A0A7Z9TS47-F1-model_v4 Sugar kinase 0.9815 1 304 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A4Q3XVL1-F1-model_v4 deleted 0.9765 208 298
AF-A0A7Z9TS47-F1-model_v4 Sugar kinase 0.9721 1 304 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840

Feature Viewer

pLDDT pTM Quality
93.86 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map