F455484

General Info

Members Datasets Scaffolds Average Seq Length
500 240 1000 247

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10085255|Ga0070691_100852552
Length 269
Sequence LHRMPGHGQNGNRLHRMSFDVSAAAYAAFMGRWSQPLAVGFADLAGVHGGQRALDVGCGPGMLTEELVARLGEVAVTAIDPSPSFVAATRERFPEADVRSGAAEQLPFADDAFDVALAQLVVHFMAEPVAGLREMGRVTRPGGMVAACVWDHAGGRGPLSAFWRAVRELDPGADDESNLAGVREGHLAELLAQAGLGVAEVTTLTVQARQDGFESWWETFTLGVGPAGAYLTSLPADRQDELHERCRRQLPEGPFEVSATAWAAMARPV

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
110 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 13
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10085255 3300005341 Bacteria 1552
2 JGI25404J52841_10004884 3300003659 Bacteria 2750
3 Ga0070676_10069465 3300005328 Bacteria 2111
4 Ga0070683_100009003 3300005329 Bacteria 8514
5 Ga0070683_100673162 3300005329 Bacteria 991
6 Ga0070690_100250898 3300005330 Bacteria 1251
7 Ga0070666_10096592 3300005335 Bacteria 2034
8 Ga0070682_100012874 3300005337 Bacteria 4801
9 Ga0070682_100071053 3300005337 Bacteria 2227
10 Ga0070682_100127032 3300005337 Bacteria 1720
11 Ga0070660_100162430 3300005339 Bacteria 1801
12 Ga0070692_10007947 3300005345 Bacteria 4704
13 Ga0070692_10041646 3300005345 Bacteria 2354
14 Ga0070669_100590932 3300005353 Bacteria 929
15 Ga0070674_100322523 3300005356 Bacteria 1239
16 Ga0070673_100839014 3300005364 Bacteria 850
17 Ga0070659_100283069 3300005366 Bacteria 1379
18 Ga0070667_100057295 3300005367 Bacteria 3293
19 Ga0070709_10029955 3300005434 Bacteria 3261
20 Ga0070709_10045059 3300005434 Bacteria 2735
21 Ga0070709_10070698 3300005434 Bacteria 2250
22 Ga0070709_10179323 3300005434 Bacteria 1486
23 Ga0070714_100091111 3300005435 Bacteria 2671
24 Ga0070714_100248899 3300005435 Bacteria 1642
25 Ga0070714_100391852 3300005435 Bacteria 1311
26 Ga0070714_100945701 3300005435 Bacteria 837
27 Ga0070713_100038529 3300005436 Bacteria 3874
28 Ga0070713_100405137 3300005436 Bacteria 1274
29 Ga0070713_100520085 3300005436 Bacteria 1124
30 Ga0070713_100533121 3300005436 Bacteria 1110
31 Ga0070710_10009332 3300005437 Bacteria 4798
32 Ga0070710_10024444 3300005437 Bacteria 3187
33 Ga0070710_10033041 3300005437 Bacteria 2807
34 Ga0070710_10066871 3300005437 Bacteria 2061
35 Ga0070710_10125940 3300005437 Bacteria 1556
36 Ga0070710_10249933 3300005437 Bacteria 1139
37 Ga0070711_100255914 3300005439 Bacteria 1375
38 Ga0070711_100305470 3300005439 Bacteria 1266
39 Ga0070708_100484082 3300005445 Bacteria 1167
40 Ga0070663_100008080 3300005455 Bacteria 6452
41 Ga0070685_10071074 3300005466 Bacteria 2062
42 Ga0070706_100453993 3300005467 Bacteria 1192
43 Ga0070707_100010788 3300005468 Bacteria 8509
44 Ga0070707_100054664 3300005468 Bacteria 3828
45 Ga0070698_100000231 3300005471 Bacteria 55183
46 Ga0070698_100000814 3300005471 Bacteria 34041
47 Ga0070699_100000682 3300005518 Bacteria 31654
48 Ga0070699_100095866 3300005518 Bacteria 2598
49 Ga0070697_100041651 3300005536 Bacteria 3718
50 Ga0068853_100123990 3300005539 Bacteria 2307
51 Ga0070686_100326994 3300005544 Bacteria 1145
52 Ga0070693_100200579 3300005547 Bacteria 1296
53 Ga0070665_100001244 3300005548 Bacteria 30828
54 Ga0068857_100013965 3300005577 Bacteria 6987
55 Ga0068857_100111471 3300005577 Bacteria 2459
56 Ga0068854_100624141 3300005578 Bacteria 923
57 Ga0068856_100033023 3300005614 Bacteria 5068
58 Ga0068856_100064942 3300005614 Bacteria 3606
59 Ga0068856_100133748 3300005614 Bacteria 2485
60 Ga0068856_100156936 3300005614 Bacteria 2286
61 Ga0068856_100313344 3300005614 Bacteria 1587
62 Ga0068856_100427605 3300005614 Bacteria 1344
63 Ga0070702_100182429 3300005615 Bacteria 1374
64 Ga0068852_100810506 3300005616 Bacteria 951
65 Ga0068864_100559816 3300005618 Bacteria 1106
66 Ga0068861_100090839 3300005719 Bacteria 2410
67 Ga0081540_1002707 3300005983 Bacteria 14415
68 Ga0070717_10025194 3300006028 Bacteria 4727
69 Ga0070717_10235052 3300006028 Bacteria 1614
70 Ga0070717_10318919 3300006028 Bacteria 1384
71 Ga0070717_10371974 3300006028 Bacteria 1280
72 Ga0070717_10628425 3300006028 Bacteria 974
73 Ga0075365_10020096 3300006038 Bacteria 4134
74 Ga0070715_10000922 3300006163 Bacteria 8177
75 Ga0070715_10060266 3300006163 Bacteria 1663
76 Ga0070716_100005212 3300006173 Bacteria 6281
77 Ga0070716_100007263 3300006173 Bacteria 5447
78 Ga0070716_100258852 3300006173 Bacteria 1189
79 Ga0070716_100268785 3300006173 Bacteria 1170
80 Ga0070712_100019907 3300006175 Bacteria 4387
81 Ga0070712_100094137 3300006175 Bacteria 2201
82 Ga0070712_100176124 3300006175 Unclassified 1663
83 Ga0070712_100359606 3300006175 Bacteria 1193
84 Ga0070712_100391877 3300006175 Bacteria 1145
85 Ga0070712_100634476 3300006175 Bacteria 907
86 Ga0075370_10043904 3300006353 Bacteria 2527
87 Ga0068871_100396405 3300006358 Bacteria 1228
88 Ga0075433_10445129 3300006852 Bacteria 1142
89 Ga0075434_100157433 3300006871 Bacteria 2291
90 Ga0068865_100386378 3300006881 Bacteria 1143
91 Ga0075435_100023615 3300007076 Bacteria 4759
92 Ga0075435_100277106 3300007076 Bacteria 1431
93 Ga0075435_100603794 3300007076 Bacteria 952
94 Ga0105245_10000470 3300009098 Bacteria 36900
95 Ga0105245_10047989 3300009098 Bacteria 3819
96 Ga0105245_10213478 3300009098 Bacteria 1859
97 Ga0114129_10060867 3300009147 Bacteria 5278
98 Ga0105243_10217998 3300009148 Bacteria 1685
99 Ga0105242_10267100 3300009176 Bacteria 1548
100 Ga0105238_10227535 3300009551 Bacteria 1842
101 Ga0105249_10200665 3300009553 Bacteria 1952
102 Ga0105246_10073238 3300011119 Bacteria 2418
103 Ga0157370_10270333 3300013104 Bacteria 1570
104 Ga0157374_10322629 3300013296 Bacteria 1531
105 Ga0157378_10038619 3300013297 Bacteria 4232
106 Ga0163162_10217657 3300013306 Bacteria 2040
107 Ga0157372_10244898 3300013307 Bacteria 2080
108 Ga0157372_10501375 3300013307 Bacteria 1416
109 Ga0157375_10087051 3300013308 Bacteria 3175
110 Ga0157380_10128355 3300014326 Bacteria 2159
111 Ga0157377_10135562 3300014745 Bacteria 1508
112 Ga0157377_10180434 3300014745 Bacteria 1327
113 Ga0157379_10490705 3300014968 Bacteria 1137
114 Ga0157376_10116234 3300014969 Bacteria 2363
115 Ga0157376_10179937 3300014969 Bacteria 1932
116 Ga0207692_10029251 3300025898 Bacteria 2616
117 Ga0207692_10036265 3300025898 Bacteria 2403
118 Ga0207692_10164426 3300025898 Bacteria 1281
119 Ga0207688_10016014 3300025901 Bacteria 4064
120 Ga0207688_10049374 3300025901 Bacteria 2352
121 Ga0207685_10009648 3300025905 Bacteria 2813
122 Ga0207685_10025853 3300025905 Bacteria 2033
123 Ga0207699_10003931 3300025906 Bacteria 7105
124 Ga0207699_10007292 3300025906 Bacteria 5401
125 Ga0207699_10053095 3300025906 Bacteria 2402
126 Ga0207699_10092483 3300025906 Bacteria 1901
127 Ga0207699_10425797 3300025906 Bacteria 949
128 Ga0207645_10036661 3300025907 Bacteria 3149
129 Ga0207705_10454668 3300025909 Bacteria 993
130 Ga0207684_10020450 3300025910 Bacteria 5656
131 Ga0207684_10174050 3300025910 Bacteria 1855
132 Ga0207654_10103701 3300025911 Bacteria 1757
133 Ga0207707_10504046 3300025912 Bacteria 1032
134 Ga0207671_10160816 3300025914 Bacteria 1739
135 Ga0207693_10015536 3300025915 Bacteria 6107
136 Ga0207693_10017453 3300025915 Bacteria 5725
137 Ga0207693_10110790 3300025915 Bacteria 2152
138 Ga0207693_10258361 3300025915 Bacteria 1366
139 Ga0207693_10315159 3300025915 Bacteria 1224
140 Ga0207663_10010735 3300025916 Bacteria 4890
141 Ga0207657_10022832 3300025919 Bacteria 5840
142 Ga0207649_10136184 3300025920 Bacteria 1675
143 Ga0207646_10047732 3300025922 Bacteria 3840
144 Ga0207646_10066729 3300025922 Bacteria 3213
145 Ga0207646_10420395 3300025922 Unclassified 1207
146 Ga0207694_10207738 3300025924 Bacteria 1594
147 Ga0207687_10395300 3300025927 Bacteria 1136
148 Ga0207687_10650491 3300025927 Bacteria 892
149 Ga0207700_10000890 3300025928 Bacteria 17201
150 Ga0207700_10015559 3300025928 Bacteria 5022
151 Ga0207700_10017958 3300025928 Bacteria 4737
152 Ga0207700_10151935 3300025928 Bacteria 1914
153 Ga0207700_10261448 3300025928 Unclassified 1482
154 Ga0207700_10353142 3300025928 Bacteria 1281
155 Ga0207700_10854341 3300025928 Bacteria 814
156 Ga0207664_10050597 3300025929 Bacteria 3277
157 Ga0207664_10054708 3300025929 Bacteria 3163
158 Ga0207664_10093857 3300025929 Bacteria 2465
159 Ga0207664_10153131 3300025929 Bacteria 1960
160 Ga0207664_10180052 3300025929 Bacteria 1814
161 Ga0207664_10292203 3300025929 Bacteria 1432
162 Ga0207664_10378521 3300025929 Bacteria 1256
163 Ga0207664_10569494 3300025929 Unclassified 1017
164 Ga0207644_10399856 3300025931 Bacteria 1123
165 Ga0207690_10040218 3300025932 Bacteria 3055
166 Ga0207690_10182701 3300025932 Bacteria 1580
167 Ga0207709_10136896 3300025935 Bacteria 1678
168 Ga0207665_10001271 3300025939 Bacteria 17025
169 Ga0207665_10008206 3300025939 Bacteria 6896
170 Ga0207665_10174420 3300025939 Bacteria 1554
171 Ga0207665_10288188 3300025939 Bacteria 1224
172 Ga0207689_10015356 3300025942 Bacteria 6483
173 Ga0207679_10330097 3300025945 Bacteria 1323
174 Ga0207668_10141206 3300025972 Bacteria 1853
175 Ga0207668_10321859 3300025972 Bacteria 1283
176 Ga0207668_10613617 3300025972 Bacteria 949
177 Ga0207640_10088372 3300025981 Bacteria 2139
178 Ga0207658_10129912 3300025986 Bacteria 2022
179 Ga0207639_10129205 3300026041 Bacteria 2089
180 Ga0207678_10161567 3300026067 Bacteria 1913
181 Ga0207708_10124271 3300026075 Bacteria 2013
182 Ga0207702_10080584 3300026078 Bacteria 2825
183 Ga0207702_10117969 3300026078 Bacteria 2370
184 Ga0207702_10189902 3300026078 Bacteria 1897
185 Ga0207702_10596676 3300026078 Bacteria 1083
186 Ga0207641_10001869 3300026088 Bacteria 20215
187 Ga0207674_10011248 3300026116 Bacteria 10059
188 Ga0207675_100495787 3300026118 Bacteria 1215
189 Ga0207683_10539076 3300026121 Bacteria 1079
190 Ga0268266_10002483 3300028379 Bacteria 19700
191 Ga0265337_1001224 3300028556 Bacteria 13016
192 Ga0265319_1003473 3300028563 Bacteria 8201
193 Ga0265334_10001788 3300028573 Bacteria 10264
194 Ga0265318_10018393 3300028577 Bacteria 2852
195 Ga0265323_10008214 3300028653 Bacteria 4316
196 Ga0265322_10002171 3300028654 Bacteria 6092
197 Ga0265336_10008067 3300028666 Bacteria 3710
198 Ga0265338_10000837 3300028800 Bacteria 51772
199 Ga0265324_10033449 3300029957 Bacteria 1793
200 Ga0265332_10002621 3300031238 Bacteria 9073
201 Ga0265320_10015847 3300031240 Bacteria 4245
202 Ga0265316_10012898 3300031344 Bacteria 7458
203 Ga0265313_10005606 3300031595 Bacteria 9185
204 Ga0265314_10020287 3300031711 Bacteria 5132
205 Ga0265342_10021635 3300031712 Bacteria 4102
206 Ga0307516_10095388 3300031730 Bacteria 2797
207 Ga0307409_100177693 3300031995 Bacteria 1881
208 Ga0307411_10204656 3300032005 Bacteria 1519
209 Ga0307415_100107851 3300032126 Bacteria 2059
210 Ga0373926_0000142 3300035083 Bacteria 15330
211 Ga0373929_0004758 3300035085 Bacteria 2433
212 Ga0373934_0005067 3300035086 Bacteria 4881
213 Ga0373934_0024120 3300035086 Bacteria 2352
214 Ga0373944_0000422 3300035089 Bacteria 9689
215 Ga0373951_0007197 3300035091 Bacteria 2532
216 Ga0373923_0000058 3300035111 Bacteria 17423
217 Ga0373923_0073699 3300035111 Bacteria 1470
218 Ga0373932_0075843 3300035112 Bacteria 1052
219 Ga0373936_0000065 3300035113 Bacteria 50174
220 Ga0373945_0000072 3300035116 Bacteria 23111
221 Ga0373945_0062014 3300035116 Bacteria 1397
222 Ga0373953_0006173 3300035117 Bacteria 3936
223 Ga0373953_0011866 3300035117 Bacteria 3070
224 Ga0373953_0099925 3300035117 Bacteria 1220
225 Ga0373954_0020976 3300035118 Bacteria 2957
226 Ga0373954_0022568 3300035118 Bacteria 2856
227 Ga0373956_0012235 3300035119 Bacteria 3552
228 Ga0373956_0025340 3300035119 Bacteria 2562
229 Ga0373957_0000253 3300035120 Bacteria 13425
230 Ga0373957_0008159 3300035120 Bacteria 3381
231 Ga0373957_0010621 3300035120 Bacteria 3050
232 Ga0373943_0001815 3300035170 Bacteria 9656
233 Ga0373943_0038653 3300035170 Bacteria 2295
234 Ga0373943_0046538 3300035170 Bacteria 2117
235 Ga0373946_0034858 3300035171 Bacteria 2034
236 Ga0373955_0005111 3300035172 Bacteria 5863
237 Ga0373955_0188525 3300035172 Bacteria 1225
238 Ga0373961_0010645 3300035241 Bacteria 2269
239 Ga0373924_0009922 3300035410 Bacteria 3503
240 Ga0373931_0026440 3300035691 Bacteria 2953
241 Ga0373935_0038714 3300035692 Bacteria 2987
242 Ga0373927_0001277 3300035695 Bacteria 19075
243 Ga0373927_0153951 3300035695 Bacteria 1505
244 Ga0373933_0000887 3300035724 Bacteria 18307
245 Ga0373933_0003998 3300035724 Bacteria 8124
246 Ga0373933_0082641 3300035724 Bacteria 1971
247 Ga0373947_0242271 3300035725 Bacteria 1190
248 Ga0373937_0000610 3300036401 Bacteria 31566
249 Ga0373937_0009888 3300036401 Bacteria 8315
250 Ga0373937_0076952 3300036401 Bacteria 3082
251 Ga0373937_0389944 3300036401 Bacteria 1321
252 Ga0373925_0001542 3300037068 Bacteria 19627
253 Ga0373925_0003628 3300037068 Bacteria 11891
254 Ga0373925_0047957 3300037068 Bacteria 3181
255 Ga0373925_0225971 3300037068 Bacteria 1495
256 Ga0436365_0562354 3300039437 Bacteria 3538
257 Ga0451843_0768469 3300041509 Bacteria 1937
258 Ga0451576_0790915 3300045051 Bacteria 996
259 Ga0466967_0072047 3300045976 Bacteria 3095
260 Ga0466967_0446851 3300045976 Bacteria 1263
261 Ga0495592_0001188 3300046454 Bacteria 18073
262 Ga0495592_0028115 3300046454 Bacteria 4260
263 Ga0495592_0036135 3300046454 Bacteria 3721
264 Ga0495592_0195259 3300046454 Bacteria 1369
265 Ga0495592_0199143 3300046454 Bacteria 1353
266 Ga0495603_0001440 3300046455 Bacteria 13836
267 Ga0495629_0000641 3300046459 Bacteria 28297
268 Ga0495629_0001715 3300046459 Bacteria 17217
269 Ga0495629_0018309 3300046459 Bacteria 5014
270 Ga0495641_0000184 3300046461 Bacteria 48241
271 Ga0495641_0002868 3300046461 Bacteria 13335
272 Ga0495651_0000215 3300046462 Bacteria 44284
273 Ga0495651_0015734 3300046462 Bacteria 5857
274 Ga0495651_0039237 3300046462 Bacteria 3687
275 Ga0495651_0288909 3300046462 Bacteria 1104
276 Ga0495653_0025022 3300046463 Bacteria 4802
277 Ga0495653_0028567 3300046463 Bacteria 4460
278 Ga0495653_0049554 3300046463 Bacteria 3234
279 Ga0495653_0079218 3300046463 Bacteria 2433
280 Ga0495582_0000343 3300046473 Bacteria 25586
281 Ga0495639_0025936 3300046475 Bacteria 2587
282 Ga0495639_0038846 3300046475 Bacteria 2138
283 Ga0495639_0049559 3300046475 Bacteria 1906
284 Ga0495662_0000054 3300046476 Bacteria 39454
285 Ga0495662_0046670 3300046476 Bacteria 2091
286 Ga0495662_0050626 3300046476 Bacteria 2005
287 Ga0495662_0113659 3300046476 Bacteria 1327
288 Ga0495664_0000350 3300046477 Bacteria 22437
289 Ga0495664_0006537 3300046477 Bacteria 6441
290 Ga0495664_0104024 3300046477 Bacteria 1711
291 Ga0495664_0147404 3300046477 Bacteria 1427
292 Ga0495664_0181927 3300046477 Bacteria 1274
293 Ga0495594_0002835 3300046499 Bacteria 9011
294 Ga0495596_0084429 3300046500 Bacteria 1233
295 Ga0495608_0000444 3300046511 Bacteria 28907
296 Ga0495608_0018501 3300046511 Bacteria 4804
297 Ga0495608_0021553 3300046511 Bacteria 4422
298 Ga0495608_0028286 3300046511 Bacteria 3810
299 Ga0495618_0000626 3300046514 Bacteria 25051
300 Ga0495618_0033782 3300046514 Bacteria 3207
301 Ga0495618_0061480 3300046514 Bacteria 2382
302 Ga0495628_0037899 3300046516 Bacteria 3862
303 Ga0495628_0041602 3300046516 Bacteria 3669
304 Ga0495628_0043900 3300046516 Bacteria 3558
305 Ga0495628_0083921 3300046516 Bacteria 2472
306 Ga0495630_0000866 3300046517 Bacteria 21319
307 Ga0495630_0055439 3300046517 Bacteria 2970
308 Ga0495630_0126286 3300046517 Bacteria 1941
309 Ga0495666_0005381 3300046526 Bacteria 6445
310 Ga0495652_0004180 3300046529 Bacteria 13902
311 Ga0495652_0056449 3300046529 Bacteria 3334
312 Ga0495652_0152132 3300046529 Bacteria 1806
313 Ga0495652_0157137 3300046529 Bacteria 1769
314 Ga0495652_0415471 3300046529 Bacteria 949
315 Ga0495665_0000427 3300046531 Bacteria 21447
316 Ga0495665_0009678 3300046531 Bacteria 5219
317 Ga0495665_0139524 3300046531 Bacteria 1267
318 Ga0495640_0001976 3300046533 Bacteria 16369
319 Ga0495640_0026154 3300046533 Bacteria 4221
320 Ga0495640_0046480 3300046533 Bacteria 3007
321 Ga0495640_0172529 3300046533 Bacteria 1381
322 Ga0495640_0332103 3300046533 Bacteria 940
323 Ga0495586_0005845 3300046535 Bacteria 6574
324 Ga0495587_0001509 3300046536 Bacteria 15481
325 Ga0495587_0033444 3300046536 Bacteria 3104
326 Ga0495587_0160241 3300046536 Bacteria 1280
327 Ga0495645_0000167 3300046543 Bacteria 45640
328 Ga0495645_0045184 3300046543 Bacteria 3213
329 Ga0495622_0099446 3300046557 Bacteria 1334
330 Ga0495667_0034709 3300046559 Bacteria 3372
331 Ga0495667_0041791 3300046559 Bacteria 3039
332 Ga0495667_0060534 3300046559 Bacteria 2483
333 Ga0495634_0002611 3300046642 Bacteria 14828
334 Ga0495634_0012757 3300046642 Bacteria 6082
335 Ga0495634_0027750 3300046642 Bacteria 3937
336 Ga0495634_0043601 3300046642 Bacteria 3040
337 Ga0495635_0001336 3300046663 Bacteria 16413
338 Ga0495635_0023363 3300046663 Bacteria 4309
339 Ga0495635_0100159 3300046663 Bacteria 1980
340 Ga0495635_0104909 3300046663 Bacteria 1931
341 Ga0495635_0123433 3300046663 Bacteria 1766
342 Ga0495588_0022111 3300046674 Bacteria 3141
343 Ga0495588_0182545 3300046674 Unclassified 1109
344 Ga0495657_0000676 3300046675 Bacteria 30764
345 Ga0495657_0005020 3300046675 Bacteria 10514
346 Ga0495657_0041049 3300046675 Bacteria 3169
347 Ga0495599_0015295 3300046678 Bacteria 4760
348 Ga0495599_0090641 3300046678 Bacteria 1907
349 Ga0495599_0118029 3300046678 Bacteria 1650
350 Ga0495623_0084846 3300046679 Bacteria 1954
351 Ga0495646_0031514 3300046680 Bacteria 3303
352 Ga0495646_0051744 3300046680 Bacteria 2484
353 Ga0495646_0067502 3300046680 Bacteria 2113
354 Ga0495647_0007937 3300046681 Bacteria 3566
355 Ga0495658_0000340 3300046683 Bacteria 26360
356 Ga0495658_0012537 3300046683 Bacteria 4297
357 Ga0495658_0167996 3300046683 Bacteria 1356
358 Ga0495613_0002229 3300046689 Bacteria 14676
359 Ga0495613_0076122 3300046689 Bacteria 2442
360 Ga0495624_0023804 3300046690 Bacteria 4034
361 Ga0495624_0044624 3300046690 Bacteria 2825
362 Ga0495600_0000437 3300046809 Bacteria 21408
363 Ga0495600_0048032 3300046809 Bacteria 2784
364 Ga0495581_0000281 3300047315 Bacteria 24731
365 Ga0495581_0227356 3300047315 Bacteria 1091
366 Ga0495604_0000286 3300047317 Bacteria 45196
367 Ga0495604_0018156 3300047317 Bacteria 5631
368 Ga0495604_0043312 3300047317 Bacteria 3524
369 Ga0495604_0303570 3300047317 Bacteria 1071
370 Ga0495674_0021807 3300047319 Bacteria 5918
371 Ga0495674_0047150 3300047319 Bacteria 3822
372 Ga0495674_0121646 3300047319 Bacteria 2204
373 Ga0495674_0225013 3300047319 Bacteria 1550
374 Ga0495674_0309916 3300047319 Bacteria 1288
375 Ga0495674_0319750 3300047319 Bacteria 1264
376 Ga0495674_0422006 3300047319 Bacteria 1074
377 Ga0495676_0000478 3300047321 Bacteria 32779
378 Ga0495676_0067808 3300047321 Bacteria 2759
379 Ga0495676_0405763 3300047321 Bacteria 904
380 Ga0495680_0002526 3300047322 Bacteria 18710
381 Ga0495680_0007571 3300047322 Bacteria 9929
382 Ga0495680_0021707 3300047322 Bacteria 5369
383 Ga0495680_0036774 3300047322 Bacteria 3927
384 Ga0495680_0082463 3300047322 Bacteria 2426
385 Ga0495680_0086904 3300047322 Bacteria 2352
386 Ga0495680_0106574 3300047322 Bacteria 2083
387 Ga0495675_0000628 3300047444 Bacteria 22465
388 Ga0495675_0049853 3300047444 Bacteria 2660
389 Ga0495675_0131012 3300047444 Bacteria 1559
390 Ga0495675_0215968 3300047444 Bacteria 1162
391 Ga0495684_0014159 3300047471 Bacteria 6136
392 Ga0495684_0014323 3300047471 Bacteria 6103
393 Ga0495684_0020005 3300047471 Bacteria 5156
394 Ga0495684_0111368 3300047471 Bacteria 2065
395 Ga0495684_0172179 3300047471 Bacteria 1609
396 Ga0495593_0001228 3300047673 Bacteria 14990
397 Ga0495602_0017829 3300048088 Bacteria 7108
398 Ga0495602_0029819 3300048088 Bacteria 5186
399 Ga0495614_0007712 3300048089 Bacteria 4782
400 Ga0495614_0027490 3300048089 Bacteria 2452
401 Ga0496100_0033312 3300048903 Bacteria 3223
402 Ga0496100_0067057 3300048903 Bacteria 2382
403 Ga0496100_0196352 3300048903 Bacteria 1468
404 Ga0496101_0024830 3300048904 Bacteria 4154
405 Ga0496101_0094555 3300048904 Bacteria 2228
406 Ga0496102_0077300 3300048905 Bacteria 3063
407 Ga0496102_0088317 3300048905 Bacteria 2865
408 Ga0496102_0112275 3300048905 Bacteria 2542
409 Ga0496102_0238383 3300048905 Bacteria 1715
410 Ga0496102_0295613 3300048905 Bacteria 1526
411 Ga0496102_0502157 3300048905 Bacteria 1135
412 Ga0496103_0398637 3300048906 Bacteria 884
413 Ga0496104_0001401 3300048907 Bacteria 20872
414 Ga0496104_0004546 3300048907 Bacteria 12086
415 Ga0496104_0011455 3300048907 Bacteria 7947
416 Ga0496104_0032177 3300048907 Bacteria 4881
417 Ga0496104_0032479 3300048907 Bacteria 4858
418 Ga0496104_0589189 3300048907 Bacteria 1022
419 Ga0496105_0006699 3300048908 Bacteria 8865
420 Ga0496105_0007621 3300048908 Bacteria 8391
421 Ga0496105_0021860 3300048908 Bacteria 5178
422 Ga0496105_0056304 3300048908 Bacteria 3245
423 Ga0496105_0082896 3300048908 Bacteria 2648
424 Ga0496105_0118272 3300048908 Bacteria 2186
425 Ga0496106_0080396 3300048909 Bacteria 2503
426 Ga0496106_0199929 3300048909 Bacteria 1590
427 Ga0496107_0149022 3300048910 Bacteria 1730
428 Ga0496107_0544412 3300048910 Bacteria 860
429 Ga0496108_0001138 3300048911 Bacteria 20763
430 Ga0496108_0008312 3300048911 Bacteria 8418
431 Ga0496108_0010582 3300048911 Bacteria 7488
432 Ga0496108_0035260 3300048911 Bacteria 4158
433 Ga0496108_0036381 3300048911 Bacteria 4096
434 Ga0496108_0047573 3300048911 Bacteria 3585
435 Ga0496108_0049097 3300048911 Bacteria 3530
436 Ga0496109_0001955 3300048912 Bacteria 17076
437 Ga0496109_0012977 3300048912 Bacteria 7201
438 Ga0496109_0131325 3300048912 Bacteria 2338
439 Ga0496109_0136453 3300048912 Bacteria 2292
440 Ga0496109_0167048 3300048912 Bacteria 2063
441 Ga0496110_0086763 3300048913 Bacteria 2794
442 Ga0496110_0093159 3300048913 Bacteria 2696
443 Ga0496110_0270795 3300048913 Bacteria 1546
444 Ga0496111_0000232 3300048914 Bacteria 26683
445 Ga0496111_0012868 3300048914 Bacteria 5677
446 Ga0496111_0028304 3300048914 Bacteria 3970
447 Ga0496111_0070645 3300048914 Bacteria 2540
448 Ga0496111_0325728 3300048914 Unclassified 1138
449 Ga0496112_0009282 3300048915 Bacteria 8843
450 Ga0496112_0015771 3300048915 Bacteria 7060
451 Ga0496112_0033874 3300048915 Bacteria 4968
452 Ga0496112_0235741 3300048915 Bacteria 1783
453 Ga0496112_0552236 3300048915 Bacteria 1085
454 Ga0496113_0001704 3300048916 Bacteria 12457
455 Ga0496113_0023454 3300048916 Bacteria 4375
456 Ga0496113_0030980 3300048916 Bacteria 3877
457 Ga0496113_0032549 3300048916 Bacteria 3789
458 Ga0496113_0089586 3300048916 Bacteria 2368
459 Ga0496113_0206521 3300048916 Bacteria 1562
460 Ga0496113_0315698 3300048916 Bacteria 1252
461 Ga0496114_0068025 3300048917 Bacteria 2989
462 Ga0496114_0092183 3300048917 Bacteria 2574
463 Ga0496114_0517817 3300048917 Bacteria 1055
464 Ga0496115_0122371 3300048918 Bacteria 2141
465 Ga0496115_0150470 3300048918 Bacteria 1922
466 Ga0496124_0053232 3300048927 Bacteria 3433
467 Ga0501040_0651019 3300049576 Bacteria 761
468 Ga0501041_0056479 3300049577 Bacteria 2399
469 Ga0501043_0169640 3300049579 Unclassified 1703
470 Ga0501048_0078922 3300049582 Bacteria 2323
471 Ga0501067_0048693 3300049583 Bacteria 2350
472 Ga0501067_0113278 3300049583 Bacteria 1508
473 Ga0501068_0054137 3300049584 Bacteria 2431
474 Ga0501068_0124785 3300049584 Bacteria 1607
475 Ga0501070_0234966 3300049586 Bacteria 1501
476 Ga0501070_0304273 3300049586 Bacteria 1298
477 Ga0501071_0403065 3300049587 Bacteria 1044
478 Ga0501072_0069127 3300049588 Bacteria 2788
479 Ga0501072_0523262 3300049588 Bacteria 938
480 Ga0501075_0247282 3300049591 Bacteria 1359
481 Ga0501076_0423214 3300049592 Unclassified 1096
482 Ga0501077_0032060 3300049593 Bacteria 3344
483 Ga0501083_0281362 3300049744 Bacteria 1082
484 Ga0501045_0175699 3300049824 Bacteria 1595
485 nmdc:mga0yw44_186123_c1 3300050492 Bacteria 1368
486 nmdc:mga0yw44_352121_c1 3300050492 Bacteria 991
487 nmdc:mga0yw44_7801_c1 3300050492 Bacteria 5045
488 nmdc:mga07m45_35250_c1 3300050496 Bacteria 2782
489 nmdc:mga0n895_36361_c1 3300050512 Bacteria 4754
490 nmdc:mga0rr50_206805_c1 3300050513 Bacteria 1615
491 nmdc:mga0rr50_308579_c1 3300050513 Bacteria 1325
492 nmdc:mga0a205_486767_c1 3300050515 Bacteria 1091
493 Ga0495601_0001416 3300053077 Bacteria 13210
494 Ga0495601_0017599 3300053077 Bacteria 4340
495 Ga0495612_0002841 3300053078 Bacteria 7164
496 Ga0495612_0016552 3300053078 Bacteria 2954
497 Ga0495619_0001006 3300053085 Bacteria 18435
498 Ga0495619_0330901 3300053085 Bacteria 1054
499 Ga0501084_0375667 3300054114 Bacteria 1201
500 Ga0501082_0046689 3300060353 Bacteria 3733
501 Ga0070691_10085255
502 JGI25404J52841_10004884
503 Ga0070676_10069465
504 Ga0070683_100009003
505 Ga0070683_100673162
506 Ga0070690_100250898
507 Ga0070666_10096592
508 Ga0070682_100012874
509 Ga0070682_100071053
510 Ga0070682_100127032
511 Ga0070660_100162430
512 Ga0070692_10007947
513 Ga0070692_10041646
514 Ga0070669_100590932
515 Ga0070674_100322523
516 Ga0070673_100839014
517 Ga0070659_100283069
518 Ga0070667_100057295
519 Ga0070709_10029955
520 Ga0070709_10045059
521 Ga0070709_10070698
522 Ga0070709_10179323
523 Ga0070714_100091111
524 Ga0070714_100248899
525 Ga0070714_100391852
526 Ga0070714_100945701
527 Ga0070713_100038529
528 Ga0070713_100405137
529 Ga0070713_100520085
530 Ga0070713_100533121
531 Ga0070710_10009332
532 Ga0070710_10024444
533 Ga0070710_10033041
534 Ga0070710_10066871
535 Ga0070710_10125940
536 Ga0070710_10249933
537 Ga0070711_100255914
538 Ga0070711_100305470
539 Ga0070708_100484082
540 Ga0070663_100008080
541 Ga0070685_10071074
542 Ga0070706_100453993
543 Ga0070707_100010788
544 Ga0070707_100054664
545 Ga0070698_100000231
546 Ga0070698_100000814
547 Ga0070699_100000682
548 Ga0070699_100095866
549 Ga0070697_100041651
550 Ga0068853_100123990
551 Ga0070686_100326994
552 Ga0070693_100200579
553 Ga0070665_100001244
554 Ga0068857_100013965
555 Ga0068857_100111471
556 Ga0068854_100624141
557 Ga0068856_100033023
558 Ga0068856_100064942
559 Ga0068856_100133748
560 Ga0068856_100156936
561 Ga0068856_100313344
562 Ga0068856_100427605
563 Ga0070702_100182429
564 Ga0068852_100810506
565 Ga0068864_100559816
566 Ga0068861_100090839
567 Ga0081540_1002707
568 Ga0070717_10025194
569 Ga0070717_10235052
570 Ga0070717_10318919
571 Ga0070717_10371974
572 Ga0070717_10628425
573 Ga0075365_10020096
574 Ga0070715_10000922
575 Ga0070715_10060266
576 Ga0070716_100005212
577 Ga0070716_100007263
578 Ga0070716_100258852
579 Ga0070716_100268785
580 Ga0070712_100019907
581 Ga0070712_100094137
582 Ga0070712_100176124
583 Ga0070712_100359606
584 Ga0070712_100391877
585 Ga0070712_100634476
586 Ga0075370_10043904
587 Ga0068871_100396405
588 Ga0075433_10445129
589 Ga0075434_100157433
590 Ga0068865_100386378
591 Ga0075435_100023615
592 Ga0075435_100277106
593 Ga0075435_100603794
594 Ga0105245_10000470
595 Ga0105245_10047989
596 Ga0105245_10213478
597 Ga0114129_10060867
598 Ga0105243_10217998
599 Ga0105242_10267100
600 Ga0105238_10227535
601 Ga0105249_10200665
602 Ga0105246_10073238
603 Ga0157370_10270333
604 Ga0157374_10322629
605 Ga0157378_10038619
606 Ga0163162_10217657
607 Ga0157372_10244898
608 Ga0157372_10501375
609 Ga0157375_10087051
610 Ga0157380_10128355
611 Ga0157377_10135562
612 Ga0157377_10180434
613 Ga0157379_10490705
614 Ga0157376_10116234
615 Ga0157376_10179937
616 Ga0207692_10029251
617 Ga0207692_10036265
618 Ga0207692_10164426
619 Ga0207688_10016014
620 Ga0207688_10049374
621 Ga0207685_10009648
622 Ga0207685_10025853
623 Ga0207699_10003931
624 Ga0207699_10007292
625 Ga0207699_10053095
626 Ga0207699_10092483
627 Ga0207699_10425797
628 Ga0207645_10036661
629 Ga0207705_10454668
630 Ga0207684_10020450
631 Ga0207684_10174050
632 Ga0207654_10103701
633 Ga0207707_10504046
634 Ga0207671_10160816
635 Ga0207693_10015536
636 Ga0207693_10017453
637 Ga0207693_10110790
638 Ga0207693_10258361
639 Ga0207693_10315159
640 Ga0207663_10010735
641 Ga0207657_10022832
642 Ga0207649_10136184
643 Ga0207646_10047732
644 Ga0207646_10066729
645 Ga0207646_10420395
646 Ga0207694_10207738
647 Ga0207687_10395300
648 Ga0207687_10650491
649 Ga0207700_10000890
650 Ga0207700_10015559
651 Ga0207700_10017958
652 Ga0207700_10151935
653 Ga0207700_10261448
654 Ga0207700_10353142
655 Ga0207700_10854341
656 Ga0207664_10050597
657 Ga0207664_10054708
658 Ga0207664_10093857
659 Ga0207664_10153131
660 Ga0207664_10180052
661 Ga0207664_10292203
662 Ga0207664_10378521
663 Ga0207664_10569494
664 Ga0207644_10399856
665 Ga0207690_10040218
666 Ga0207690_10182701
667 Ga0207709_10136896
668 Ga0207665_10001271
669 Ga0207665_10008206
670 Ga0207665_10174420
671 Ga0207665_10288188
672 Ga0207689_10015356
673 Ga0207679_10330097
674 Ga0207668_10141206
675 Ga0207668_10321859
676 Ga0207668_10613617
677 Ga0207640_10088372
678 Ga0207658_10129912
679 Ga0207639_10129205
680 Ga0207678_10161567
681 Ga0207708_10124271
682 Ga0207702_10080584
683 Ga0207702_10117969
684 Ga0207702_10189902
685 Ga0207702_10596676
686 Ga0207641_10001869
687 Ga0207674_10011248
688 Ga0207675_100495787
689 Ga0207683_10539076
690 Ga0268266_10002483
691 Ga0265337_1001224
692 Ga0265319_1003473
693 Ga0265334_10001788
694 Ga0265318_10018393
695 Ga0265323_10008214
696 Ga0265322_10002171
697 Ga0265336_10008067
698 Ga0265338_10000837
699 Ga0265324_10033449
700 Ga0265332_10002621
701 Ga0265320_10015847
702 Ga0265316_10012898
703 Ga0265313_10005606
704 Ga0265314_10020287
705 Ga0265342_10021635
706 Ga0307516_10095388
707 Ga0307409_100177693
708 Ga0307411_10204656
709 Ga0307415_100107851
710 Ga0373926_0000142
711 Ga0373929_0004758
712 Ga0373934_0005067
713 Ga0373934_0024120
714 Ga0373944_0000422
715 Ga0373951_0007197
716 Ga0373923_0000058
717 Ga0373923_0073699
718 Ga0373932_0075843
719 Ga0373936_0000065
720 Ga0373945_0000072
721 Ga0373945_0062014
722 Ga0373953_0006173
723 Ga0373953_0011866
724 Ga0373953_0099925
725 Ga0373954_0020976
726 Ga0373954_0022568
727 Ga0373956_0012235
728 Ga0373956_0025340
729 Ga0373957_0000253
730 Ga0373957_0008159
731 Ga0373957_0010621
732 Ga0373943_0001815
733 Ga0373943_0038653
734 Ga0373943_0046538
735 Ga0373946_0034858
736 Ga0373955_0005111
737 Ga0373955_0188525
738 Ga0373961_0010645
739 Ga0373924_0009922
740 Ga0373931_0026440
741 Ga0373935_0038714
742 Ga0373927_0001277
743 Ga0373927_0153951
744 Ga0373933_0000887
745 Ga0373933_0003998
746 Ga0373933_0082641
747 Ga0373947_0242271
748 Ga0373937_0000610
749 Ga0373937_0009888
750 Ga0373937_0076952
751 Ga0373937_0389944
752 Ga0373925_0001542
753 Ga0373925_0003628
754 Ga0373925_0047957
755 Ga0373925_0225971
756 Ga0436365_0562354
757 Ga0451843_0768469
758 Ga0451576_0790915
759 Ga0466967_0072047
760 Ga0466967_0446851
761 Ga0495592_0001188
762 Ga0495592_0028115
763 Ga0495592_0036135
764 Ga0495592_0195259
765 Ga0495592_0199143
766 Ga0495603_0001440
767 Ga0495629_0000641
768 Ga0495629_0001715
769 Ga0495629_0018309
770 Ga0495641_0000184
771 Ga0495641_0002868
772 Ga0495651_0000215
773 Ga0495651_0015734
774 Ga0495651_0039237
775 Ga0495651_0288909
776 Ga0495653_0025022
777 Ga0495653_0028567
778 Ga0495653_0049554
779 Ga0495653_0079218
780 Ga0495582_0000343
781 Ga0495639_0025936
782 Ga0495639_0038846
783 Ga0495639_0049559
784 Ga0495662_0000054
785 Ga0495662_0046670
786 Ga0495662_0050626
787 Ga0495662_0113659
788 Ga0495664_0000350
789 Ga0495664_0006537
790 Ga0495664_0104024
791 Ga0495664_0147404
792 Ga0495664_0181927
793 Ga0495594_0002835
794 Ga0495596_0084429
795 Ga0495608_0000444
796 Ga0495608_0018501
797 Ga0495608_0021553
798 Ga0495608_0028286
799 Ga0495618_0000626
800 Ga0495618_0033782
801 Ga0495618_0061480
802 Ga0495628_0037899
803 Ga0495628_0041602
804 Ga0495628_0043900
805 Ga0495628_0083921
806 Ga0495630_0000866
807 Ga0495630_0055439
808 Ga0495630_0126286
809 Ga0495666_0005381
810 Ga0495652_0004180
811 Ga0495652_0056449
812 Ga0495652_0152132
813 Ga0495652_0157137
814 Ga0495652_0415471
815 Ga0495665_0000427
816 Ga0495665_0009678
817 Ga0495665_0139524
818 Ga0495640_0001976
819 Ga0495640_0026154
820 Ga0495640_0046480
821 Ga0495640_0172529
822 Ga0495640_0332103
823 Ga0495586_0005845
824 Ga0495587_0001509
825 Ga0495587_0033444
826 Ga0495587_0160241
827 Ga0495645_0000167
828 Ga0495645_0045184
829 Ga0495622_0099446
830 Ga0495667_0034709
831 Ga0495667_0041791
832 Ga0495667_0060534
833 Ga0495634_0002611
834 Ga0495634_0012757
835 Ga0495634_0027750
836 Ga0495634_0043601
837 Ga0495635_0001336
838 Ga0495635_0023363
839 Ga0495635_0100159
840 Ga0495635_0104909
841 Ga0495635_0123433
842 Ga0495588_0022111
843 Ga0495588_0182545
844 Ga0495657_0000676
845 Ga0495657_0005020
846 Ga0495657_0041049
847 Ga0495599_0015295
848 Ga0495599_0090641
849 Ga0495599_0118029
850 Ga0495623_0084846
851 Ga0495646_0031514
852 Ga0495646_0051744
853 Ga0495646_0067502
854 Ga0495647_0007937
855 Ga0495658_0000340
856 Ga0495658_0012537
857 Ga0495658_0167996
858 Ga0495613_0002229
859 Ga0495613_0076122
860 Ga0495624_0023804
861 Ga0495624_0044624
862 Ga0495600_0000437
863 Ga0495600_0048032
864 Ga0495581_0000281
865 Ga0495581_0227356
866 Ga0495604_0000286
867 Ga0495604_0018156
868 Ga0495604_0043312
869 Ga0495604_0303570
870 Ga0495674_0021807
871 Ga0495674_0047150
872 Ga0495674_0121646
873 Ga0495674_0225013
874 Ga0495674_0309916
875 Ga0495674_0319750
876 Ga0495674_0422006
877 Ga0495676_0000478
878 Ga0495676_0067808
879 Ga0495676_0405763
880 Ga0495680_0002526
881 Ga0495680_0007571
882 Ga0495680_0021707
883 Ga0495680_0036774
884 Ga0495680_0082463
885 Ga0495680_0086904
886 Ga0495680_0106574
887 Ga0495675_0000628
888 Ga0495675_0049853
889 Ga0495675_0131012
890 Ga0495675_0215968
891 Ga0495684_0014159
892 Ga0495684_0014323
893 Ga0495684_0020005
894 Ga0495684_0111368
895 Ga0495684_0172179
896 Ga0495593_0001228
897 Ga0495602_0017829
898 Ga0495602_0029819
899 Ga0495614_0007712
900 Ga0495614_0027490
901 Ga0496100_0033312
902 Ga0496100_0067057
903 Ga0496100_0196352
904 Ga0496101_0024830
905 Ga0496101_0094555
906 Ga0496102_0077300
907 Ga0496102_0088317
908 Ga0496102_0112275
909 Ga0496102_0238383
910 Ga0496102_0295613
911 Ga0496102_0502157
912 Ga0496103_0398637
913 Ga0496104_0001401
914 Ga0496104_0004546
915 Ga0496104_0011455
916 Ga0496104_0032177
917 Ga0496104_0032479
918 Ga0496104_0589189
919 Ga0496105_0006699
920 Ga0496105_0007621
921 Ga0496105_0021860
922 Ga0496105_0056304
923 Ga0496105_0082896
924 Ga0496105_0118272
925 Ga0496106_0080396
926 Ga0496106_0199929
927 Ga0496107_0149022
928 Ga0496107_0544412
929 Ga0496108_0001138
930 Ga0496108_0008312
931 Ga0496108_0010582
932 Ga0496108_0035260
933 Ga0496108_0036381
934 Ga0496108_0047573
935 Ga0496108_0049097
936 Ga0496109_0001955
937 Ga0496109_0012977
938 Ga0496109_0131325
939 Ga0496109_0136453
940 Ga0496109_0167048
941 Ga0496110_0086763
942 Ga0496110_0093159
943 Ga0496110_0270795
944 Ga0496111_0000232
945 Ga0496111_0012868
946 Ga0496111_0028304
947 Ga0496111_0070645
948 Ga0496111_0325728
949 Ga0496112_0009282
950 Ga0496112_0015771
951 Ga0496112_0033874
952 Ga0496112_0235741
953 Ga0496112_0552236
954 Ga0496113_0001704
955 Ga0496113_0023454
956 Ga0496113_0030980
957 Ga0496113_0032549
958 Ga0496113_0089586
959 Ga0496113_0206521
960 Ga0496113_0315698
961 Ga0496114_0068025
962 Ga0496114_0092183
963 Ga0496114_0517817
964 Ga0496115_0122371
965 Ga0496115_0150470
966 Ga0496124_0053232
967 Ga0501040_0651019
968 Ga0501041_0056479
969 Ga0501043_0169640
970 Ga0501048_0078922
971 Ga0501067_0048693
972 Ga0501067_0113278
973 Ga0501068_0054137
974 Ga0501068_0124785
975 Ga0501070_0234966
976 Ga0501070_0304273
977 Ga0501071_0403065
978 Ga0501072_0069127
979 Ga0501072_0523262
980 Ga0501075_0247282
981 Ga0501076_0423214
982 Ga0501077_0032060
983 Ga0501083_0281362
984 Ga0501045_0175699
985 nmdc:mga0yw44_186123_c1
986 nmdc:mga0yw44_352121_c1
987 nmdc:mga0yw44_7801_c1
988 nmdc:mga07m45_35250_c1
989 nmdc:mga0n895_36361_c1
990 nmdc:mga0rr50_206805_c1
991 nmdc:mga0rr50_308579_c1
992 nmdc:mga0a205_486767_c1
993 Ga0495601_0001416
994 Ga0495601_0017599
995 Ga0495612_0002841
996 Ga0495612_0016552
997 Ga0495619_0001006
998 Ga0495619_0330901
999 Ga0501084_0375667
1000 Ga0501082_0046689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

54

147

0.95

PF08242

Methyltransf_12

Methyltransferase domain

54

145

0.95

PF13649

Methyltransf_25

Methyltransferase domain

53

143

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

34

153

0.9

PF13847

Methyltransf_31

Methyltransferase domain

47

195

0.87

PF13489

Methyltransf_23

Methyltransferase domain

29

217

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.8431 22 134
6uk5-assembly1.cif.gz_B structure of sam bound cals10, an amino pentose methyltransferase from micromonospora echinaspora involved in calicheamicin biosynthesis 0.8275 8 134
3tma-assembly1.cif.gz_A crystal structure of trmn from thermus thermophilus 0.8246 21 133
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.8018 8 133
4oqe-assembly1.cif.gz_A crystal structure of the tylm1 n,n-dimethyltransferase in complex with sah and tdp-fuc3nme 0.7983 1 134
ID Description Score Start End Superfamily
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9054 19 134 3.40.50.150
af_A0A1D6QMW6_179_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8867 38 131 3.40.50.150
af_I1KJV5_166_284_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8749 88 131 3.40.50.150
af_A0A0R0II64_62_165_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8728 85 132 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8677 18 70 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A853DKQ2-F1-model_v4 SAM-dependent methyltransferase 0.9586 2 253 GO:0008757
GO:0032259
AF-A0A5D0XQ80-F1-model_v4 Class I SAM-dependent methyltransferase 0.9568 2 124 GO:0008757
GO:0032259
AF-A0A853DKQ2-F1-model_v4 SAM-dependent methyltransferase 0.9512 2 253 GO:0008757
GO:0032259
AF-A0A4V2VD79-F1-model_v4 Methyltransferase family protein 0.9276 2 253 GO:0008757
GO:0032259
AF-A0A4V2VD79-F1-model_v4 Methyltransferase family protein 0.9205 2 253 GO:0008757
GO:0032259

Map