F455340

General Info

Members Datasets Scaffolds Average Seq Length
499 220 998 369

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100062916|Ga0068856_1000629162
Length 421
Sequence MTAGFGKCLSLQNVSDFAPLPARKPRRSREEHARARFETGGDGINPISSRNHLSSTYVQKIRVRTKPNAYTVQVGAGLLRRAGREVRRVLPSSGSRVFVITSPNVRRHWGEALEKSLRDARLPYEVLEMHDGEPAKRLHTVEQLAESLVDAKADRKSLLVAFGGGVVGDSAGFLAAVFMRGIPVVQIPTTVVAQVDASIGGKTGVNLRGGKNLVGSFHQPSTVLVDPDLLATLDEREFRSGLFESLKCGVIRDRNLFDFMERNSTKILARDSRSLQRVIGDSIRVKADVVSADEKESGLRRVLNFGHTIGHALEAATDYSQYLHGEAVAWGMIAAAAIARDSGACNAETAERIIAATRLYGPLPNVLCDAQSILGRLGADKKTIAGAVHFILPQKIGKVKISSDVPPGIIRNAVELIRNHV

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 1.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.01
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100062916 3300005614 Bacteria 3665
2 MBSR1b_contig_12822335 2162886012 Unclassified 1291
3 MBSR1b_contig_5450740 2162886012 Unclassified 1289
4 LJNas_1000068 3300000546 Bacteria 14265
5 Ga0070658_10026806 3300005327 Bacteria 4627
6 Ga0070683_100109120 3300005329 Bacteria 2610
7 Ga0070690_100047491 3300005330 Bacteria 2732
8 Ga0070690_100089918 3300005330 Bacteria 2020
9 Ga0068869_100012038 3300005334 Bacteria 5699
10 Ga0068869_100040848 3300005334 Bacteria 3318
11 Ga0070680_100052284 3300005336 Bacteria 3335
12 Ga0070680_100086423 3300005336 Bacteria 2592
13 Ga0070682_100002535 3300005337 Bacteria 10083
14 Ga0068868_100026143 3300005338 Bacteria 4445
15 Ga0068868_100087659 3300005338 Bacteria 2503
16 Ga0070691_10039680 3300005341 Bacteria 2225
17 Ga0070687_100050932 3300005343 Bacteria 2141
18 Ga0070661_100019010 3300005344 Bacteria 4891
19 Ga0070661_100026967 3300005344 Bacteria 4136
20 Ga0070668_100008093 3300005347 Bacteria 7809
21 Ga0070668_100228397 3300005347 Bacteria 1537
22 Ga0070675_100098033 3300005354 Bacteria 2465
23 Ga0070675_100361944 3300005354 Bacteria 1288
24 Ga0070673_100100224 3300005364 Unclassified 2384
25 Ga0070659_100044343 3300005366 Bacteria 3481
26 Ga0070667_100012738 3300005367 Bacteria 6953
27 Ga0070709_10001122 3300005434 Bacteria 14778
28 Ga0070709_10023190 3300005434 Bacteria 3641
29 Ga0070709_10042822 3300005434 Unclassified 2798
30 Ga0070709_10045730 3300005434 Unclassified 2719
31 Ga0070709_10068346 3300005434 Bacteria 2284
32 Ga0070709_10175466 3300005434 Bacteria 1501
33 Ga0070714_100000069 3300005435 Bacteria 93567
34 Ga0070714_100010671 3300005435 Bacteria 7269
35 Ga0070714_100147122 3300005435 Unclassified 2120
36 Ga0070714_100159158 3300005435 Bacteria 2042
37 Ga0070714_100265259 3300005435 Bacteria 1591
38 Ga0070713_100000432 3300005436 Bacteria 26764
39 Ga0070713_100018623 3300005436 Bacteria 5277
40 Ga0070713_100024471 3300005436 Bacteria 4703
41 Ga0070713_100035662 3300005436 Bacteria 4007
42 Ga0070713_100107554 3300005436 Bacteria 2426
43 Ga0070713_100141614 3300005436 Unclassified 2131
44 Ga0070713_100183258 3300005436 Bacteria 1883
45 Ga0070713_100209972 3300005436 Bacteria 1762
46 Ga0070713_100372174 3300005436 Unclassified 1329
47 Ga0070710_10002730 3300005437 Bacteria 8401
48 Ga0070710_10026016 3300005437 Bacteria 3105
49 Ga0070710_10064174 3300005437 Bacteria 2100
50 Ga0070711_100000340 3300005439 Bacteria 24038
51 Ga0070711_100001263 3300005439 Bacteria 13724
52 Ga0070711_100008309 3300005439 Bacteria 6354
53 Ga0070711_100029375 3300005439 Unclassified 3627
54 Ga0070711_100045716 3300005439 Bacteria 2980
55 Ga0070711_100059564 3300005439 Unclassified 2652
56 Ga0070711_100105723 3300005439 Bacteria 2056
57 Ga0070711_100158733 3300005439 Bacteria 1712
58 Ga0070708_100001602 3300005445 Bacteria 17338
59 Ga0070708_100003146 3300005445 Bacteria 12861
60 Ga0070708_100003488 3300005445 Bacteria 12311
61 Ga0070708_100003966 3300005445 Bacteria 11615
62 Ga0070708_100004955 3300005445 Bacteria 10526
63 Ga0070708_100012272 3300005445 Bacteria 6985
64 Ga0070708_100019629 3300005445 Bacteria 5684
65 Ga0070708_100104328 3300005445 Bacteria 2599
66 Ga0070663_100016064 3300005455 Bacteria 4849
67 Ga0070678_100265020 3300005456 Bacteria 1447
68 Ga0070662_100002565 3300005457 Bacteria 11188
69 Ga0070681_10011813 3300005458 Bacteria 8657
70 Ga0070681_10018554 3300005458 Bacteria 6954
71 Ga0070681_10200985 3300005458 Bacteria 1911
72 Ga0068867_100016423 3300005459 Bacteria 5255
73 Ga0070706_100000499 3300005467 Bacteria 45986
74 Ga0070706_100006009 3300005467 Bacteria 11472
75 Ga0070706_100014536 3300005467 Bacteria 7272
76 Ga0070706_100075763 3300005467 Bacteria 3114
77 Ga0070707_100006096 3300005468 Bacteria 11241
78 Ga0070707_100009701 3300005468 Bacteria 8947
79 Ga0070707_100029235 3300005468 Bacteria 5247
80 Ga0070707_100041410 3300005468 Bacteria 4409
81 Ga0070707_100043220 3300005468 Bacteria 4313
82 Ga0070707_100070689 3300005468 Unclassified 3362
83 Ga0070707_100209128 3300005468 Bacteria 1902
84 Ga0070698_100001333 3300005471 Bacteria 27479
85 Ga0070698_100013058 3300005471 Bacteria 8794
86 Ga0070698_100037641 3300005471 Bacteria 4987
87 Ga0070699_100001027 3300005518 Bacteria 25921
88 Ga0070699_100008978 3300005518 Bacteria 8658
89 Ga0070699_100016909 3300005518 Bacteria 6264
90 Ga0070699_100135698 3300005518 Bacteria 2171
91 Ga0070679_100077165 3300005530 Bacteria 3321
92 Ga0070679_100096350 3300005530 Bacteria 2946
93 Ga0070697_100000237 3300005536 Bacteria 44549
94 Ga0070697_100003028 3300005536 Bacteria 12911
95 Ga0070697_100008934 3300005536 Bacteria 7828
96 Ga0070697_100010357 3300005536 Bacteria 7272
97 Ga0070697_100010690 3300005536 Bacteria 7163
98 Ga0070697_100012360 3300005536 Bacteria 6688
99 Ga0070697_100055702 3300005536 Bacteria 3215
100 Ga0070697_100115647 3300005536 Bacteria 2240
101 Ga0070697_100154329 3300005536 Unclassified 1937
102 Ga0068853_100003306 3300005539 Bacteria 12335
103 Ga0068853_100025074 3300005539 Bacteria 5003
104 Ga0068853_100285645 3300005539 Unclassified 1522
105 Ga0070672_100003170 3300005543 Bacteria 10631
106 Ga0070686_100070186 3300005544 Bacteria 2290
107 Ga0070686_100171272 3300005544 Bacteria 1536
108 Ga0070695_100049309 3300005545 Unclassified 2696
109 Ga0070695_100089117 3300005545 Bacteria 2056
110 Ga0070696_100142619 3300005546 Bacteria 1752
111 Ga0068855_100271050 3300005563 Bacteria 1887
112 Ga0068855_100455208 3300005563 Unclassified 1396
113 Ga0070664_100065697 3300005564 Bacteria 3096
114 Ga0070664_100240420 3300005564 Bacteria 1625
115 Ga0068857_100014159 3300005577 Bacteria 6946
116 Ga0068856_100002427 3300005614 Bacteria 19176
117 Ga0068856_100165732 3300005614 Bacteria 2221
118 Ga0068856_100210933 3300005614 Bacteria 1957
119 Ga0070702_100110922 3300005615 Bacteria 1700
120 Ga0068852_100008868 3300005616 Bacteria 7439
121 Ga0068852_100029894 3300005616 Bacteria 4479
122 Ga0068859_100025551 3300005617 Bacteria 5923
123 Ga0068859_100029696 3300005617 Bacteria 5486
124 Ga0068866_10087775 3300005718 Bacteria 1686
125 Ga0068861_100186701 3300005719 Bacteria 1729
126 Ga0068851_10010754 3300005834 Bacteria 4276
127 Ga0068851_10034967 3300005834 Bacteria 2510
128 Ga0068870_10008583 3300005840 Bacteria 4602
129 Ga0068863_100034249 3300005841 Bacteria 4838
130 Ga0068863_100038879 3300005841 Unclassified 4527
131 Ga0068858_100014582 3300005842 Bacteria 7405
132 Ga0068858_100061857 3300005842 Bacteria 3461
133 Ga0068860_100017651 3300005843 Bacteria 6953
134 Ga0068862_100010972 3300005844 Bacteria 7482
135 Ga0070717_10000774 3300006028 Bacteria 20927
136 Ga0070717_10001917 3300006028 Bacteria 14536
137 Ga0070717_10001986 3300006028 Bacteria 14301
138 Ga0070717_10003179 3300006028 Bacteria 11734
139 Ga0070717_10007845 3300006028 Bacteria 7946
140 Ga0070717_10009302 3300006028 Bacteria 7384
141 Ga0070717_10021908 3300006028 Bacteria 5042
142 Ga0070717_10052237 3300006028 Unclassified 3366
143 Ga0070717_10095823 3300006028 Bacteria 2512
144 Ga0070717_10100677 3300006028 Bacteria 2453
145 Ga0070715_10005270 3300006163 Bacteria 4300
146 Ga0070715_10011966 3300006163 Unclassified 3140
147 Ga0070716_100000792 3300006173 Bacteria 13578
148 Ga0070716_100005146 3300006173 Bacteria 6321
149 Ga0070716_100009498 3300006173 Unclassified 4850
150 Ga0070716_100010634 3300006173 Bacteria 4618
151 Ga0070712_100000042 3300006175 Bacteria 66639
152 Ga0070712_100000192 3300006175 Bacteria 33875
153 Ga0070712_100029040 3300006175 Bacteria 3705
154 Ga0070712_100032630 3300006175 Bacteria 3517
155 Ga0070712_100032679 3300006175 Unclassified 3515
156 Ga0070712_100064166 3300006175 Bacteria 2603
157 Ga0097621_100018541 3300006237 Bacteria 5319
158 Ga0097621_100059626 3300006237 Bacteria 3125
159 Ga0068871_100001484 3300006358 Bacteria 15731
160 Ga0068871_100036565 3300006358 Bacteria 3911
161 Ga0068871_100064375 3300006358 Bacteria 3002
162 Ga0075433_10026059 3300006852 Unclassified 4946
163 Ga0075434_100005455 3300006871 Bacteria 11589
164 Ga0075434_100204443 3300006871 Bacteria 1995
165 Ga0075434_100402831 3300006871 Bacteria 1389
166 Ga0068865_100079922 3300006881 Bacteria 2343
167 Ga0075436_100002929 3300006914 Bacteria 11706
168 Ga0097620_100025552 3300006931 Bacteria 5923
169 Ga0097620_100029691 3300006931 Bacteria 5486
170 Ga0075435_100000170 3300007076 Bacteria 38099
171 Ga0075435_100228366 3300007076 Bacteria 1581
172 Ga0099794_10105742 3300007265 Unclassified 1407
173 Ga0105240_10005223 3300009093 Bacteria 19427
174 Ga0105240_10046039 3300009093 Bacteria 5530
175 Ga0105240_10101953 3300009093 Bacteria 3489
176 Ga0105240_10136094 3300009093 Bacteria 2942
177 Ga0105240_10154676 3300009093 Bacteria 2729
178 Ga0105245_10033558 3300009098 Bacteria 4550
179 Ga0105245_10083732 3300009098 Bacteria 2920
180 Ga0105245_10097855 3300009098 Bacteria 2710
181 Ga0105247_10030045 3300009101 Bacteria 3294
182 Ga0105247_10153663 3300009101 Bacteria 1518
183 Ga0114129_10014271 3300009147 Bacteria 11322
184 Ga0105243_10015615 3300009148 Bacteria 5741
185 Ga0105241_10096119 3300009174 Unclassified 2346
186 Ga0105241_10194882 3300009174 Bacteria 1689
187 Ga0105242_10011382 3300009176 Bacteria 6839
188 Ga0105242_10021426 3300009176 Bacteria 5075
189 Ga0105248_10048797 3300009177 Bacteria 4748
190 Ga0105248_10075358 3300009177 Bacteria 3792
191 Ga0105237_10396507 3300009545 Unclassified 1385
192 Ga0105238_10011948 3300009551 Bacteria 8748
193 Ga0105238_10029280 3300009551 Bacteria 5610
194 Ga0105238_10036031 3300009551 Bacteria 5029
195 Ga0105238_10063589 3300009551 Unclassified 3691
196 Ga0105238_10266380 3300009551 Bacteria 1693
197 Ga0105249_10032850 3300009553 Bacteria 4696
198 Ga0105239_10007204 3300010375 Bacteria 12783
199 Ga0105239_10031937 3300010375 Bacteria 5786
200 Ga0105246_10007535 3300011119 Bacteria 6676
201 Ga0105246_10009350 3300011119 Bacteria 6040
202 Ga0157371_10011908 3300013102 Bacteria 6673
203 Ga0157371_10056494 3300013102 Bacteria 2784
204 Ga0157370_10168116 3300013104 Bacteria 2039
205 Ga0157369_10044962 3300013105 Bacteria 4804
206 Ga0157369_10154214 3300013105 Unclassified 2427
207 Ga0157369_10211718 3300013105 Bacteria 2031
208 Ga0157374_10003563 3300013296 Bacteria 13110
209 Ga0157374_10018844 3300013296 Bacteria 6100
210 Ga0157374_10027772 3300013296 Bacteria 5109
211 Ga0157374_10055042 3300013296 Bacteria 3712
212 Ga0157374_10164435 3300013296 Unclassified 2162
213 Ga0157374_10238831 3300013296 Unclassified 1786
214 Ga0157374_10437658 3300013296 Unclassified 1308
215 Ga0157378_10004484 3300013297 Bacteria 12259
216 Ga0157378_10010895 3300013297 Bacteria 7952
217 Ga0157378_10088145 3300013297 Bacteria 2816
218 Ga0163162_10013577 3300013306 Bacteria 7957
219 Ga0163162_10054581 3300013306 Bacteria 4020
220 Ga0163162_10183959 3300013306 Bacteria 2216
221 Ga0157372_10003854 3300013307 Bacteria 16121
222 Ga0157372_10022731 3300013307 Bacteria 6788
223 Ga0157372_10028458 3300013307 Bacteria 6099
224 Ga0157372_10045541 3300013307 Bacteria 4867
225 Ga0157372_10116456 3300013307 Unclassified 3064
226 Ga0157372_10229963 3300013307 Bacteria 2150
227 Ga0157375_10055990 3300013308 Bacteria 3891
228 Ga0163163_10013137 3300014325 Bacteria 7567
229 Ga0163163_10035017 3300014325 Bacteria 4868
230 Ga0157377_10043589 3300014745 Bacteria 2497
231 Ga0157379_10002438 3300014968 Bacteria 15569
232 Ga0157376_10025014 3300014969 Bacteria 4697
233 Ga0157376_10040421 3300014969 Bacteria 3811
234 Ga0163161_10021178 3300017792 Bacteria 4571
235 Ga0213873_10029386 3300021358 Unclassified 1354
236 Ga0224570_101002 3300022730 Bacteria 2224
237 Ga0224572_1004194 3300024225 Bacteria 2492
238 Ga0207692_10001160 3300025898 Bacteria 9728
239 Ga0207692_10025318 3300025898 Bacteria 2770
240 Ga0207692_10089591 3300025898 Bacteria 1665
241 Ga0207688_10028280 3300025901 Bacteria 3084
242 Ga0207680_10091772 3300025903 Bacteria 1933
243 Ga0207647_10005883 3300025904 Bacteria 8937
244 Ga0207647_10041764 3300025904 Bacteria 2882
245 Ga0207699_10018795 3300025906 Bacteria 3670
246 Ga0207699_10043379 3300025906 Unclassified 2612
247 Ga0207699_10143588 3300025906 Bacteria 1571
248 Ga0207645_10000551 3300025907 Bacteria 31119
249 Ga0207643_10008703 3300025908 Bacteria 5443
250 Ga0207684_10002771 3300025910 Bacteria 17451
251 Ga0207684_10003513 3300025910 Bacteria 15292
252 Ga0207684_10008622 3300025910 Bacteria 9059
253 Ga0207654_10029158 3300025911 Bacteria 3017
254 Ga0207654_10167939 3300025911 Bacteria 1422
255 Ga0207707_10029553 3300025912 Bacteria 4793
256 Ga0207707_10056523 3300025912 Bacteria 3414
257 Ga0207707_10107169 3300025912 Bacteria 2443
258 Ga0207707_10165143 3300025912 Bacteria 1935
259 Ga0207695_10016407 3300025913 Bacteria 8665
260 Ga0207695_10020145 3300025913 Bacteria 7649
261 Ga0207695_10092676 3300025913 Bacteria 3031
262 Ga0207671_10009068 3300025914 Bacteria 8362
263 Ga0207693_10000010 3300025915 Bacteria 162031
264 Ga0207693_10000076 3300025915 Bacteria 88185
265 Ga0207693_10000689 3300025915 Bacteria 30320
266 Ga0207693_10003255 3300025915 Bacteria 13927
267 Ga0207693_10009791 3300025915 Bacteria 7801
268 Ga0207693_10012836 3300025915 Bacteria 6758
269 Ga0207693_10014425 3300025915 Bacteria 6354
270 Ga0207693_10018371 3300025915 Bacteria 5569
271 Ga0207693_10028964 3300025915 Bacteria 4377
272 Ga0207663_10000541 3300025916 Bacteria 16618
273 Ga0207663_10001822 3300025916 Bacteria 10047
274 Ga0207663_10005938 3300025916 Bacteria 6197
275 Ga0207663_10035006 3300025916 Bacteria 3009
276 Ga0207663_10112999 3300025916 Unclassified 1846
277 Ga0207663_10127010 3300025916 Bacteria 1756
278 Ga0207660_10094862 3300025917 Bacteria 2218
279 Ga0207662_10013830 3300025918 Bacteria 4517
280 Ga0207662_10135017 3300025918 Bacteria 1559
281 Ga0207657_10006439 3300025919 Bacteria 12168
282 Ga0207657_10009009 3300025919 Bacteria 10078
283 Ga0207649_10000546 3300025920 Bacteria 26008
284 Ga0207649_10026232 3300025920 Bacteria 3407
285 Ga0207652_10134883 3300025921 Bacteria 2204
286 Ga0207652_10176635 3300025921 Bacteria 1918
287 Ga0207646_10002047 3300025922 Bacteria 24227
288 Ga0207646_10004789 3300025922 Bacteria 14527
289 Ga0207646_10016435 3300025922 Bacteria 6943
290 Ga0207646_10036812 3300025922 Bacteria 4416
291 Ga0207646_10296621 3300025922 Unclassified 1460
292 Ga0207646_10343593 3300025922 Bacteria 1348
293 Ga0207646_10344776 3300025922 Unclassified 1346
294 Ga0207694_10043723 3300025924 Bacteria 3457
295 Ga0207694_10275451 3300025924 Bacteria 1381
296 Ga0207650_10000045 3300025925 Bacteria 181507
297 Ga0207687_10002372 3300025927 Bacteria 12792
298 Ga0207700_10000121 3300025928 Bacteria 46080
299 Ga0207700_10003745 3300025928 Bacteria 8878
300 Ga0207700_10042219 3300025928 Unclassified 3342
301 Ga0207700_10058503 3300025928 Bacteria 2912
302 Ga0207700_10250586 3300025928 Bacteria 1513
303 Ga0207664_10000084 3300025929 Bacteria 93564
304 Ga0207664_10158751 3300025929 Bacteria 1927
305 Ga0207706_10001085 3300025933 Bacteria 27637
306 Ga0207706_10049890 3300025933 Bacteria 3699
307 Ga0207709_10155989 3300025935 Bacteria 1587
308 Ga0207704_10243900 3300025938 Bacteria 1344
309 Ga0207665_10001046 3300025939 Bacteria 18599
310 Ga0207665_10003917 3300025939 Bacteria 9965
311 Ga0207665_10006547 3300025939 Bacteria 7723
312 Ga0207665_10015107 3300025939 Bacteria 5070
313 Ga0207665_10081098 3300025939 Unclassified 2233
314 Ga0207711_10018805 3300025941 Bacteria 5744
315 Ga0207689_10000185 3300025942 Bacteria 54094
316 Ga0207661_10000131 3300025944 Bacteria 47673
317 Ga0207661_10332171 3300025944 Bacteria 1368
318 Ga0207679_10000283 3300025945 Bacteria 38405
319 Ga0207679_10024134 3300025945 Bacteria 4166
320 Ga0207667_10034349 3300025949 Bacteria 5446
321 Ga0207667_10053004 3300025949 Bacteria 4269
322 Ga0207667_10063402 3300025949 Bacteria 3862
323 Ga0207712_10037780 3300025961 Bacteria 3297
324 Ga0207668_10226584 3300025972 Bacteria 1504
325 Ga0207640_10150008 3300025981 Bacteria 1711
326 Ga0207677_10012304 3300026023 Bacteria 4913
327 Ga0207703_10025452 3300026035 Unclassified 4654
328 Ga0207639_10013564 3300026041 Bacteria 5709
329 Ga0207639_10035925 3300026041 Bacteria 3669
330 Ga0207678_10001488 3300026067 Bacteria 21502
331 Ga0207702_10003772 3300026078 Bacteria 13688
332 Ga0207702_10093496 3300026078 Bacteria 2637
333 Ga0207702_10154473 3300026078 Bacteria 2091
334 Ga0207702_10328374 3300026078 Unclassified 1458
335 Ga0207641_10000021 3300026088 Bacteria 279851
336 Ga0207641_10049472 3300026088 Unclassified 3552
337 Ga0207648_10000611 3300026089 Bacteria 40065
338 Ga0207648_10014438 3300026089 Bacteria 7300
339 Ga0207676_10000096 3300026095 Bacteria 80353
340 Ga0207674_10000246 3300026116 Bacteria 67486
341 Ga0207674_10153214 3300026116 Bacteria 2261
342 Ga0207675_100007864 3300026118 Bacteria 10061
343 Ga0207683_10001457 3300026121 Bacteria 21339
344 Ga0207683_10059357 3300026121 Bacteria 3360
345 Ga0207698_10034788 3300026142 Bacteria 3677
346 Ga0207698_10363986 3300026142 Bacteria 1370
347 Ga0268266_10074347 3300028379 Unclassified 2950
348 Ga0268265_10003076 3300028380 Bacteria 12174
349 Ga0268265_10032089 3300028380 Bacteria 3801
350 Ga0268265_10181148 3300028380 Bacteria 1810
351 Ga0268264_10053472 3300028381 Bacteria 3369
352 Ga0268264_10197860 3300028381 Unclassified 1836
353 Ga0265338_10001963 3300028800 Bacteria 32066
354 Ga0265762_1000287 3300030760 Bacteria 8442
355 Ga0265762_1000781 3300030760 Bacteria 5691
356 Ga0265762_1008189 3300030760 Bacteria 1860
357 Ga0265760_10001472 3300031090 Bacteria 6935
358 Ga0265760_10003647 3300031090 Bacteria 4465
359 Ga0265760_10006548 3300031090 Bacteria 3332
360 Ga0265760_10015443 3300031090 Bacteria 2189
361 Ga0265325_10069924 3300031241 Bacteria 1764
362 Ga0265339_10005262 3300031249 Bacteria 8634
363 Ga0265339_10011964 3300031249 Bacteria 5317
364 Ga0265339_10073582 3300031249 Bacteria 1817
365 Ga0265342_10082308 3300031712 Bacteria 1857
366 Ga0373930_0003904 3300034816 Bacteria 2394
367 Ga0373926_0000675 3300035083 Bacteria 9381
368 Ga0373926_0002982 3300035083 Bacteria 5413
369 Ga0373926_0003341 3300035083 Bacteria 5162
370 Ga0373923_0029574 3300035111 Bacteria 2198
371 Ga0373936_0002287 3300035113 Bacteria 7173
372 Ga0373945_0001150 3300035116 Bacteria 8019
373 Ga0373953_0020813 3300035117 Bacteria 2454
374 Ga0373954_0010205 3300035118 Bacteria 4140
375 Ga0373956_0019173 3300035119 Bacteria 2900
376 Ga0373956_0020508 3300035119 Bacteria 2813
377 Ga0373957_0020335 3300035120 Bacteria 2344
378 Ga0373943_0000009 3300035170 Bacteria 67175
379 Ga0373943_0001291 3300035170 Bacteria 11240
380 Ga0373943_0010538 3300035170 Bacteria 4143
381 Ga0373946_0000821 3300035171 Bacteria 10594
382 Ga0373946_0005007 3300035171 Bacteria 4771
383 Ga0373955_0007147 3300035172 Bacteria 5117
384 Ga0373961_0041897 3300035241 Bacteria 1325
385 Ga0373924_0010551 3300035410 Bacteria 3411
386 Ga0373924_0050971 3300035410 Bacteria 1715
387 Ga0373931_0008667 3300035691 Unclassified 4835
388 Ga0373931_0042914 3300035691 Bacteria 2379
389 Ga0373935_0003495 3300035692 Bacteria 9136
390 Ga0373935_0009673 3300035692 Bacteria 5769
391 Ga0373935_0049204 3300035692 Bacteria 2671
392 Ga0373935_0134995 3300035692 Bacteria 1662
393 Ga0373935_0210114 3300035692 Bacteria 1348
394 Ga0373927_0000539 3300035695 Bacteria 28719
395 Ga0373927_0004411 3300035695 Bacteria 9864
396 Ga0373927_0017759 3300035695 Bacteria 4681
397 Ga0373927_0128395 3300035695 Bacteria 1656
398 Ga0373933_0004057 3300035724 Bacteria 8071
399 Ga0373933_0076314 3300035724 Bacteria 2047
400 Ga0373933_0258742 3300035724 Bacteria 1122
401 Ga0373947_0005058 3300035725 Bacteria 7723
402 Ga0373947_0007151 3300035725 Bacteria 6471
403 Ga0373947_0027616 3300035725 Bacteria 3322
404 Ga0373937_0000199 3300036401 Bacteria 58972
405 Ga0373937_0021728 3300036401 Bacteria 5760
406 Ga0373937_0036227 3300036401 Bacteria 4495
407 Ga0373937_0088904 3300036401 Bacteria 2860
408 Ga0373925_0005162 3300037068 Bacteria 9784
409 Ga0373925_0007548 3300037068 Bacteria 7925
410 Ga0373925_0017483 3300037068 Bacteria 5198
411 Ga0373925_0023346 3300037068 Bacteria 4513
412 Ga0373925_0138644 3300037068 Bacteria 1902
413 Ga0436363_0221864 3300039450 Bacteria 4303
414 Ga0436363_1333267 3300039450 Bacteria 1436
415 Ga0436362_0199515 3300039453 Bacteria 5047
416 Ga0466957_0000211 3300044842 Bacteria 27323
417 Ga0451576_0159283 3300045051 Bacteria 2355
418 Ga0466967_0095324 3300045976 Bacteria 2712
419 Ga0466967_0142673 3300045976 Bacteria 2232
420 Ga0495629_0008433 3300046459 Bacteria 7586
421 Ga0495651_0080475 3300046462 Bacteria 2461
422 Ga0495651_0080844 3300046462 Bacteria 2454
423 Ga0495651_0081819 3300046462 Unclassified 2437
424 Ga0495580_0001237 3300046472 Bacteria 22525
425 Ga0495580_0002538 3300046472 Bacteria 15898
426 Ga0495580_0004308 3300046472 Bacteria 11967
427 Ga0495580_0005568 3300046472 Bacteria 10385
428 Ga0495580_0061504 3300046472 Bacteria 2637
429 Ga0495582_0009610 3300046473 Bacteria 5325
430 Ga0495662_0104820 3300046476 Bacteria 1384
431 Ga0495628_0031761 3300046516 Bacteria 4269
432 Ga0495630_0050853 3300046517 Bacteria 3101
433 Ga0495630_0150436 3300046517 Bacteria 1771
434 Ga0495642_0094210 3300046528 Bacteria 1270
435 Ga0495665_0015425 3300046531 Bacteria 4114
436 Ga0495613_0045518 3300046689 Bacteria 3245
437 Ga0495624_0108791 3300046690 Bacteria 1705
438 Ga0495581_0042774 3300047315 Bacteria 2622
439 Ga0495581_0069621 3300047315 Bacteria 2035
440 Ga0495581_0069669 3300047315 Bacteria 2034
441 Ga0495604_0025093 3300047317 Bacteria 4751
442 Ga0495604_0125688 3300047317 Bacteria 1849
443 Ga0495674_0002665 3300047319 Bacteria 17375
444 Ga0495684_0218452 3300047471 Bacteria 1399
445 Ga0495602_0035756 3300048088 Bacteria 4629
446 Ga0495602_0059860 3300048088 Bacteria 3322
447 Ga0496100_0002390 3300048903 Bacteria 9503
448 Ga0496100_0075560 3300048903 Bacteria 2260
449 Ga0496101_0236457 3300048904 Bacteria 1421
450 Ga0496101_0359963 3300048904 Bacteria 1144
451 Ga0496102_0009005 3300048905 Bacteria 8568
452 Ga0496102_0046596 3300048905 Bacteria 3938
453 Ga0496102_0098797 3300048905 Bacteria 2709
454 Ga0496102_0323181 3300048905 Bacteria 1453
455 Ga0496103_0042895 3300048906 Bacteria 2785
456 Ga0496103_0142092 3300048906 Unclassified 1536
457 Ga0496104_0015789 3300048907 Bacteria 6850
458 Ga0496104_0151506 3300048907 Bacteria 2226
459 Ga0496104_0189269 3300048907 Unclassified 1969
460 Ga0496105_0001615 3300048908 Bacteria 15999
461 Ga0496105_0342972 3300048908 Bacteria 1194
462 Ga0496106_0074239 3300048909 Bacteria 2603
463 Ga0496107_0090846 3300048910 Bacteria 2231
464 Ga0496108_0000605 3300048911 Bacteria 28095
465 Ga0496109_0000749 3300048912 Bacteria 27009
466 Ga0496109_0227376 3300048912 Bacteria 1755
467 Ga0496109_0342466 3300048912 Bacteria 1412
468 Ga0496110_0023738 3300048913 Bacteria 5219
469 Ga0496110_0026763 3300048913 Bacteria 4939
470 Ga0496110_0152833 3300048913 Bacteria 2090
471 Ga0496111_0001384 3300048914 Bacteria 13768
472 Ga0496111_0022053 3300048914 Bacteria 4454
473 Ga0496111_0278322 3300048914 Bacteria 1241
474 Ga0496111_0294727 3300048914 Bacteria 1203
475 Ga0496112_0000464 3300048915 Bacteria 27058
476 Ga0496112_0003191 3300048915 Bacteria 13485
477 Ga0496112_0075013 3300048915 Bacteria 3345
478 Ga0496112_0084416 3300048915 Unclassified 3141
479 Ga0496113_0000468 3300048916 Bacteria 19787
480 Ga0496113_0001193 3300048916 Bacteria 14220
481 Ga0496114_0301398 3300048917 Bacteria 1415
482 Ga0501073_0099550 3300049589 Bacteria 2018
483 nmdc:mga05p37_85605_c1 3300050507 Bacteria 3884
484 nmdc:mga0n895_194_c1 3300050512 Bacteria 37839
485 nmdc:mga0n895_2844_c1 3300050512 Bacteria 13712
486 nmdc:mga0n895_361779_c1 3300050512 Bacteria 1469
487 nmdc:mga0rr50_1647_c1 3300050513 Bacteria 12304
488 nmdc:mga0rr50_211268_c1 3300050513 Bacteria 1599
489 nmdc:mga0rr50_214588_c1 3300050513 Bacteria 1587
490 nmdc:mga0rr50_410_c1 3300050513 Bacteria 23330
491 nmdc:mga08x19_13769_c1 3300050514 Bacteria 4897
492 nmdc:mga08x19_2349_c1 3300050514 Bacteria 11485
493 nmdc:mga08x19_43251_c1 3300050514 Bacteria 2874
494 nmdc:mga0a205_11064_c1 3300050515 Bacteria 6692
495 nmdc:mga0a205_20440_c1 3300050515 Bacteria 6246
496 Ga0495601_0004386 3300053077 Bacteria 8152
497 Ga0495601_0040404 3300053077 Bacteria 2921
498 Ga0495619_0047864 3300053085 Bacteria 2817
499 Ga0501082_0206562 3300060353 Bacteria 1709
500 Ga0068856_100062916
501 MBSR1b_contig_12822335
502 MBSR1b_contig_5450740
503 LJNas_1000068
504 Ga0070658_10026806
505 Ga0070683_100109120
506 Ga0070690_100047491
507 Ga0070690_100089918
508 Ga0068869_100012038
509 Ga0068869_100040848
510 Ga0070680_100052284
511 Ga0070680_100086423
512 Ga0070682_100002535
513 Ga0068868_100026143
514 Ga0068868_100087659
515 Ga0070691_10039680
516 Ga0070687_100050932
517 Ga0070661_100019010
518 Ga0070661_100026967
519 Ga0070668_100008093
520 Ga0070668_100228397
521 Ga0070675_100098033
522 Ga0070675_100361944
523 Ga0070673_100100224
524 Ga0070659_100044343
525 Ga0070667_100012738
526 Ga0070709_10001122
527 Ga0070709_10023190
528 Ga0070709_10042822
529 Ga0070709_10045730
530 Ga0070709_10068346
531 Ga0070709_10175466
532 Ga0070714_100000069
533 Ga0070714_100010671
534 Ga0070714_100147122
535 Ga0070714_100159158
536 Ga0070714_100265259
537 Ga0070713_100000432
538 Ga0070713_100018623
539 Ga0070713_100024471
540 Ga0070713_100035662
541 Ga0070713_100107554
542 Ga0070713_100141614
543 Ga0070713_100183258
544 Ga0070713_100209972
545 Ga0070713_100372174
546 Ga0070710_10002730
547 Ga0070710_10026016
548 Ga0070710_10064174
549 Ga0070711_100000340
550 Ga0070711_100001263
551 Ga0070711_100008309
552 Ga0070711_100029375
553 Ga0070711_100045716
554 Ga0070711_100059564
555 Ga0070711_100105723
556 Ga0070711_100158733
557 Ga0070708_100001602
558 Ga0070708_100003146
559 Ga0070708_100003488
560 Ga0070708_100003966
561 Ga0070708_100004955
562 Ga0070708_100012272
563 Ga0070708_100019629
564 Ga0070708_100104328
565 Ga0070663_100016064
566 Ga0070678_100265020
567 Ga0070662_100002565
568 Ga0070681_10011813
569 Ga0070681_10018554
570 Ga0070681_10200985
571 Ga0068867_100016423
572 Ga0070706_100000499
573 Ga0070706_100006009
574 Ga0070706_100014536
575 Ga0070706_100075763
576 Ga0070707_100006096
577 Ga0070707_100009701
578 Ga0070707_100029235
579 Ga0070707_100041410
580 Ga0070707_100043220
581 Ga0070707_100070689
582 Ga0070707_100209128
583 Ga0070698_100001333
584 Ga0070698_100013058
585 Ga0070698_100037641
586 Ga0070699_100001027
587 Ga0070699_100008978
588 Ga0070699_100016909
589 Ga0070699_100135698
590 Ga0070679_100077165
591 Ga0070679_100096350
592 Ga0070697_100000237
593 Ga0070697_100003028
594 Ga0070697_100008934
595 Ga0070697_100010357
596 Ga0070697_100010690
597 Ga0070697_100012360
598 Ga0070697_100055702
599 Ga0070697_100115647
600 Ga0070697_100154329
601 Ga0068853_100003306
602 Ga0068853_100025074
603 Ga0068853_100285645
604 Ga0070672_100003170
605 Ga0070686_100070186
606 Ga0070686_100171272
607 Ga0070695_100049309
608 Ga0070695_100089117
609 Ga0070696_100142619
610 Ga0068855_100271050
611 Ga0068855_100455208
612 Ga0070664_100065697
613 Ga0070664_100240420
614 Ga0068857_100014159
615 Ga0068856_100002427
616 Ga0068856_100165732
617 Ga0068856_100210933
618 Ga0070702_100110922
619 Ga0068852_100008868
620 Ga0068852_100029894
621 Ga0068859_100025551
622 Ga0068859_100029696
623 Ga0068866_10087775
624 Ga0068861_100186701
625 Ga0068851_10010754
626 Ga0068851_10034967
627 Ga0068870_10008583
628 Ga0068863_100034249
629 Ga0068863_100038879
630 Ga0068858_100014582
631 Ga0068858_100061857
632 Ga0068860_100017651
633 Ga0068862_100010972
634 Ga0070717_10000774
635 Ga0070717_10001917
636 Ga0070717_10001986
637 Ga0070717_10003179
638 Ga0070717_10007845
639 Ga0070717_10009302
640 Ga0070717_10021908
641 Ga0070717_10052237
642 Ga0070717_10095823
643 Ga0070717_10100677
644 Ga0070715_10005270
645 Ga0070715_10011966
646 Ga0070716_100000792
647 Ga0070716_100005146
648 Ga0070716_100009498
649 Ga0070716_100010634
650 Ga0070712_100000042
651 Ga0070712_100000192
652 Ga0070712_100029040
653 Ga0070712_100032630
654 Ga0070712_100032679
655 Ga0070712_100064166
656 Ga0097621_100018541
657 Ga0097621_100059626
658 Ga0068871_100001484
659 Ga0068871_100036565
660 Ga0068871_100064375
661 Ga0075433_10026059
662 Ga0075434_100005455
663 Ga0075434_100204443
664 Ga0075434_100402831
665 Ga0068865_100079922
666 Ga0075436_100002929
667 Ga0097620_100025552
668 Ga0097620_100029691
669 Ga0075435_100000170
670 Ga0075435_100228366
671 Ga0099794_10105742
672 Ga0105240_10005223
673 Ga0105240_10046039
674 Ga0105240_10101953
675 Ga0105240_10136094
676 Ga0105240_10154676
677 Ga0105245_10033558
678 Ga0105245_10083732
679 Ga0105245_10097855
680 Ga0105247_10030045
681 Ga0105247_10153663
682 Ga0114129_10014271
683 Ga0105243_10015615
684 Ga0105241_10096119
685 Ga0105241_10194882
686 Ga0105242_10011382
687 Ga0105242_10021426
688 Ga0105248_10048797
689 Ga0105248_10075358
690 Ga0105237_10396507
691 Ga0105238_10011948
692 Ga0105238_10029280
693 Ga0105238_10036031
694 Ga0105238_10063589
695 Ga0105238_10266380
696 Ga0105249_10032850
697 Ga0105239_10007204
698 Ga0105239_10031937
699 Ga0105246_10007535
700 Ga0105246_10009350
701 Ga0157371_10011908
702 Ga0157371_10056494
703 Ga0157370_10168116
704 Ga0157369_10044962
705 Ga0157369_10154214
706 Ga0157369_10211718
707 Ga0157374_10003563
708 Ga0157374_10018844
709 Ga0157374_10027772
710 Ga0157374_10055042
711 Ga0157374_10164435
712 Ga0157374_10238831
713 Ga0157374_10437658
714 Ga0157378_10004484
715 Ga0157378_10010895
716 Ga0157378_10088145
717 Ga0163162_10013577
718 Ga0163162_10054581
719 Ga0163162_10183959
720 Ga0157372_10003854
721 Ga0157372_10022731
722 Ga0157372_10028458
723 Ga0157372_10045541
724 Ga0157372_10116456
725 Ga0157372_10229963
726 Ga0157375_10055990
727 Ga0163163_10013137
728 Ga0163163_10035017
729 Ga0157377_10043589
730 Ga0157379_10002438
731 Ga0157376_10025014
732 Ga0157376_10040421
733 Ga0163161_10021178
734 Ga0213873_10029386
735 Ga0224570_101002
736 Ga0224572_1004194
737 Ga0207692_10001160
738 Ga0207692_10025318
739 Ga0207692_10089591
740 Ga0207688_10028280
741 Ga0207680_10091772
742 Ga0207647_10005883
743 Ga0207647_10041764
744 Ga0207699_10018795
745 Ga0207699_10043379
746 Ga0207699_10143588
747 Ga0207645_10000551
748 Ga0207643_10008703
749 Ga0207684_10002771
750 Ga0207684_10003513
751 Ga0207684_10008622
752 Ga0207654_10029158
753 Ga0207654_10167939
754 Ga0207707_10029553
755 Ga0207707_10056523
756 Ga0207707_10107169
757 Ga0207707_10165143
758 Ga0207695_10016407
759 Ga0207695_10020145
760 Ga0207695_10092676
761 Ga0207671_10009068
762 Ga0207693_10000010
763 Ga0207693_10000076
764 Ga0207693_10000689
765 Ga0207693_10003255
766 Ga0207693_10009791
767 Ga0207693_10012836
768 Ga0207693_10014425
769 Ga0207693_10018371
770 Ga0207693_10028964
771 Ga0207663_10000541
772 Ga0207663_10001822
773 Ga0207663_10005938
774 Ga0207663_10035006
775 Ga0207663_10112999
776 Ga0207663_10127010
777 Ga0207660_10094862
778 Ga0207662_10013830
779 Ga0207662_10135017
780 Ga0207657_10006439
781 Ga0207657_10009009
782 Ga0207649_10000546
783 Ga0207649_10026232
784 Ga0207652_10134883
785 Ga0207652_10176635
786 Ga0207646_10002047
787 Ga0207646_10004789
788 Ga0207646_10016435
789 Ga0207646_10036812
790 Ga0207646_10296621
791 Ga0207646_10343593
792 Ga0207646_10344776
793 Ga0207694_10043723
794 Ga0207694_10275451
795 Ga0207650_10000045
796 Ga0207687_10002372
797 Ga0207700_10000121
798 Ga0207700_10003745
799 Ga0207700_10042219
800 Ga0207700_10058503
801 Ga0207700_10250586
802 Ga0207664_10000084
803 Ga0207664_10158751
804 Ga0207706_10001085
805 Ga0207706_10049890
806 Ga0207709_10155989
807 Ga0207704_10243900
808 Ga0207665_10001046
809 Ga0207665_10003917
810 Ga0207665_10006547
811 Ga0207665_10015107
812 Ga0207665_10081098
813 Ga0207711_10018805
814 Ga0207689_10000185
815 Ga0207661_10000131
816 Ga0207661_10332171
817 Ga0207679_10000283
818 Ga0207679_10024134
819 Ga0207667_10034349
820 Ga0207667_10053004
821 Ga0207667_10063402
822 Ga0207712_10037780
823 Ga0207668_10226584
824 Ga0207640_10150008
825 Ga0207677_10012304
826 Ga0207703_10025452
827 Ga0207639_10013564
828 Ga0207639_10035925
829 Ga0207678_10001488
830 Ga0207702_10003772
831 Ga0207702_10093496
832 Ga0207702_10154473
833 Ga0207702_10328374
834 Ga0207641_10000021
835 Ga0207641_10049472
836 Ga0207648_10000611
837 Ga0207648_10014438
838 Ga0207676_10000096
839 Ga0207674_10000246
840 Ga0207674_10153214
841 Ga0207675_100007864
842 Ga0207683_10001457
843 Ga0207683_10059357
844 Ga0207698_10034788
845 Ga0207698_10363986
846 Ga0268266_10074347
847 Ga0268265_10003076
848 Ga0268265_10032089
849 Ga0268265_10181148
850 Ga0268264_10053472
851 Ga0268264_10197860
852 Ga0265338_10001963
853 Ga0265762_1000287
854 Ga0265762_1000781
855 Ga0265762_1008189
856 Ga0265760_10001472
857 Ga0265760_10003647
858 Ga0265760_10006548
859 Ga0265760_10015443
860 Ga0265325_10069924
861 Ga0265339_10005262
862 Ga0265339_10011964
863 Ga0265339_10073582
864 Ga0265342_10082308
865 Ga0373930_0003904
866 Ga0373926_0000675
867 Ga0373926_0002982
868 Ga0373926_0003341
869 Ga0373923_0029574
870 Ga0373936_0002287
871 Ga0373945_0001150
872 Ga0373953_0020813
873 Ga0373954_0010205
874 Ga0373956_0019173
875 Ga0373956_0020508
876 Ga0373957_0020335
877 Ga0373943_0000009
878 Ga0373943_0001291
879 Ga0373943_0010538
880 Ga0373946_0000821
881 Ga0373946_0005007
882 Ga0373955_0007147
883 Ga0373961_0041897
884 Ga0373924_0010551
885 Ga0373924_0050971
886 Ga0373931_0008667
887 Ga0373931_0042914
888 Ga0373935_0003495
889 Ga0373935_0009673
890 Ga0373935_0049204
891 Ga0373935_0134995
892 Ga0373935_0210114
893 Ga0373927_0000539
894 Ga0373927_0004411
895 Ga0373927_0017759
896 Ga0373927_0128395
897 Ga0373933_0004057
898 Ga0373933_0076314
899 Ga0373933_0258742
900 Ga0373947_0005058
901 Ga0373947_0007151
902 Ga0373947_0027616
903 Ga0373937_0000199
904 Ga0373937_0021728
905 Ga0373937_0036227
906 Ga0373937_0088904
907 Ga0373925_0005162
908 Ga0373925_0007548
909 Ga0373925_0017483
910 Ga0373925_0023346
911 Ga0373925_0138644
912 Ga0436363_0221864
913 Ga0436363_1333267
914 Ga0436362_0199515
915 Ga0466957_0000211
916 Ga0451576_0159283
917 Ga0466967_0095324
918 Ga0466967_0142673
919 Ga0495629_0008433
920 Ga0495651_0080475
921 Ga0495651_0080844
922 Ga0495651_0081819
923 Ga0495580_0001237
924 Ga0495580_0002538
925 Ga0495580_0004308
926 Ga0495580_0005568
927 Ga0495580_0061504
928 Ga0495582_0009610
929 Ga0495662_0104820
930 Ga0495628_0031761
931 Ga0495630_0050853
932 Ga0495630_0150436
933 Ga0495642_0094210
934 Ga0495665_0015425
935 Ga0495613_0045518
936 Ga0495624_0108791
937 Ga0495581_0042774
938 Ga0495581_0069621
939 Ga0495581_0069669
940 Ga0495604_0025093
941 Ga0495604_0125688
942 Ga0495674_0002665
943 Ga0495684_0218452
944 Ga0495602_0035756
945 Ga0495602_0059860
946 Ga0496100_0002390
947 Ga0496100_0075560
948 Ga0496101_0236457
949 Ga0496101_0359963
950 Ga0496102_0009005
951 Ga0496102_0046596
952 Ga0496102_0098797
953 Ga0496102_0323181
954 Ga0496103_0042895
955 Ga0496103_0142092
956 Ga0496104_0015789
957 Ga0496104_0151506
958 Ga0496104_0189269
959 Ga0496105_0001615
960 Ga0496105_0342972
961 Ga0496106_0074239
962 Ga0496107_0090846
963 Ga0496108_0000605
964 Ga0496109_0000749
965 Ga0496109_0227376
966 Ga0496109_0342466
967 Ga0496110_0023738
968 Ga0496110_0026763
969 Ga0496110_0152833
970 Ga0496111_0001384
971 Ga0496111_0022053
972 Ga0496111_0278322
973 Ga0496111_0294727
974 Ga0496112_0000464
975 Ga0496112_0003191
976 Ga0496112_0075013
977 Ga0496112_0084416
978 Ga0496113_0000468
979 Ga0496113_0001193
980 Ga0496114_0301398
981 Ga0501073_0099550
982 nmdc:mga05p37_85605_c1
983 nmdc:mga0n895_194_c1
984 nmdc:mga0n895_2844_c1
985 nmdc:mga0n895_361779_c1
986 nmdc:mga0rr50_1647_c1
987 nmdc:mga0rr50_211268_c1
988 nmdc:mga0rr50_214588_c1
989 nmdc:mga0rr50_410_c1
990 nmdc:mga08x19_13769_c1
991 nmdc:mga08x19_2349_c1
992 nmdc:mga08x19_43251_c1
993 nmdc:mga0a205_11064_c1
994 nmdc:mga0a205_20440_c1
995 Ga0495601_0004386
996 Ga0495601_0040404
997 Ga0495619_0047864
998 Ga0501082_0206562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01761

DHQ_synthase

3-dehydroquinate synthase

126

240

0.98

PF24621

241

383

0.94

PF00465

Fe-ADH

Iron-containing alcohol dehydrogenase

70

227

0.79

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

73

232

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eks-assembly3.cif.gz_A structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with nad 0.9478 1 360
3okf-assembly1.cif.gz_B 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae 0.9429 1 361
3zok-assembly2.cif.gz_C structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad 0.9396 1 359
6lk2-assembly1.cif.gz_C crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9382 1 355
6lk2-assembly2.cif.gz_D crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9381 1 355
ID Description Score Start End Superfamily
af_A0A1D6IPW7_249_439_1.20.1090.10 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9455 175 359 1.20.1090.10
af_A0A0R0HLZ4_60_246_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9401 2 174 3.40.50.1970
1xahB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9271 2 174 3.40.50.1970
5hvnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9242 2 168 3.40.50.1970
3okfB02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9234 175 361 1.20.1090.10
ID Description Score Start End GO Terms
AF-A0A2V9V4B2-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9902 2 278 GO:0003856
GO:0005737
GO:0008652
GO:0009073
GO:0009423
GO:0016020
AF-A0A2W0BWE3-F1-model_v4 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4) 0.9866 1 365 GO:0000166
GO:0003856
GO:0005737
GO:0008652
GO:0009073
GO:0009423
GO:0016020
GO:0046872
AF-A0A2V9YNC5-F1-model_v4 3-dehydroquinate synthase 0.9822 4 101 GO:0003856
GO:0009073
AF-A0A7C1JBI9-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9795 1 249 GO:0003856
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-X1HFU3-F1-model_v4 3-dehydroquinate synthase domain-containing protein 0.9791 137 277 GO:0003856
GO:0009073

Map