F455201

General Info

Members Datasets Scaffolds Average Seq Length
498 215 996 108

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_11290425|Ga0207663_112904251
Length 130
Sequence MNVDAARRRRALRWCWQPNMARPSIAPEAEVVEHEAIVPLYRVVLLDDNDHTYDYVIEMLQKIFIFSMDQAYRHAEEVDTAGRTVLITCGLPEAEFARDQIHAYGPDWRLPRSKGSMSAVVEPACAGESR

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.2
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 35.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_11290425 3300025916 Unclassified 588
2 Ga0070658_10001230 3300005327 Bacteria 21953
3 Ga0070658_10040855 3300005327 Unclassified 3743
4 Ga0070658_10104257 3300005327 Bacteria 2346
5 Ga0070658_10393456 3300005327 Bacteria 1190
6 Ga0070658_10456588 3300005327 Bacteria 1101
7 Ga0070658_10564979 3300005327 Bacteria 985
8 Ga0070676_10707541 3300005328 Bacteria 736
9 Ga0070683_100000014 3300005329 Bacteria 221422
10 Ga0070683_100142239 3300005329 Bacteria 2273
11 Ga0070683_100479306 3300005329 Unclassified 1188
12 Ga0070683_101430688 3300005329 Unclassified 664
13 Ga0070690_100298028 3300005330 Bacteria 1155
14 Ga0070690_100759902 3300005330 Unclassified 749
15 Ga0070670_100256456 3300005331 Bacteria 1524
16 Ga0070666_10280016 3300005335 Bacteria 1185
17 Ga0070666_10478081 3300005335 Unclassified 902
18 Ga0070680_100054576 3300005336 Bacteria 3263
19 Ga0070680_100205830 3300005336 Bacteria 1660
20 Ga0070680_100453668 3300005336 Bacteria 1095
21 Ga0070680_100771466 3300005336 Bacteria 828
22 Ga0070682_101418480 3300005337 Bacteria 594
23 Ga0070682_101780389 3300005337 Bacteria 537
24 Ga0070660_100500111 3300005339 Bacteria 1011
25 Ga0070660_100587982 3300005339 Unclassified 930
26 Ga0070689_100119691 3300005340 Bacteria 2102
27 Ga0070691_10889791 3300005341 Unclassified 548
28 Ga0070692_10932822 3300005345 Unclassified 602
29 Ga0070668_100746084 3300005347 Bacteria 866
30 Ga0070675_100269758 3300005354 Bacteria 1493
31 Ga0070671_101305800 3300005355 Bacteria 640
32 Ga0070671_101646196 3300005355 Bacteria 569
33 Ga0070673_100368151 3300005364 Bacteria 1279
34 Ga0070688_100114655 3300005365 Bacteria 1797
35 Ga0070659_100227073 3300005366 Bacteria 1542
36 Ga0070667_101491093 3300005367 Bacteria 635
37 Ga0070667_102153685 3300005367 Unclassified 525
38 Ga0070709_10312255 3300005434 Bacteria 1151
39 Ga0070714_100036320 3300005435 Bacteria 4132
40 Ga0070710_11274043 3300005437 Unclassified 546
41 Ga0070701_10269531 3300005438 Bacteria 1035
42 Ga0070711_100279011 3300005439 Unclassified 1321
43 Ga0070711_100501327 3300005439 Unclassified 1001
44 Ga0070711_100803033 3300005439 Bacteria 798
45 Ga0070694_100138238 3300005444 Bacteria 1767
46 Ga0070694_100269728 3300005444 Bacteria 1294
47 Ga0070708_100256575 3300005445 Bacteria 1643
48 Ga0070708_100908014 3300005445 Bacteria 827
49 Ga0070678_100810112 3300005456 Bacteria 851
50 Ga0070681_10019557 3300005458 Bacteria 6780
51 Ga0070681_10056508 3300005458 Bacteria 3906
52 Ga0070681_10300919 3300005458 Bacteria 1514
53 Ga0070681_10307413 3300005458 Unclassified 1495
54 Ga0070681_10744823 3300005458 Bacteria 896
55 Ga0068867_100385663 3300005459 Unclassified 1178
56 Ga0068867_101430863 3300005459 Bacteria 642
57 Ga0070685_10066761 3300005466 Unclassified 2121
58 Ga0070706_100068825 3300005467 Bacteria 3274
59 Ga0070706_100983394 3300005467 Bacteria 778
60 Ga0070707_101315395 3300005468 Unclassified 689
61 Ga0070707_101345938 3300005468 Unclassified 680
62 Ga0070679_100017636 3300005530 Bacteria 6911
63 Ga0070679_100402238 3300005530 Bacteria 1315
64 Ga0070679_100900338 3300005530 Bacteria 828
65 Ga0070684_100000004 3300005535 Bacteria 231043
66 Ga0070684_100409355 3300005535 Bacteria 1251
67 Ga0070684_100465608 3300005535 Bacteria 1169
68 Ga0070684_100600422 3300005535 Bacteria 1023
69 Ga0070684_101985598 3300005535 Unclassified 549
70 Ga0070695_100063924 3300005545 Bacteria 2393
71 Ga0070695_100261859 3300005545 Unclassified 1263
72 Ga0070695_101177611 3300005545 Unclassified 630
73 Ga0070696_100006145 3300005546 Bacteria 8025
74 Ga0070665_100241423 3300005548 Bacteria 1807
75 Ga0070665_100374804 3300005548 Bacteria 1430
76 Ga0070665_100748718 3300005548 Bacteria 990
77 Ga0070665_102332340 3300005548 Bacteria 538
78 Ga0070704_100240956 3300005549 Unclassified 1480
79 Ga0068855_100034660 3300005563 Bacteria 6016
80 Ga0068855_100056882 3300005563 Bacteria 4586
81 Ga0068855_100114317 3300005563 Unclassified 3095
82 Ga0068855_100606341 3300005563 Bacteria 1180
83 Ga0068855_101647558 3300005563 Bacteria 655
84 Ga0068855_101912587 3300005563 Bacteria 601
85 Ga0068857_100945584 3300005577 Unclassified 828
86 Ga0068856_100343913 3300005614 Unclassified 1510
87 Ga0068856_101223483 3300005614 Unclassified 767
88 Ga0068852_100043019 3300005616 Bacteria 3829
89 Ga0068852_100235859 3300005616 Bacteria 1746
90 Ga0068859_100485434 3300005617 Unclassified 1331
91 Ga0068859_101068524 3300005617 Bacteria 887
92 Ga0068859_102136956 3300005617 Unclassified 618
93 Ga0068864_100243405 3300005618 Bacteria 1667
94 Ga0068864_100295758 3300005618 Bacteria 1514
95 Ga0068864_100971818 3300005618 Bacteria 841
96 Ga0068866_11022759 3300005718 Bacteria 588
97 Ga0068851_10650592 3300005834 Unclassified 645
98 Ga0068863_100155495 3300005841 Bacteria 2189
99 Ga0068863_101005175 3300005841 Bacteria 837
100 Ga0068863_102196709 3300005841 Unclassified 562
101 Ga0068858_101231630 3300005842 Bacteria 736
102 Ga0068860_101245519 3300005843 Unclassified 764
103 Ga0068860_102744797 3300005843 Bacteria 511
104 Ga0070717_10210714 3300006028 Unclassified 1705
105 Ga0070717_10677701 3300006028 Bacteria 936
106 Ga0070717_11652273 3300006028 Bacteria 580
107 Ga0070716_100320320 3300006173 Bacteria 1086
108 Ga0070716_101480557 3300006173 Unclassified 554
109 Ga0070716_101585310 3300006173 Unclassified 537
110 Ga0097621_100356103 3300006237 Bacteria 1303
111 Ga0068871_100361281 3300006358 Bacteria 1286
112 Ga0068871_101768363 3300006358 Unclassified 587
113 Ga0075433_10378305 3300006852 Bacteria 1250
114 Ga0075434_100236603 3300006871 Unclassified 1846
115 Ga0075429_101617713 3300006880 Bacteria 563
116 Ga0075436_100003800 3300006914 Bacteria 10358
117 Ga0075436_100209356 3300006914 Bacteria 1382
118 Ga0097620_100485461 3300006931 Unclassified 1331
119 Ga0097620_101068609 3300006931 Bacteria 887
120 Ga0097620_102136713 3300006931 Unclassified 618
121 Ga0075435_100768750 3300007076 Bacteria 838
122 Ga0105240_10013867 3300009093 Bacteria 11038
123 Ga0105240_10086215 3300009093 Bacteria 3846
124 Ga0105240_10132076 3300009093 Bacteria 2994
125 Ga0105240_10450327 3300009093 Unclassified 1441
126 Ga0105240_10634060 3300009093 Bacteria 1173
127 Ga0105240_12560225 3300009093 Unclassified 527
128 Ga0111539_10113374 3300009094 Bacteria 3180
129 Ga0105245_10497560 3300009098 Unclassified 1235
130 Ga0105245_10774545 3300009098 Bacteria 996
131 Ga0105245_10827702 3300009098 Unclassified 965
132 Ga0105245_11579455 3300009098 Bacteria 708
133 Ga0105247_10763511 3300009101 Bacteria 734
134 Ga0105247_11846757 3300009101 Unclassified 504
135 Ga0114129_10176232 3300009147 Bacteria 2912
136 Ga0105241_11172546 3300009174 Unclassified 726
137 Ga0105242_10190581 3300009176 Bacteria 1815
138 Ga0105242_10465836 3300009176 Bacteria 1194
139 Ga0105248_10046843 3300009177 Bacteria 4848
140 Ga0105248_10050463 3300009177 Unclassified 4667
141 Ga0105248_10636093 3300009177 Bacteria 1204
142 Ga0105248_10695378 3300009177 Bacteria 1147
143 Ga0105248_10837941 3300009177 Bacteria 1038
144 Ga0105248_10904805 3300009177 Bacteria 996
145 Ga0105248_11408774 3300009177 Bacteria 789
146 Ga0105237_10004845 3300009545 Bacteria 15463
147 Ga0105237_10046124 3300009545 Bacteria 4384
148 Ga0105237_10547870 3300009545 Unclassified 1163
149 Ga0105237_10621479 3300009545 Bacteria 1087
150 Ga0105237_11546954 3300009545 Bacteria 670
151 Ga0105237_12102927 3300009545 Unclassified 574
152 Ga0105237_12189617 3300009545 Unclassified 562
153 Ga0105238_10399793 3300009551 Unclassified 1367
154 Ga0105238_10769446 3300009551 Bacteria 977
155 Ga0105238_10869991 3300009551 Bacteria 919
156 Ga0105238_11739139 3300009551 Unclassified 655
157 Ga0105238_12187578 3300009551 Unclassified 588
158 Ga0105238_12712174 3300009551 Unclassified 532
159 Ga0105249_10568786 3300009553 Bacteria 1186
160 Ga0105239_10018245 3300010375 Bacteria 7757
161 Ga0105239_10975180 3300010375 Bacteria 974
162 Ga0105239_11751700 3300010375 Bacteria 719
163 Ga0105246_10182055 3300011119 Bacteria 1619
164 Ga0105246_10607874 3300011119 Bacteria 946
165 Ga0157371_11145481 3300013102 Unclassified 598
166 Ga0157370_10013865 3300013104 Bacteria 8277
167 Ga0157370_10354761 3300013104 Bacteria 1352
168 Ga0157370_10387573 3300013104 Bacteria 1287
169 Ga0157370_11621648 3300013104 Unclassified 581
170 Ga0157370_11997724 3300013104 Bacteria 520
171 Ga0157369_10005127 3300013105 Bacteria 15340
172 Ga0157369_10010558 3300013105 Bacteria 10509
173 Ga0157369_10130299 3300013105 Bacteria 2666
174 Ga0157369_10378731 3300013105 Unclassified 1469
175 Ga0157369_10660223 3300013105 Bacteria 1078
176 Ga0157374_10033978 3300013296 Unclassified 4656
177 Ga0157374_10094359 3300013296 Bacteria 2859
178 Ga0157374_10691265 3300013296 Unclassified 1033
179 Ga0157374_10799300 3300013296 Bacteria 959
180 Ga0157374_11125962 3300013296 Bacteria 806
181 Ga0157374_11280894 3300013296 Bacteria 755
182 Ga0157374_12787258 3300013296 Unclassified 516
183 Ga0157378_10081591 3300013297 Unclassified 2923
184 Ga0157378_10712896 3300013297 Unclassified 1023
185 Ga0157378_11019011 3300013297 Unclassified 863
186 Ga0157378_11040958 3300013297 Unclassified 854
187 Ga0157378_11194801 3300013297 Unclassified 800
188 Ga0157378_11687033 3300013297 Unclassified 680
189 Ga0157378_11776091 3300013297 Unclassified 665
190 Ga0157378_12612696 3300013297 Unclassified 557
191 Ga0163162_10529137 3300013306 Bacteria 1308
192 Ga0163162_10929746 3300013306 Bacteria 981
193 Ga0163162_11288537 3300013306 Bacteria 830
194 Ga0163162_11416793 3300013306 Bacteria 791
195 Ga0163162_11537020 3300013306 Unclassified 758
196 Ga0163162_11881320 3300013306 Unclassified 685
197 Ga0157372_10059896 3300013307 Bacteria 4260
198 Ga0157372_10454716 3300013307 Unclassified 1492
199 Ga0157372_10618690 3300013307 Unclassified 1262
200 Ga0157372_10619641 3300013307 Unclassified 1261
201 Ga0157372_13044625 3300013307 Unclassified 536
202 Ga0157375_10567707 3300013308 Bacteria 1295
203 Ga0157375_10779175 3300013308 Bacteria 1106
204 Ga0157375_10811426 3300013308 Bacteria 1084
205 Ga0157375_10830363 3300013308 Bacteria 1072
206 Ga0157375_12751646 3300013308 Unclassified 588
207 Ga0163163_10105344 3300014325 Unclassified 2846
208 Ga0163163_10271386 3300014325 Bacteria 1747
209 Ga0163163_10380957 3300014325 Unclassified 1468
210 Ga0163163_10976109 3300014325 Unclassified 910
211 Ga0163163_11568794 3300014325 Bacteria 719
212 Ga0163163_12200975 3300014325 Bacteria 611
213 Ga0163163_13226832 3300014325 Unclassified 508
214 Ga0157376_10054628 3300014969 Bacteria 3331
215 Ga0157376_10101946 3300014969 Bacteria 2509
216 Ga0157376_10185980 3300014969 Unclassified 1902
217 Ga0157376_10316090 3300014969 Unclassified 1483
218 Ga0157376_10746669 3300014969 Bacteria 987
219 Ga0157376_11064981 3300014969 Bacteria 833
220 Ga0157376_11152582 3300014969 Unclassified 802
221 Ga0163161_11176085 3300017792 Bacteria 662
222 Ga0206352_11341001 3300020078 Bacteria 572
223 Ga0213875_10115009 3300021388 Unclassified 1257
224 Ga0207680_10209659 3300025903 Bacteria 1332
225 Ga0207680_10461122 3300025903 Unclassified 903
226 Ga0207680_10760239 3300025903 Unclassified 695
227 Ga0207685_10426497 3300025905 Bacteria 685
228 Ga0207685_10682785 3300025905 Unclassified 558
229 Ga0207699_10192940 3300025906 Bacteria 1376
230 Ga0207699_10775307 3300025906 Unclassified 704
231 Ga0207705_10088148 3300025909 Bacteria 2270
232 Ga0207705_10092268 3300025909 Unclassified 2219
233 Ga0207705_10107972 3300025909 Bacteria 2054
234 Ga0207705_10661697 3300025909 Unclassified 812
235 Ga0207684_10318558 3300025910 Unclassified 1340
236 Ga0207684_11215413 3300025910 Bacteria 623
237 Ga0207654_10966690 3300025911 Unclassified 619
238 Ga0207654_11429042 3300025911 Unclassified 504
239 Ga0207707_10024461 3300025912 Bacteria 5284
240 Ga0207707_10057470 3300025912 Bacteria 3386
241 Ga0207707_10116160 3300025912 Bacteria 2338
242 Ga0207707_10162329 3300025912 Bacteria 1953
243 Ga0207707_10597018 3300025912 Bacteria 935
244 Ga0207695_10009040 3300025913 Bacteria 12385
245 Ga0207695_10050788 3300025913 Unclassified 4360
246 Ga0207695_10361140 3300025913 Bacteria 1339
247 Ga0207695_10373113 3300025913 Unclassified 1313
248 Ga0207695_10454914 3300025913 Bacteria 1163
249 Ga0207695_10517512 3300025913 Bacteria 1075
250 Ga0207695_10914350 3300025913 Bacteria 757
251 Ga0207695_11619869 3300025913 Unclassified 528
252 Ga0207671_10028182 3300025914 Unclassified 4198
253 Ga0207671_10033024 3300025914 Bacteria 3852
254 Ga0207671_10403916 3300025914 Unclassified 1086
255 Ga0207693_10615295 3300025915 Unclassified 845
256 Ga0207663_10218662 3300025916 Unclassified 1385
257 Ga0207663_10449297 3300025916 Unclassified 994
258 Ga0207660_10026975 3300025917 Bacteria 3915
259 Ga0207660_10354708 3300025917 Bacteria 1176
260 Ga0207660_10707194 3300025917 Unclassified 822
261 Ga0207657_10499513 3300025919 Unclassified 953
262 Ga0207652_10336972 3300025921 Bacteria 1362
263 Ga0207652_10866284 3300025921 Bacteria 799
264 Ga0207646_11178833 3300025922 Unclassified 672
265 Ga0207694_10821541 3300025924 Bacteria 785
266 Ga0207659_10396250 3300025926 Bacteria 1154
267 Ga0207659_11723402 3300025926 Bacteria 533
268 Ga0207687_10791872 3300025927 Unclassified 808
269 Ga0207700_10223769 3300025928 Bacteria 1597
270 Ga0207700_10857838 3300025928 Unclassified 813
271 Ga0207664_10097960 3300025929 Bacteria 2417
272 Ga0207644_10076117 3300025931 Bacteria 2468
273 Ga0207644_10240304 3300025931 Bacteria 1442
274 Ga0207690_10077826 3300025932 Bacteria 2306
275 Ga0207686_10375311 3300025934 Bacteria 1077
276 Ga0207686_10379004 3300025934 Bacteria 1072
277 Ga0207670_10092570 3300025936 Bacteria 2140
278 Ga0207670_10589572 3300025936 Bacteria 912
279 Ga0207665_10380635 3300025939 Bacteria 1071
280 Ga0207665_10705698 3300025939 Unclassified 793
281 Ga0207711_10124491 3300025941 Bacteria 2305
282 Ga0207711_10192968 3300025941 Unclassified 1857
283 Ga0207711_11241352 3300025941 Unclassified 687
284 Ga0207689_11277196 3300025942 Bacteria 617
285 Ga0207661_10000055 3300025944 Bacteria 86544
286 Ga0207661_10328884 3300025944 Unclassified 1375
287 Ga0207661_12086016 3300025944 Unclassified 513
288 Ga0207679_11932732 3300025945 Unclassified 538
289 Ga0207667_10077203 3300025949 Bacteria 3455
290 Ga0207667_10125814 3300025949 Bacteria 2640
291 Ga0207667_10171055 3300025949 Bacteria 2233
292 Ga0207667_10333030 3300025949 Unclassified 1550
293 Ga0207667_10719190 3300025949 Bacteria 1000
294 Ga0207651_10222771 3300025960 Bacteria 1526
295 Ga0207712_10200204 3300025961 Bacteria 1583
296 Ga0207668_10814432 3300025972 Bacteria 827
297 Ga0207658_10135695 3300025986 Bacteria 1984
298 Ga0207658_10742239 3300025986 Unclassified 889
299 Ga0207658_11044568 3300025986 Bacteria 746
300 Ga0207658_11189354 3300025986 Bacteria 697
301 Ga0207658_11859925 3300025986 Unclassified 549
302 Ga0207677_12217951 3300026023 Unclassified 511
303 Ga0207703_10768311 3300026035 Bacteria 919
304 Ga0207703_11306611 3300026035 Unclassified 698
305 Ga0207703_11310180 3300026035 Unclassified 697
306 Ga0207639_11293535 3300026041 Unclassified 684
307 Ga0207702_11906495 3300026078 Unclassified 585
308 Ga0207641_10214874 3300026088 Bacteria 1780
309 Ga0207641_11990926 3300026088 Unclassified 582
310 Ga0207648_10274601 3300026089 Bacteria 1506
311 Ga0207648_10533544 3300026089 Bacteria 1076
312 Ga0207676_10488650 3300026095 Bacteria 1167
313 Ga0207676_11061533 3300026095 Bacteria 800
314 Ga0207675_101751297 3300026118 Unclassified 641
315 Ga0207683_11723602 3300026121 Unclassified 576
316 Ga0207698_10365060 3300026142 Bacteria 1369
317 Ga0207698_10756540 3300026142 Unclassified 971
318 Ga0268266_10432538 3300028379 Bacteria 1249
319 Ga0268266_12027582 3300028379 Unclassified 549
320 Ga0268264_10143865 3300028381 Bacteria 2130
321 Ga0268264_11873008 3300028381 Bacteria 610
322 Ga0265338_10884382 3300028800 Unclassified 609
323 Ga0265330_10425829 3300031235 Bacteria 562
324 Ga0265325_10051663 3300031241 Bacteria 2113
325 Ga0265339_10091043 3300031249 Bacteria 1599
326 Ga0265316_10014212 3300031344 Bacteria 7021
327 Ga0265316_10023678 3300031344 Bacteria 5155
328 Ga0265316_10039441 3300031344 Bacteria 3793
329 Ga0265316_10039724 3300031344 Bacteria 3778
330 Ga0265316_10049677 3300031344 Bacteria 3303
331 Ga0265316_10176029 3300031344 Bacteria 1594
332 Ga0265316_10235400 3300031344 Unclassified 1347
333 Ga0265316_10238075 3300031344 Bacteria 1339
334 Ga0265316_10268715 3300031344 Unclassified 1248
335 Ga0265316_10279373 3300031344 Unclassified 1220
336 Ga0265316_10345005 3300031344 Bacteria 1079
337 Ga0265316_10595034 3300031344 Bacteria 785
338 Ga0265316_10662010 3300031344 Unclassified 738
339 Ga0265316_10783711 3300031344 Unclassified 669
340 Ga0307408_102003945 3300031548 Bacteria 557
341 Ga0265313_10079226 3300031595 Bacteria 1496
342 Ga0265313_10297834 3300031595 Unclassified 649
343 Ga0265313_10308316 3300031595 Unclassified 634
344 Ga0265314_10072666 3300031711 Bacteria 2297
345 Ga0373926_0036267 3300035083 Bacteria 1751
346 Ga0373926_0223308 3300035083 Bacteria 727
347 Ga0373934_0059710 3300035086 Unclassified 1518
348 Ga0373923_0591755 3300035111 Unclassified 546
349 Ga0373953_0275971 3300035117 Unclassified 732
350 Ga0373954_0469912 3300035118 Unclassified 623
351 Ga0373957_0140932 3300035120 Bacteria 986
352 Ga0373957_0188314 3300035120 Unclassified 857
353 Ga0373943_0464946 3300035170 Bacteria 736
354 Ga0373943_0705263 3300035170 Bacteria 598
355 Ga0373946_0333988 3300035171 Bacteria 755
356 Ga0373946_0526606 3300035171 Bacteria 608
357 Ga0373955_0152144 3300035172 Unclassified 1362
358 Ga0373935_0457459 3300035692 Bacteria 923
359 Ga0373935_0530275 3300035692 Bacteria 857
360 Ga0373935_0647157 3300035692 Bacteria 775
361 Ga0373935_0961854 3300035692 Bacteria 634
362 Ga0373927_0001252 3300035695 Bacteria 19261
363 Ga0373927_0002496 3300035695 Bacteria 13424
364 Ga0373927_0084411 3300035695 Bacteria 2060
365 Ga0373927_0796819 3300035695 Unclassified 624
366 Ga0373947_0000254 3300035725 Bacteria 30091
367 Ga0373947_0161927 3300035725 Bacteria 1448
368 Ga0373947_0702921 3300035725 Unclassified 690
369 Ga0373947_0773340 3300035725 Unclassified 655
370 Ga0373937_0050158 3300036401 Unclassified 3822
371 Ga0373937_0409458 3300036401 Bacteria 1287
372 Ga0373937_1891644 3300036401 Unclassified 543
373 Ga0373925_0000090 3300037068 Bacteria 97041
374 Ga0373925_0132576 3300037068 Bacteria 1944
375 Ga0373925_0397958 3300037068 Bacteria 1123
376 Ga0373925_0528759 3300037068 Bacteria 969
377 Ga0373925_1154789 3300037068 Bacteria 637
378 Ga0373925_1332232 3300037068 Unclassified 589
379 Ga0373925_1741078 3300037068 Unclassified 509
380 Ga0395899_0502882 3300037312 Bacteria 786
381 Ga0395900_0687053 3300037418 Bacteria 958
382 Ga0395898_0878259 3300037466 Bacteria 835
383 Ga0436364_0528445 3300037853 Unclassified 666
384 Ga0436364_0567752 3300037853 Bacteria 5166
385 Ga0436365_0441969 3300039437 Unclassified 2870
386 Ga0451577_0729388 3300042876 Unclassified 897
387 Ga0466961_0208913 3300044693 Bacteria 1206
388 Ga0466957_0604556 3300044842 Bacteria 768
389 Ga0451576_0245964 3300045051 Bacteria 1869
390 Ga0451576_0328400 3300045051 Bacteria 1601
391 Ga0451576_0397222 3300045051 Bacteria 1445
392 Ga0451576_0491709 3300045051 Bacteria 1289
393 Ga0451576_0688763 3300045051 Unclassified 1074
394 Ga0451576_2177801 3300045051 Unclassified 569
395 Ga0466958_0484928 3300045836 Bacteria 802
396 Ga0466967_0386962 3300045976 Bacteria 1359
397 Ga0495592_0225799 3300046454 Bacteria 1249
398 Ga0495603_0227078 3300046455 Bacteria 1077
399 Ga0495651_0014252 3300046462 Bacteria 6145
400 Ga0495651_0040804 3300046462 Unclassified 3606
401 Ga0495651_0853582 3300046462 Unclassified 559
402 Ga0495653_0045138 3300046463 Bacteria 3418
403 Ga0495580_0001569 3300046472 Bacteria 20092
404 Ga0495580_0006742 3300046472 Bacteria 9318
405 Ga0495580_0030573 3300046472 Unclassified 3899
406 Ga0495580_0063294 3300046472 Bacteria 2595
407 Ga0495580_0214381 3300046472 Unclassified 1324
408 Ga0495580_0452846 3300046472 Unclassified 861
409 Ga0495580_1045005 3300046472 Bacteria 519
410 Ga0495582_0103408 3300046473 Bacteria 1596
411 Ga0495662_0050345 3300046476 Bacteria 2011
412 Ga0495662_0420268 3300046476 Bacteria 656
413 Ga0495662_0649730 3300046476 Unclassified 515
414 Ga0495664_0280167 3300046477 Bacteria 1007
415 Ga0495594_0549876 3300046499 Bacteria 655
416 Ga0495608_0151714 3300046511 Bacteria 1476
417 Ga0495608_0762203 3300046511 Bacteria 573
418 Ga0495618_0053493 3300046514 Unclassified 2553
419 Ga0495618_0495228 3300046514 Bacteria 737
420 Ga0495628_0234174 3300046516 Unclassified 1376
421 Ga0495628_0343455 3300046516 Bacteria 1098
422 Ga0495630_0088523 3300046517 Bacteria 2338
423 Ga0495630_0366016 3300046517 Unclassified 1104
424 Ga0495666_0123637 3300046526 Bacteria 1211
425 Ga0495642_0026226 3300046528 Bacteria 2314
426 Ga0495642_0407173 3300046528 Bacteria 600
427 Ga0495652_0316480 3300046529 Bacteria 1129
428 Ga0495652_0436286 3300046529 Bacteria 920
429 Ga0495652_1141556 3300046529 Unclassified 504
430 Ga0495665_0046496 3300046531 Bacteria 2304
431 Ga0495665_0573586 3300046531 Unclassified 565
432 Ga0495640_0061726 3300046533 Bacteria 2545
433 Ga0495640_0262347 3300046533 Bacteria 1079
434 Ga0495640_0470527 3300046533 Bacteria 766
435 Ga0495640_0525370 3300046533 Unclassified 719
436 Ga0495587_0228322 3300046536 Bacteria 1049
437 Ga0495587_0291702 3300046536 Bacteria 913
438 Ga0495587_0405575 3300046536 Bacteria 757
439 Ga0495645_0003297 3300046543 Bacteria 10939
440 Ga0495645_0244449 3300046543 Bacteria 1196
441 Ga0495645_0407542 3300046543 Bacteria 865
442 Ga0495645_0453735 3300046543 Bacteria 808
443 Ga0495645_0473812 3300046543 Unclassified 786
444 Ga0495645_0780467 3300046543 Bacteria 575
445 Ga0495667_0363000 3300046559 Bacteria 914
446 Ga0495667_0482075 3300046559 Bacteria 778
447 Ga0495668_0594603 3300046616 Bacteria 611
448 Ga0495634_0040200 3300046642 Bacteria 3182
449 Ga0495635_0022594 3300046663 Bacteria 4383
450 Ga0495657_0255629 3300046675 Unclassified 1054
451 Ga0495599_0221283 3300046678 Bacteria 1158
452 Ga0495599_0266212 3300046678 Unclassified 1041
453 Ga0495599_0815465 3300046678 Bacteria 532
454 Ga0495623_0062809 3300046679 Unclassified 2327
455 Ga0495623_0076562 3300046679 Bacteria 2076
456 Ga0495623_0117811 3300046679 Bacteria 1603
457 Ga0495623_0150399 3300046679 Bacteria 1376
458 Ga0495646_0181688 3300046680 Bacteria 1154
459 Ga0495613_0121324 3300046689 Bacteria 1877
460 Ga0495604_0325834 3300047317 Bacteria 1026
461 Ga0495604_0368180 3300047317 Unclassified 952
462 Ga0495604_0885668 3300047317 Bacteria 558
463 Ga0495674_0029251 3300047319 Bacteria 5019
464 Ga0495674_0114188 3300047319 Bacteria 2287
465 Ga0495674_0114797 3300047319 Unclassified 2280
466 Ga0495674_0704869 3300047319 Bacteria 792
467 Ga0495680_0259964 3300047322 Bacteria 1228
468 Ga0495675_0055812 3300047444 Bacteria 2505
469 Ga0495675_0085834 3300047444 Bacteria 1979
470 Ga0495684_0006455 3300047471 Bacteria 9108
471 Ga0495684_0036481 3300047471 Bacteria 3768
472 Ga0495684_0066571 3300047471 Bacteria 2739
473 Ga0495684_0068057 3300047471 Bacteria 2708
474 Ga0495684_0658995 3300047471 Bacteria 699
475 Ga0495602_0065347 3300048088 Unclassified 3140
476 Ga0495602_0661893 3300048088 Bacteria 712
477 Ga0495602_0904864 3300048088 Unclassified 587
478 Ga0496100_1193638 3300048903 Unclassified 600
479 Ga0496101_0316618 3300048904 Unclassified 1224
480 Ga0496104_0719274 3300048907 Bacteria 906
481 Ga0496104_1552601 3300048907 Unclassified 565
482 Ga0496112_1401460 3300048915 Bacteria 613
483 Ga0496115_0393538 3300048918 Unclassified 1125
484 Ga0501047_0322925 3300049581 Bacteria 1383
485 Ga0501047_0400091 3300049581 Bacteria 1206
486 Ga0501048_1193429 3300049582 Unclassified 547
487 Ga0501083_0619880 3300049744 Bacteria 704
488 nmdc:mga05p37_1129607_c1 3300050507 Bacteria 817
489 nmdc:mga09592_1689683_c1 3300050508 Bacteria 511
490 nmdc:mga06r32_90582_c1 3300050510 Bacteria 2988
491 nmdc:mga0n895_1445889_c1 3300050512 Unclassified 655
492 nmdc:mga0n895_350235_c1 3300050512 Unclassified 1496
493 nmdc:mga0rr50_83451_c1 3300050513 Bacteria 2470
494 nmdc:mga08x19_154925_c1 3300050514 Bacteria 1553
495 nmdc:mga08x19_220040_c1 3300050514 Bacteria 1304
496 nmdc:mga08x19_2619_c1 3300050514 Bacteria 10908
497 Ga0495619_0554454 3300053085 Unclassified 788
498 Ga0501082_0000102 3300060353 Bacteria 66513
499 Ga0207663_11290425
500 Ga0070658_10001230
501 Ga0070658_10040855
502 Ga0070658_10104257
503 Ga0070658_10393456
504 Ga0070658_10456588
505 Ga0070658_10564979
506 Ga0070676_10707541
507 Ga0070683_100000014
508 Ga0070683_100142239
509 Ga0070683_100479306
510 Ga0070683_101430688
511 Ga0070690_100298028
512 Ga0070690_100759902
513 Ga0070670_100256456
514 Ga0070666_10280016
515 Ga0070666_10478081
516 Ga0070680_100054576
517 Ga0070680_100205830
518 Ga0070680_100453668
519 Ga0070680_100771466
520 Ga0070682_101418480
521 Ga0070682_101780389
522 Ga0070660_100500111
523 Ga0070660_100587982
524 Ga0070689_100119691
525 Ga0070691_10889791
526 Ga0070692_10932822
527 Ga0070668_100746084
528 Ga0070675_100269758
529 Ga0070671_101305800
530 Ga0070671_101646196
531 Ga0070673_100368151
532 Ga0070688_100114655
533 Ga0070659_100227073
534 Ga0070667_101491093
535 Ga0070667_102153685
536 Ga0070709_10312255
537 Ga0070714_100036320
538 Ga0070710_11274043
539 Ga0070701_10269531
540 Ga0070711_100279011
541 Ga0070711_100501327
542 Ga0070711_100803033
543 Ga0070694_100138238
544 Ga0070694_100269728
545 Ga0070708_100256575
546 Ga0070708_100908014
547 Ga0070678_100810112
548 Ga0070681_10019557
549 Ga0070681_10056508
550 Ga0070681_10300919
551 Ga0070681_10307413
552 Ga0070681_10744823
553 Ga0068867_100385663
554 Ga0068867_101430863
555 Ga0070685_10066761
556 Ga0070706_100068825
557 Ga0070706_100983394
558 Ga0070707_101315395
559 Ga0070707_101345938
560 Ga0070679_100017636
561 Ga0070679_100402238
562 Ga0070679_100900338
563 Ga0070684_100000004
564 Ga0070684_100409355
565 Ga0070684_100465608
566 Ga0070684_100600422
567 Ga0070684_101985598
568 Ga0070695_100063924
569 Ga0070695_100261859
570 Ga0070695_101177611
571 Ga0070696_100006145
572 Ga0070665_100241423
573 Ga0070665_100374804
574 Ga0070665_100748718
575 Ga0070665_102332340
576 Ga0070704_100240956
577 Ga0068855_100034660
578 Ga0068855_100056882
579 Ga0068855_100114317
580 Ga0068855_100606341
581 Ga0068855_101647558
582 Ga0068855_101912587
583 Ga0068857_100945584
584 Ga0068856_100343913
585 Ga0068856_101223483
586 Ga0068852_100043019
587 Ga0068852_100235859
588 Ga0068859_100485434
589 Ga0068859_101068524
590 Ga0068859_102136956
591 Ga0068864_100243405
592 Ga0068864_100295758
593 Ga0068864_100971818
594 Ga0068866_11022759
595 Ga0068851_10650592
596 Ga0068863_100155495
597 Ga0068863_101005175
598 Ga0068863_102196709
599 Ga0068858_101231630
600 Ga0068860_101245519
601 Ga0068860_102744797
602 Ga0070717_10210714
603 Ga0070717_10677701
604 Ga0070717_11652273
605 Ga0070716_100320320
606 Ga0070716_101480557
607 Ga0070716_101585310
608 Ga0097621_100356103
609 Ga0068871_100361281
610 Ga0068871_101768363
611 Ga0075433_10378305
612 Ga0075434_100236603
613 Ga0075429_101617713
614 Ga0075436_100003800
615 Ga0075436_100209356
616 Ga0097620_100485461
617 Ga0097620_101068609
618 Ga0097620_102136713
619 Ga0075435_100768750
620 Ga0105240_10013867
621 Ga0105240_10086215
622 Ga0105240_10132076
623 Ga0105240_10450327
624 Ga0105240_10634060
625 Ga0105240_12560225
626 Ga0111539_10113374
627 Ga0105245_10497560
628 Ga0105245_10774545
629 Ga0105245_10827702
630 Ga0105245_11579455
631 Ga0105247_10763511
632 Ga0105247_11846757
633 Ga0114129_10176232
634 Ga0105241_11172546
635 Ga0105242_10190581
636 Ga0105242_10465836
637 Ga0105248_10046843
638 Ga0105248_10050463
639 Ga0105248_10636093
640 Ga0105248_10695378
641 Ga0105248_10837941
642 Ga0105248_10904805
643 Ga0105248_11408774
644 Ga0105237_10004845
645 Ga0105237_10046124
646 Ga0105237_10547870
647 Ga0105237_10621479
648 Ga0105237_11546954
649 Ga0105237_12102927
650 Ga0105237_12189617
651 Ga0105238_10399793
652 Ga0105238_10769446
653 Ga0105238_10869991
654 Ga0105238_11739139
655 Ga0105238_12187578
656 Ga0105238_12712174
657 Ga0105249_10568786
658 Ga0105239_10018245
659 Ga0105239_10975180
660 Ga0105239_11751700
661 Ga0105246_10182055
662 Ga0105246_10607874
663 Ga0157371_11145481
664 Ga0157370_10013865
665 Ga0157370_10354761
666 Ga0157370_10387573
667 Ga0157370_11621648
668 Ga0157370_11997724
669 Ga0157369_10005127
670 Ga0157369_10010558
671 Ga0157369_10130299
672 Ga0157369_10378731
673 Ga0157369_10660223
674 Ga0157374_10033978
675 Ga0157374_10094359
676 Ga0157374_10691265
677 Ga0157374_10799300
678 Ga0157374_11125962
679 Ga0157374_11280894
680 Ga0157374_12787258
681 Ga0157378_10081591
682 Ga0157378_10712896
683 Ga0157378_11019011
684 Ga0157378_11040958
685 Ga0157378_11194801
686 Ga0157378_11687033
687 Ga0157378_11776091
688 Ga0157378_12612696
689 Ga0163162_10529137
690 Ga0163162_10929746
691 Ga0163162_11288537
692 Ga0163162_11416793
693 Ga0163162_11537020
694 Ga0163162_11881320
695 Ga0157372_10059896
696 Ga0157372_10454716
697 Ga0157372_10618690
698 Ga0157372_10619641
699 Ga0157372_13044625
700 Ga0157375_10567707
701 Ga0157375_10779175
702 Ga0157375_10811426
703 Ga0157375_10830363
704 Ga0157375_12751646
705 Ga0163163_10105344
706 Ga0163163_10271386
707 Ga0163163_10380957
708 Ga0163163_10976109
709 Ga0163163_11568794
710 Ga0163163_12200975
711 Ga0163163_13226832
712 Ga0157376_10054628
713 Ga0157376_10101946
714 Ga0157376_10185980
715 Ga0157376_10316090
716 Ga0157376_10746669
717 Ga0157376_11064981
718 Ga0157376_11152582
719 Ga0163161_11176085
720 Ga0206352_11341001
721 Ga0213875_10115009
722 Ga0207680_10209659
723 Ga0207680_10461122
724 Ga0207680_10760239
725 Ga0207685_10426497
726 Ga0207685_10682785
727 Ga0207699_10192940
728 Ga0207699_10775307
729 Ga0207705_10088148
730 Ga0207705_10092268
731 Ga0207705_10107972
732 Ga0207705_10661697
733 Ga0207684_10318558
734 Ga0207684_11215413
735 Ga0207654_10966690
736 Ga0207654_11429042
737 Ga0207707_10024461
738 Ga0207707_10057470
739 Ga0207707_10116160
740 Ga0207707_10162329
741 Ga0207707_10597018
742 Ga0207695_10009040
743 Ga0207695_10050788
744 Ga0207695_10361140
745 Ga0207695_10373113
746 Ga0207695_10454914
747 Ga0207695_10517512
748 Ga0207695_10914350
749 Ga0207695_11619869
750 Ga0207671_10028182
751 Ga0207671_10033024
752 Ga0207671_10403916
753 Ga0207693_10615295
754 Ga0207663_10218662
755 Ga0207663_10449297
756 Ga0207660_10026975
757 Ga0207660_10354708
758 Ga0207660_10707194
759 Ga0207657_10499513
760 Ga0207652_10336972
761 Ga0207652_10866284
762 Ga0207646_11178833
763 Ga0207694_10821541
764 Ga0207659_10396250
765 Ga0207659_11723402
766 Ga0207687_10791872
767 Ga0207700_10223769
768 Ga0207700_10857838
769 Ga0207664_10097960
770 Ga0207644_10076117
771 Ga0207644_10240304
772 Ga0207690_10077826
773 Ga0207686_10375311
774 Ga0207686_10379004
775 Ga0207670_10092570
776 Ga0207670_10589572
777 Ga0207665_10380635
778 Ga0207665_10705698
779 Ga0207711_10124491
780 Ga0207711_10192968
781 Ga0207711_11241352
782 Ga0207689_11277196
783 Ga0207661_10000055
784 Ga0207661_10328884
785 Ga0207661_12086016
786 Ga0207679_11932732
787 Ga0207667_10077203
788 Ga0207667_10125814
789 Ga0207667_10171055
790 Ga0207667_10333030
791 Ga0207667_10719190
792 Ga0207651_10222771
793 Ga0207712_10200204
794 Ga0207668_10814432
795 Ga0207658_10135695
796 Ga0207658_10742239
797 Ga0207658_11044568
798 Ga0207658_11189354
799 Ga0207658_11859925
800 Ga0207677_12217951
801 Ga0207703_10768311
802 Ga0207703_11306611
803 Ga0207703_11310180
804 Ga0207639_11293535
805 Ga0207702_11906495
806 Ga0207641_10214874
807 Ga0207641_11990926
808 Ga0207648_10274601
809 Ga0207648_10533544
810 Ga0207676_10488650
811 Ga0207676_11061533
812 Ga0207675_101751297
813 Ga0207683_11723602
814 Ga0207698_10365060
815 Ga0207698_10756540
816 Ga0268266_10432538
817 Ga0268266_12027582
818 Ga0268264_10143865
819 Ga0268264_11873008
820 Ga0265338_10884382
821 Ga0265330_10425829
822 Ga0265325_10051663
823 Ga0265339_10091043
824 Ga0265316_10014212
825 Ga0265316_10023678
826 Ga0265316_10039441
827 Ga0265316_10039724
828 Ga0265316_10049677
829 Ga0265316_10176029
830 Ga0265316_10235400
831 Ga0265316_10238075
832 Ga0265316_10268715
833 Ga0265316_10279373
834 Ga0265316_10345005
835 Ga0265316_10595034
836 Ga0265316_10662010
837 Ga0265316_10783711
838 Ga0307408_102003945
839 Ga0265313_10079226
840 Ga0265313_10297834
841 Ga0265313_10308316
842 Ga0265314_10072666
843 Ga0373926_0036267
844 Ga0373926_0223308
845 Ga0373934_0059710
846 Ga0373923_0591755
847 Ga0373953_0275971
848 Ga0373954_0469912
849 Ga0373957_0140932
850 Ga0373957_0188314
851 Ga0373943_0464946
852 Ga0373943_0705263
853 Ga0373946_0333988
854 Ga0373946_0526606
855 Ga0373955_0152144
856 Ga0373935_0457459
857 Ga0373935_0530275
858 Ga0373935_0647157
859 Ga0373935_0961854
860 Ga0373927_0001252
861 Ga0373927_0002496
862 Ga0373927_0084411
863 Ga0373927_0796819
864 Ga0373947_0000254
865 Ga0373947_0161927
866 Ga0373947_0702921
867 Ga0373947_0773340
868 Ga0373937_0050158
869 Ga0373937_0409458
870 Ga0373937_1891644
871 Ga0373925_0000090
872 Ga0373925_0132576
873 Ga0373925_0397958
874 Ga0373925_0528759
875 Ga0373925_1154789
876 Ga0373925_1332232
877 Ga0373925_1741078
878 Ga0395899_0502882
879 Ga0395900_0687053
880 Ga0395898_0878259
881 Ga0436364_0528445
882 Ga0436364_0567752
883 Ga0436365_0441969
884 Ga0451577_0729388
885 Ga0466961_0208913
886 Ga0466957_0604556
887 Ga0451576_0245964
888 Ga0451576_0328400
889 Ga0451576_0397222
890 Ga0451576_0491709
891 Ga0451576_0688763
892 Ga0451576_2177801
893 Ga0466958_0484928
894 Ga0466967_0386962
895 Ga0495592_0225799
896 Ga0495603_0227078
897 Ga0495651_0014252
898 Ga0495651_0040804
899 Ga0495651_0853582
900 Ga0495653_0045138
901 Ga0495580_0001569
902 Ga0495580_0006742
903 Ga0495580_0030573
904 Ga0495580_0063294
905 Ga0495580_0214381
906 Ga0495580_0452846
907 Ga0495580_1045005
908 Ga0495582_0103408
909 Ga0495662_0050345
910 Ga0495662_0420268
911 Ga0495662_0649730
912 Ga0495664_0280167
913 Ga0495594_0549876
914 Ga0495608_0151714
915 Ga0495608_0762203
916 Ga0495618_0053493
917 Ga0495618_0495228
918 Ga0495628_0234174
919 Ga0495628_0343455
920 Ga0495630_0088523
921 Ga0495630_0366016
922 Ga0495666_0123637
923 Ga0495642_0026226
924 Ga0495642_0407173
925 Ga0495652_0316480
926 Ga0495652_0436286
927 Ga0495652_1141556
928 Ga0495665_0046496
929 Ga0495665_0573586
930 Ga0495640_0061726
931 Ga0495640_0262347
932 Ga0495640_0470527
933 Ga0495640_0525370
934 Ga0495587_0228322
935 Ga0495587_0291702
936 Ga0495587_0405575
937 Ga0495645_0003297
938 Ga0495645_0244449
939 Ga0495645_0407542
940 Ga0495645_0453735
941 Ga0495645_0473812
942 Ga0495645_0780467
943 Ga0495667_0363000
944 Ga0495667_0482075
945 Ga0495668_0594603
946 Ga0495634_0040200
947 Ga0495635_0022594
948 Ga0495657_0255629
949 Ga0495599_0221283
950 Ga0495599_0266212
951 Ga0495599_0815465
952 Ga0495623_0062809
953 Ga0495623_0076562
954 Ga0495623_0117811
955 Ga0495623_0150399
956 Ga0495646_0181688
957 Ga0495613_0121324
958 Ga0495604_0325834
959 Ga0495604_0368180
960 Ga0495604_0885668
961 Ga0495674_0029251
962 Ga0495674_0114188
963 Ga0495674_0114797
964 Ga0495674_0704869
965 Ga0495680_0259964
966 Ga0495675_0055812
967 Ga0495675_0085834
968 Ga0495684_0006455
969 Ga0495684_0036481
970 Ga0495684_0066571
971 Ga0495684_0068057
972 Ga0495684_0658995
973 Ga0495602_0065347
974 Ga0495602_0661893
975 Ga0495602_0904864
976 Ga0496100_1193638
977 Ga0496101_0316618
978 Ga0496104_0719274
979 Ga0496104_1552601
980 Ga0496112_1401460
981 Ga0496115_0393538
982 Ga0501047_0322925
983 Ga0501047_0400091
984 Ga0501048_1193429
985 Ga0501083_0619880
986 nmdc:mga05p37_1129607_c1
987 nmdc:mga09592_1689683_c1
988 nmdc:mga06r32_90582_c1
989 nmdc:mga0n895_1445889_c1
990 nmdc:mga0n895_350235_c1
991 nmdc:mga0rr50_83451_c1
992 nmdc:mga08x19_154925_c1
993 nmdc:mga08x19_220040_c1
994 nmdc:mga08x19_2619_c1
995 Ga0495619_0554454
996 Ga0501082_0000102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

37

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8apo-assembly1.cif.gz_Xb structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.9457 34 59
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9396 20 106
5c3c-assembly1.cif.gz_A structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.9296 33 61
4yjx-assembly2.cif.gz_B the structure of agrobacterium tumefaciens clps2 bound to l-phenylalaninamide 0.9288 19 105
5cbg-assembly1.cif.gz_A calcium activated non-selective cation channel 0.9255 34 59
ID Description Score Start End Superfamily
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9465 17 104 3.30.1390.10
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9236 17 104 3.30.1390.10
af_Q58997_1_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9206 32 60 3.40.50.720
5cbgD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9163 34 59 1.10.287.70
4ykaD00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9153 20 105 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A6B0WAT3-F1-model_v4 ATP-dependent Clp protease adaptor ClpS 0.9966 21 106 GO:0006508
GO:0008233
GO:0030163
AF-A0A7Y5VXM3-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9953 21 106 GO:0006508
GO:0008233
GO:0030163
AF-A0A7C5VBF5-F1-model_v4 ATP-dependent Clp protease adaptor ClpS 0.9952 21 105 GO:0006508
GO:0008233
GO:0030163
AF-A0A7Z9UBN7-F1-model_v4 ATP-dependent Clp protease adaptor ClpS 0.9948 21 106 GO:0006508
GO:0008233
GO:0030163
AF-A0A368KYU5-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 0.9937 21 106 GO:0006508
GO:0008233
GO:0030163

Map