F455016

General Info

Members Datasets Scaffolds Average Seq Length
497 217 994 145

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100062987|Ga0075436_1000629875
Length 149
Sequence MQVSSPIPKHKARIEIIPLIDIMFFLLASFMMVSLSQVHMKGMKVNLPTGQTGETQAKNEYISVSVDRDGHPYFDKEEMRSYEDLAARLKKVHDENPEAKVFVRGDADTVHFNIIRVLDTLRSVGFYKVAFEIKSEALKGMPGPGSGQP

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
87 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 1.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.65
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 26.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100062987 3300006914 Bacteria 2563
2 SwRhRL2b_contig_809977 2162886007 Unclassified 855
3 JGI24035J26624_1004428 3300002126 Bacteria 1334
4 JGI25406J46586_10000002 3300003203 Bacteria 202415
5 JGI25406J46586_10016698 3300003203 Bacteria 3054
6 JGI25406J46586_10067587 3300003203 Bacteria 1131
7 JGI25405J52794_10000193 3300003911 Bacteria 7817
8 JGI25405J52794_10117134 3300003911 Bacteria 599
9 Ga0058860_11620987 3300004801 Unclassified 778
10 Ga0065703_1018881 3300005272 Bacteria 5564
11 Ga0065712_10091959 3300005290 Bacteria 2350
12 Ga0065712_10155363 3300005290 Bacteria 1339
13 Ga0065712_10309657 3300005290 Bacteria 846
14 Ga0065712_10440515 3300005290 Bacteria 695
15 Ga0065715_10138946 3300005293 Unclassified 1884
16 Ga0065715_10242115 3300005293 Bacteria 1196
17 Ga0065715_11100686 3300005293 Bacteria 520
18 Ga0070658_10462182 3300005327 Bacteria 1094
19 Ga0070676_10056713 3300005328 Bacteria 2316
20 Ga0070676_10677790 3300005328 Bacteria 751
21 Ga0070676_10686156 3300005328 Bacteria 747
22 Ga0070683_100087600 3300005329 Unclassified 2921
23 Ga0070690_100036368 3300005330 Unclassified 3094
24 Ga0070690_100560509 3300005330 Unclassified 862
25 Ga0070690_100764763 3300005330 Bacteria 747
26 Ga0070670_100015828 3300005331 Bacteria 6472
27 Ga0070670_100023748 3300005331 Bacteria 5277
28 Ga0070670_100033144 3300005331 Bacteria 4449
29 Ga0070670_100072563 3300005331 Unclassified 2956
30 Ga0070666_10003392 3300005335 Bacteria 9654
31 Ga0070666_10018705 3300005335 Unclassified 4460
32 Ga0070666_10033398 3300005335 Bacteria 3404
33 Ga0070666_10131619 3300005335 Unclassified 1739
34 Ga0068868_100068068 3300005338 Bacteria 2834
35 Ga0068868_100148599 3300005338 Unclassified 1928
36 Ga0070660_101131882 3300005339 Unclassified 663
37 Ga0070689_100159126 3300005340 Bacteria 1825
38 Ga0070689_100708068 3300005340 Bacteria 880
39 Ga0070687_101098173 3300005343 Unclassified 582
40 Ga0070668_100010994 3300005347 Bacteria 6738
41 Ga0070668_100018383 3300005347 Bacteria 5248
42 Ga0070668_100035530 3300005347 Bacteria 3800
43 Ga0070669_100033392 3300005353 Bacteria 3722
44 Ga0070669_100046190 3300005353 Unclassified 3175
45 Ga0070669_100100590 3300005353 Bacteria 2180
46 Ga0070669_100223102 3300005353 Unclassified 1491
47 Ga0070669_100403746 3300005353 Unclassified 1118
48 Ga0070675_100026836 3300005354 Bacteria 4623
49 Ga0070675_100028758 3300005354 Bacteria 4476
50 Ga0070675_100035545 3300005354 Bacteria 4049
51 Ga0070675_100574791 3300005354 Bacteria 1021
52 Ga0070675_100881916 3300005354 Bacteria 819
53 Ga0070671_100033630 3300005355 Bacteria 4242
54 Ga0070671_100040942 3300005355 Bacteria 3850
55 Ga0070671_100127951 3300005355 Bacteria 2139
56 Ga0070671_100240887 3300005355 Unclassified 1535
57 Ga0070674_100008908 3300005356 Bacteria 5992
58 Ga0070674_100026425 3300005356 Bacteria 3792
59 Ga0070674_100720508 3300005356 Unclassified 854
60 Ga0070673_100014465 3300005364 Bacteria 5500
61 Ga0070673_100021407 3300005364 Bacteria 4687
62 Ga0070673_100079872 3300005364 Unclassified 2649
63 Ga0070673_101332475 3300005364 Bacteria 675
64 Ga0070688_100017707 3300005365 Unclassified 4093
65 Ga0070659_101684966 3300005366 Bacteria 567
66 Ga0070667_100021174 3300005367 Bacteria 5402
67 Ga0070667_100043603 3300005367 Bacteria 3765
68 Ga0070667_100151804 3300005367 Unclassified 2035
69 Ga0070667_100177340 3300005367 Unclassified 1883
70 Ga0070667_100699961 3300005367 Bacteria 937
71 Ga0070667_101488592 3300005367 Bacteria 636
72 Ga0070703_10328688 3300005406 Unclassified 646
73 Ga0070709_11026334 3300005434 Unclassified 657
74 Ga0070714_100286273 3300005435 Bacteria 1532
75 Ga0070714_101464847 3300005435 Unclassified 667
76 Ga0070714_102031091 3300005435 Bacteria 560
77 Ga0070713_101604150 3300005436 Bacteria 632
78 Ga0070711_100324104 3300005439 Bacteria 1232
79 Ga0070711_100328710 3300005439 Unclassified 1223
80 Ga0070705_100196212 3300005440 Unclassified 1380
81 Ga0070705_100679610 3300005440 Bacteria 806
82 Ga0070700_100137712 3300005441 Unclassified 1655
83 Ga0070700_100259393 3300005441 Unclassified 1251
84 Ga0070700_101604191 3300005441 Bacteria 556
85 Ga0070708_100020966 3300005445 Bacteria 5519
86 Ga0070708_100027395 3300005445 Bacteria 4889
87 Ga0070708_100234176 3300005445 Unclassified 1723
88 Ga0070708_100971266 3300005445 Bacteria 797
89 Ga0070708_101547520 3300005445 Bacteria 618
90 Ga0070663_100833239 3300005455 Bacteria 793
91 Ga0070678_100001802 3300005456 Bacteria 11542
92 Ga0070678_100028152 3300005456 Unclassified 3827
93 Ga0070678_100093058 3300005456 Unclassified 2317
94 Ga0070678_101329945 3300005456 Bacteria 669
95 Ga0070662_100532739 3300005457 Unclassified 982
96 Ga0068867_100076058 3300005459 Bacteria 2520
97 Ga0070706_100000286 3300005467 Bacteria 61351
98 Ga0070706_100003298 3300005467 Bacteria 15966
99 Ga0070706_100027832 3300005467 Bacteria 5200
100 Ga0070706_100097706 3300005467 Bacteria 2728
101 Ga0070706_100107424 3300005467 Bacteria 2596
102 Ga0070706_100140746 3300005467 Bacteria 2252
103 Ga0070706_100222104 3300005467 Bacteria 1763
104 Ga0070706_100311122 3300005467 Bacteria 1469
105 Ga0070706_100719628 3300005467 Unclassified 925
106 Ga0070706_100915881 3300005467 Bacteria 810
107 Ga0070706_101236241 3300005467 Bacteria 686
108 Ga0070707_100002233 3300005468 Bacteria 18498
109 Ga0070707_100094922 3300005468 Bacteria 2888
110 Ga0070707_100155382 3300005468 Unclassified 2228
111 Ga0070707_100394154 3300005468 Bacteria 1344
112 Ga0070707_100450499 3300005468 Bacteria 1248
113 Ga0070707_100608769 3300005468 Bacteria 1055
114 Ga0070707_100630410 3300005468 Bacteria 1035
115 Ga0070707_100675411 3300005468 Bacteria 995
116 Ga0070698_100001957 3300005471 Bacteria 22869
117 Ga0070698_100020545 3300005471 Bacteria 6923
118 Ga0070698_100181446 3300005471 Bacteria 2043
119 Ga0070698_100361323 3300005471 Bacteria 1384
120 Ga0070698_101074841 3300005471 Bacteria 753
121 Ga0070698_101599698 3300005471 Bacteria 604
122 Ga0070699_100019406 3300005518 Bacteria 5852
123 Ga0070699_101081505 3300005518 Bacteria 736
124 Ga0070699_101339434 3300005518 Bacteria 656
125 Ga0070697_100032866 3300005536 Bacteria 4177
126 Ga0070697_100038604 3300005536 Bacteria 3859
127 Ga0070697_100065591 3300005536 Bacteria 2967
128 Ga0070697_100145983 3300005536 Unclassified 1991
129 Ga0070697_100423860 3300005536 Unclassified 1156
130 Ga0070697_100722206 3300005536 Bacteria 880
131 Ga0070697_100988943 3300005536 Bacteria 748
132 Ga0068853_101161066 3300005539 Unclassified 745
133 Ga0070672_100004759 3300005543 Bacteria 8906
134 Ga0070672_100034400 3300005543 Bacteria 3846
135 Ga0070672_100037824 3300005543 Bacteria 3684
136 Ga0070695_100025252 3300005545 Bacteria 3668
137 Ga0070696_100064022 3300005546 Unclassified 2576
138 Ga0070696_100905838 3300005546 Bacteria 732
139 Ga0070696_101042884 3300005546 Bacteria 685
140 Ga0070665_100014886 3300005548 Bacteria 7807
141 Ga0070665_100076732 3300005548 Bacteria 3348
142 Ga0070665_100166469 3300005548 Bacteria 2207
143 Ga0070665_100231360 3300005548 Bacteria 1848
144 Ga0070704_100119204 3300005549 Bacteria 2023
145 Ga0070704_100923720 3300005549 Bacteria 786
146 Ga0070704_101261955 3300005549 Unclassified 675
147 Ga0068855_100815701 3300005563 Bacteria 991
148 Ga0070664_100162584 3300005564 Bacteria 1976
149 Ga0068856_101273106 3300005614 Unclassified 751
150 Ga0068856_101415409 3300005614 Bacteria 710
151 Ga0070702_100160399 3300005615 Unclassified 1453
152 Ga0068852_102134453 3300005616 Bacteria 582
153 Ga0068864_100301298 3300005618 Bacteria 1501
154 Ga0068864_100324452 3300005618 Bacteria 1447
155 Ga0068866_10222985 3300005718 Unclassified 1138
156 Ga0068866_10253076 3300005718 Bacteria 1079
157 Ga0068858_100364170 3300005842 Bacteria 1386
158 Ga0068858_101601466 3300005842 Unclassified 643
159 Ga0081455_10001521 3300005937 Bacteria 28596
160 Ga0081455_10032183 3300005937 Bacteria 4730
161 Ga0081540_1008065 3300005983 Bacteria 7402
162 Ga0081540_1023222 3300005983 Bacteria 3635
163 Ga0081539_10000061 3300005985 Bacteria 250890
164 Ga0081539_10001104 3300005985 Bacteria 49011
165 Ga0081539_10009995 3300005985 Bacteria 7813
166 Ga0081539_10073148 3300005985 Bacteria 1829
167 Ga0070717_10005474 3300006028 Bacteria 9266
168 Ga0070717_10069243 3300006028 Unclassified 2938
169 Ga0070717_10096030 3300006028 Unclassified 2510
170 Ga0070717_10594621 3300006028 Unclassified 1004
171 Ga0070717_11249558 3300006028 Unclassified 675
172 Ga0070716_100027561 3300006173 Bacteria 3053
173 Ga0070716_100146437 3300006173 Bacteria 1513
174 Ga0070716_100403225 3300006173 Bacteria 984
175 Ga0070716_100784878 3300006173 Bacteria 736
176 Ga0070712_101030964 3300006175 Bacteria 713
177 Ga0097621_100007270 3300006237 Bacteria 7908
178 Ga0097621_100065637 3300006237 Unclassified 2988
179 Ga0097621_100200389 3300006237 Bacteria 1733
180 Ga0097621_100202914 3300006237 Bacteria 1722
181 Ga0097621_100336342 3300006237 Bacteria 1340
182 Ga0068871_100099117 3300006358 Bacteria 2439
183 Ga0068871_100146937 3300006358 Bacteria 2008
184 Ga0068871_101545625 3300006358 Bacteria 628
185 Ga0075428_100120877 3300006844 Unclassified 2852
186 Ga0075434_100267539 3300006871 Bacteria 1729
187 Ga0075434_100302327 3300006871 Bacteria 1620
188 Ga0068865_100028325 3300006881 Unclassified 3707
189 Ga0068865_100097958 3300006881 Bacteria 2142
190 Ga0068865_100609639 3300006881 Bacteria 924
191 Ga0075436_100252315 3300006914 Bacteria 1256
192 Ga0075435_101557064 3300007076 Unclassified 580
193 Ga0099794_10141757 3300007265 Bacteria 1217
194 Ga0099794_10225901 3300007265 Bacteria 962
195 Ga0105240_10205383 3300009093 Bacteria 2306
196 Ga0111539_10311502 3300009094 Bacteria 1832
197 Ga0111539_10498351 3300009094 Unclassified 1418
198 Ga0105245_10059835 3300009098 Bacteria 3431
199 Ga0105247_10232080 3300009101 Unclassified 1254
200 Ga0114129_10031857 3300009147 Bacteria 7453
201 Ga0114129_10444804 3300009147 Bacteria 1701
202 Ga0105241_10853346 3300009174 Unclassified 842
203 Ga0105242_10007333 3300009176 Bacteria 8488
204 Ga0105242_10310439 3300009176 Unclassified 1443
205 Ga0105242_10749758 3300009176 Bacteria 961
206 Ga0105248_11453825 3300009177 Bacteria 776
207 Ga0105237_10447970 3300009545 Bacteria 1297
208 Ga0105249_12221225 3300009553 Unclassified 622
209 Ga0099796_10332710 3300010159 Unclassified 651
210 Ga0105239_12580663 3300010375 Unclassified 592
211 Ga0105246_10296191 3300011119 Bacteria 1304
212 Ga0157321_1007129 3300012487 Bacteria 779
213 Ga0157327_1002849 3300012512 Unclassified 1230
214 Ga0157374_10017735 3300013296 Bacteria 6274
215 Ga0157374_10049758 3300013296 Bacteria 3894
216 Ga0157374_10085680 3300013296 Bacteria 2996
217 Ga0157374_10168974 3300013296 Bacteria 2132
218 Ga0157374_10458814 3300013296 Bacteria 1276
219 Ga0157374_10550694 3300013296 Bacteria 1161
220 Ga0157374_11475291 3300013296 Bacteria 703
221 Ga0157374_11830994 3300013296 Bacteria 632
222 Ga0157374_12170129 3300013296 Bacteria 582
223 Ga0157378_10034167 3300013297 Unclassified 4497
224 Ga0157378_10065134 3300013297 Bacteria 3261
225 Ga0157378_10111852 3300013297 Bacteria 2504
226 Ga0157378_10169445 3300013297 Bacteria 2047
227 Ga0157378_10210536 3300013297 Bacteria 1843
228 Ga0157378_10228056 3300013297 Unclassified 1773
229 Ga0157378_10228646 3300013297 Bacteria 1771
230 Ga0157378_10259731 3300013297 Bacteria 1666
231 Ga0157378_10262242 3300013297 Bacteria 1658
232 Ga0157378_10885600 3300013297 Bacteria 923
233 Ga0157378_10981598 3300013297 Bacteria 878
234 Ga0157378_11348060 3300013297 Bacteria 755
235 Ga0163162_10025675 3300013306 Bacteria 5824
236 Ga0163162_10227260 3300013306 Bacteria 1996
237 Ga0163162_10343672 3300013306 Unclassified 1625
238 Ga0163162_10545383 3300013306 Bacteria 1288
239 Ga0157372_10193155 3300013307 Unclassified 2358
240 Ga0157372_10529275 3300013307 Bacteria 1374
241 Ga0157375_10024632 3300013308 Bacteria 5573
242 Ga0157375_10033886 3300013308 Bacteria 4858
243 Ga0157375_10034150 3300013308 Bacteria 4843
244 Ga0157375_10058852 3300013308 Bacteria 3803
245 Ga0157375_10390092 3300013308 Unclassified 1559
246 Ga0157375_10965786 3300013308 Bacteria 993
247 Ga0157375_11291955 3300013308 Unclassified 858
248 Ga0163163_11076207 3300014325 Unclassified 867
249 Ga0157380_12866736 3300014326 Unclassified 549
250 Ga0182008_10411340 3300014497 Bacteria 728
251 Ga0157377_10171424 3300014745 Unclassified 1358
252 Ga0157377_10377074 3300014745 Bacteria 959
253 Ga0157376_10111305 3300014969 Bacteria 2410
254 Ga0157376_10246101 3300014969 Unclassified 1668
255 Ga0157376_10302814 3300014969 Bacteria 1514
256 Ga0157376_10387255 3300014969 Bacteria 1348
257 Ga0157376_11605439 3300014969 Bacteria 685
258 Ga0157376_13119844 3300014969 Bacteria 502
259 Ga0182007_10227250 3300015262 Bacteria 661
260 Ga0163161_10018151 3300017792 Unclassified 4932
261 Ga0163161_10280603 3300017792 Bacteria 1307
262 Ga0213876_10462191 3300021384 Bacteria 675
263 Ga0207673_1004905 3300025290 Bacteria 1615
264 Ga0207697_10000444 3300025315 Bacteria 23320
265 Ga0207697_10001023 3300025315 Bacteria 15666
266 Ga0207697_10028853 3300025315 Bacteria 2270
267 Ga0207653_10053762 3300025885 Unclassified 1345
268 Ga0207682_10031717 3300025893 Bacteria 2122
269 Ga0207642_10112619 3300025899 Unclassified 1388
270 Ga0207642_10275200 3300025899 Bacteria 966
271 Ga0207688_10009933 3300025901 Bacteria 5178
272 Ga0207688_10022887 3300025901 Unclassified 3420
273 Ga0207680_10005793 3300025903 Bacteria 5932
274 Ga0207680_10076645 3300025903 Bacteria 2089
275 Ga0207680_10303714 3300025903 Bacteria 1113
276 Ga0207680_10895192 3300025903 Bacteria 636
277 Ga0207685_10107978 3300025905 Bacteria 1201
278 Ga0207699_10023315 3300025906 Bacteria 3367
279 Ga0207645_10001285 3300025907 Bacteria 20617
280 Ga0207645_10026097 3300025907 Bacteria 3777
281 Ga0207645_10042020 3300025907 Unclassified 2926
282 Ga0207645_10047937 3300025907 Bacteria 2728
283 Ga0207645_10407409 3300025907 Bacteria 915
284 Ga0207684_10000361 3300025910 Bacteria 61371
285 Ga0207684_10006037 3300025910 Bacteria 11085
286 Ga0207684_10010162 3300025910 Bacteria 8288
287 Ga0207684_10014196 3300025910 Bacteria 6876
288 Ga0207684_10112645 3300025910 Bacteria 2329
289 Ga0207684_10152653 3300025910 Unclassified 1987
290 Ga0207684_10284704 3300025910 Bacteria 1425
291 Ga0207684_10807961 3300025910 Bacteria 792
292 Ga0207684_11109212 3300025910 Unclassified 658
293 Ga0207684_11324424 3300025910 Bacteria 592
294 Ga0207695_11430043 3300025913 Unclassified 572
295 Ga0207671_10544802 3300025914 Bacteria 925
296 Ga0207693_10086956 3300025915 Bacteria 2449
297 Ga0207693_10814113 3300025915 Unclassified 719
298 Ga0207663_10094235 3300025916 Unclassified 1995
299 Ga0207657_10241171 3300025919 Unclassified 1443
300 Ga0207646_10000115 3300025922 Bacteria 110424
301 Ga0207646_10001435 3300025922 Bacteria 29563
302 Ga0207646_10314322 3300025922 Bacteria 1415
303 Ga0207646_10341541 3300025922 Unclassified 1353
304 Ga0207681_10083155 3300025923 Bacteria 2265
305 Ga0207681_10126555 3300025923 Bacteria 1882
306 Ga0207681_10240765 3300025923 Unclassified 1408
307 Ga0207650_10028632 3300025925 Bacteria 3997
308 Ga0207650_10193965 3300025925 Bacteria 1624
309 Ga0207650_10835527 3300025925 Bacteria 781
310 Ga0207659_10037817 3300025926 Unclassified 3353
311 Ga0207659_10043476 3300025926 Bacteria 3155
312 Ga0207659_11125132 3300025926 Bacteria 675
313 Ga0207687_11598147 3300025927 Bacteria 559
314 Ga0207700_10277154 3300025928 Unclassified 1441
315 Ga0207664_10015216 3300025929 Bacteria 5578
316 Ga0207664_11382499 3300025929 Bacteria 624
317 Ga0207644_10018153 3300025931 Bacteria 4757
318 Ga0207644_10071555 3300025931 Unclassified 2537
319 Ga0207644_10245491 3300025931 Bacteria 1427
320 Ga0207690_11153621 3300025932 Bacteria 646
321 Ga0207706_10041283 3300025933 Bacteria 4090
322 Ga0207706_10121389 3300025933 Unclassified 2298
323 Ga0207686_10063032 3300025934 Bacteria 2356
324 Ga0207670_10235346 3300025936 Bacteria 1408
325 Ga0207669_10028446 3300025937 Bacteria 3075
326 Ga0207669_10029298 3300025937 Unclassified 3042
327 Ga0207669_10114364 3300025937 Bacteria 1816
328 Ga0207704_10078111 3300025938 Bacteria 2128
329 Ga0207704_10219873 3300025938 Bacteria 1405
330 Ga0207665_10028161 3300025939 Bacteria 3710
331 Ga0207665_10133731 3300025939 Bacteria 1763
332 Ga0207665_10168524 3300025939 Bacteria 1580
333 Ga0207691_10001851 3300025940 Bacteria 20664
334 Ga0207691_10003807 3300025940 Bacteria 14644
335 Ga0207691_10018166 3300025940 Bacteria 6662
336 Ga0207691_10048402 3300025940 Bacteria 3898
337 Ga0207689_11231303 3300025942 Unclassified 630
338 Ga0207679_10128100 3300025945 Bacteria 2032
339 Ga0207679_10446153 3300025945 Bacteria 1147
340 Ga0207651_10006741 3300025960 Bacteria 6049
341 Ga0207651_10105818 3300025960 Bacteria 2099
342 Ga0207651_10342622 3300025960 Bacteria 1256
343 Ga0207651_10626499 3300025960 Unclassified 942
344 Ga0207668_10013858 3300025972 Bacteria 4978
345 Ga0207668_10094626 3300025972 Unclassified 2203
346 Ga0207668_10176553 3300025972 Bacteria 1681
347 Ga0207668_11869704 3300025972 Unclassified 541
348 Ga0207658_10019466 3300025986 Bacteria 4695
349 Ga0207658_10159828 3300025986 Bacteria 1846
350 Ga0207658_10177413 3300025986 Unclassified 1760
351 Ga0207658_10199205 3300025986 Unclassified 1670
352 Ga0207658_11779080 3300025986 Bacteria 562
353 Ga0207658_11965129 3300025986 Bacteria 532
354 Ga0207677_10065796 3300026023 Bacteria 2531
355 Ga0207677_10073922 3300026023 Unclassified 2416
356 Ga0207677_10079580 3300026023 Bacteria 2344
357 Ga0207703_10356515 3300026035 Bacteria 1348
358 Ga0207703_10806147 3300026035 Unclassified 896
359 Ga0207678_10082389 3300026067 Bacteria 2753
360 Ga0207708_10337918 3300026075 Bacteria 1233
361 Ga0207708_11634031 3300026075 Bacteria 566
362 Ga0207702_10292400 3300026078 Unclassified 1544
363 Ga0207648_10477401 3300026089 Bacteria 1138
364 Ga0207676_10891702 3300026095 Unclassified 872
365 Ga0207683_10004604 3300026121 Bacteria 11885
366 Ga0207683_10049221 3300026121 Unclassified 3689
367 Ga0207683_10282575 3300026121 Unclassified 1516
368 Ga0207683_10293278 3300026121 Bacteria 1487
369 Ga0207683_11234350 3300026121 Bacteria 692
370 Ga0207698_11453646 3300026142 Bacteria 701
371 Ga0207428_10653615 3300027907 Bacteria 754
372 Ga0268266_10019922 3300028379 Bacteria 5716
373 Ga0268266_10032992 3300028379 Bacteria 4402
374 Ga0268266_10082421 3300028379 Unclassified 2806
375 Ga0268266_10105071 3300028379 Bacteria 2494
376 Ga0268266_10664471 3300028379 Bacteria 1003
377 Ga0268264_11671345 3300028381 Unclassified 647
378 Ga0373938_0095830 3300034957 Bacteria 740
379 Ga0373940_0035309 3300035088 Unclassified 1353
380 Ga0373951_0143045 3300035091 Bacteria 666
381 Ga0373923_0423746 3300035111 Bacteria 643
382 Ga0373936_0121577 3300035113 Bacteria 1116
383 Ga0373957_0097702 3300035120 Bacteria 1173
384 Ga0373946_0179951 3300035171 Bacteria 1003
385 Ga0373955_0003871 3300035172 Bacteria 6599
386 Ga0373942_0081071 3300035207 Bacteria 964
387 Ga0373931_0055075 3300035691 Unclassified 2127
388 Ga0373935_0033859 3300035692 Bacteria 3182
389 Ga0373935_0077364 3300035692 Bacteria 2156
390 Ga0373935_0092645 3300035692 Unclassified 1980
391 Ga0373935_0547028 3300035692 Unclassified 844
392 Ga0373927_0181884 3300035695 Bacteria 1379
393 Ga0373947_0026416 3300035725 Bacteria 3393
394 Ga0373947_0053027 3300035725 Bacteria 2445
395 Ga0373947_0070651 3300035725 Bacteria 2140
396 Ga0373947_0266651 3300035725 Bacteria 1136
397 Ga0373937_0006068 3300036401 Bacteria 10401
398 Ga0373937_0047009 3300036401 Bacteria 3948
399 Ga0373925_0008367 3300037068 Bacteria 7532
400 Ga0373925_0118427 3300037068 Unclassified 2053
401 Ga0373925_0351079 3300037068 Unclassified 1198
402 Ga0373925_0533256 3300037068 Bacteria 965
403 Ga0373925_0672675 3300037068 Bacteria 853
404 Ga0373925_0688012 3300037068 Unclassified 843
405 Ga0395899_0056258 3300037312 Bacteria 2908
406 Ga0395900_0007479 3300037418 Bacteria 11293
407 Ga0395900_0027545 3300037418 Bacteria 5822
408 Ga0395900_0624273 3300037418 Bacteria 1016
409 Ga0395900_0780520 3300037418 Bacteria 884
410 Ga0395898_0013491 3300037466 Bacteria 8412
411 Ga0395898_0212982 3300037466 Bacteria 1843
412 Ga0395898_0473874 3300037466 Unclassified 1191
413 Ga0395898_0593715 3300037466 Unclassified 1050
414 Ga0395898_1026253 3300037466 Bacteria 760
415 Ga0395905_0008443 3300037471 Bacteria 10156
416 Ga0436364_0089791 3300037853 Bacteria 967
417 Ga0436364_1329891 3300037853 Bacteria 3904
418 Ga0395901_0001270 3300038443 Bacteria 26753
419 Ga0395901_0028632 3300038443 Bacteria 5730
420 Ga0395901_0037856 3300038443 Bacteria 4988
421 Ga0395901_0199011 3300038443 Bacteria 2100
422 Ga0395901_0436498 3300038443 Bacteria 1341
423 Ga0395901_0798835 3300038443 Unclassified 933
424 Ga0436365_0435640 3300039437 Bacteria 677
425 Ga0451789_0757860 3300041443 Bacteria 532
426 Ga0451791_0724790 3300041451 Bacteria 652
427 Ga0451802_0741486 3300041460 Bacteria 559
428 Ga0451853_2292673 3300041512 Bacteria 675
429 Ga0439448_0194195 3300042005 Unclassified 711
430 Ga0466967_0166057 3300045976 Bacteria 2075
431 Ga0495651_0046006 3300046462 Bacteria 3379
432 Ga0495664_0588026 3300046477 Bacteria 662
433 Ga0495663_0160670 3300046525 Unclassified 771
434 Ga0495652_0021147 3300046529 Bacteria 5784
435 Ga0495640_0421381 3300046533 Unclassified 818
436 Ga0495598_0280142 3300046537 Bacteria 626
437 Ga0495659_0063511 3300046664 Unclassified 1369
438 Ga0495647_0038133 3300046681 Unclassified 1816
439 Ga0495647_0371339 3300046681 Unclassified 654
440 Ga0495658_0279985 3300046683 Bacteria 1052
441 Ga0495669_0080444 3300046684 Unclassified 1495
442 Ga0495604_0247668 3300047317 Bacteria 1216
443 Ga0495680_0142350 3300047322 Bacteria 1754
444 Ga0495675_0008247 3300047444 Bacteria 6446
445 Ga0495684_0034630 3300047471 Bacteria 3874
446 Ga0496100_0009688 3300048903 Bacteria 5419
447 Ga0496100_0365528 3300048903 Unclassified 1093
448 Ga0496101_0047030 3300048904 Bacteria 3096
449 Ga0496102_0002637 3300048905 Bacteria 15241
450 Ga0496102_1182617 3300048905 Bacteria 684
451 Ga0496104_0052465 3300048907 Unclassified 3852
452 Ga0496104_0263034 3300048907 Unclassified 1638
453 Ga0496104_0385476 3300048907 Bacteria 1314
454 Ga0496104_0401370 3300048907 Bacteria 1283
455 Ga0496104_0441767 3300048907 Bacteria 1213
456 Ga0496105_0047692 3300048908 Unclassified 3536
457 Ga0496105_0062706 3300048908 Bacteria 3068
458 Ga0496105_0582916 3300048908 Unclassified 870
459 Ga0496106_0194638 3300048909 Unclassified 1612
460 Ga0496107_0053736 3300048910 Unclassified 2905
461 Ga0496108_0161458 3300048911 Unclassified 1937
462 Ga0496108_0201784 3300048911 Bacteria 1726
463 Ga0496109_0077655 3300048912 Unclassified 3056
464 Ga0496109_0318768 3300048912 Bacteria 1467
465 Ga0496109_0349363 3300048912 Bacteria 1397
466 Ga0496109_0444384 3300048912 Bacteria 1225
467 Ga0496110_0790349 3300048913 Bacteria 853
468 Ga0496112_0015714 3300048915 Bacteria 7070
469 Ga0496112_0028618 3300048915 Bacteria 5380
470 Ga0496112_0075011 3300048915 Bacteria 3345
471 Ga0496112_0388732 3300048915 Bacteria 1335
472 Ga0496112_0389061 3300048915 Bacteria 1335
473 Ga0496112_0819515 3300048915 Unclassified 855
474 Ga0496112_1065038 3300048915 Bacteria 727
475 Ga0496112_1420927 3300048915 Unclassified 608
476 Ga0496113_0126424 3300048916 Unclassified 2002
477 Ga0496114_0080740 3300048917 Unclassified 2747
478 Ga0496114_1402282 3300048917 Bacteria 586
479 Ga0496115_0001208 3300048918 Bacteria 18530
480 Ga0496115_0002913 3300048918 Bacteria 12348
481 nmdc:mga05p37_1576182_c1 3300050507 Bacteria 649
482 nmdc:mga05p37_8732_c1 3300050507 Bacteria 11967
483 nmdc:mga08y16_307286_c1 3300050511 Bacteria 1633
484 nmdc:mga08y16_410522_c1 3300050511 Unclassified 1385
485 nmdc:mga0n895_293455_c1 3300050512 Bacteria 1648
486 nmdc:mga0n895_442307_c1 3300050512 Bacteria 1313
487 nmdc:mga0n895_490897_c1 3300050512 Bacteria 1238
488 nmdc:mga0rr50_822210_c1 3300050513 Bacteria 792
489 nmdc:mga08x19_15186_c1 3300050514 Bacteria 4682
490 nmdc:mga08x19_386069_c1 3300050514 Bacteria 981
491 Ga0495601_0012199 3300053077 Bacteria 5153
492 Ga0495612_0238399 3300053078 Unclassified 808
493 Ga0587073_0158312 3300059492 Bacteria 647
494 Ga0587106_044106 3300059605 Bacteria 768
495 Ga0587069_039130 3300059642 Bacteria 802
496 Ga0587079_042500 3300059647 Bacteria 924
497 Ga0587114_089636 3300059655 Bacteria 584
498 Ga0075436_100062987
499 SwRhRL2b_contig_809977
500 JGI24035J26624_1004428
501 JGI25406J46586_10000002
502 JGI25406J46586_10016698
503 JGI25406J46586_10067587
504 JGI25405J52794_10000193
505 JGI25405J52794_10117134
506 Ga0058860_11620987
507 Ga0065703_1018881
508 Ga0065712_10091959
509 Ga0065712_10155363
510 Ga0065712_10309657
511 Ga0065712_10440515
512 Ga0065715_10138946
513 Ga0065715_10242115
514 Ga0065715_11100686
515 Ga0070658_10462182
516 Ga0070676_10056713
517 Ga0070676_10677790
518 Ga0070676_10686156
519 Ga0070683_100087600
520 Ga0070690_100036368
521 Ga0070690_100560509
522 Ga0070690_100764763
523 Ga0070670_100015828
524 Ga0070670_100023748
525 Ga0070670_100033144
526 Ga0070670_100072563
527 Ga0070666_10003392
528 Ga0070666_10018705
529 Ga0070666_10033398
530 Ga0070666_10131619
531 Ga0068868_100068068
532 Ga0068868_100148599
533 Ga0070660_101131882
534 Ga0070689_100159126
535 Ga0070689_100708068
536 Ga0070687_101098173
537 Ga0070668_100010994
538 Ga0070668_100018383
539 Ga0070668_100035530
540 Ga0070669_100033392
541 Ga0070669_100046190
542 Ga0070669_100100590
543 Ga0070669_100223102
544 Ga0070669_100403746
545 Ga0070675_100026836
546 Ga0070675_100028758
547 Ga0070675_100035545
548 Ga0070675_100574791
549 Ga0070675_100881916
550 Ga0070671_100033630
551 Ga0070671_100040942
552 Ga0070671_100127951
553 Ga0070671_100240887
554 Ga0070674_100008908
555 Ga0070674_100026425
556 Ga0070674_100720508
557 Ga0070673_100014465
558 Ga0070673_100021407
559 Ga0070673_100079872
560 Ga0070673_101332475
561 Ga0070688_100017707
562 Ga0070659_101684966
563 Ga0070667_100021174
564 Ga0070667_100043603
565 Ga0070667_100151804
566 Ga0070667_100177340
567 Ga0070667_100699961
568 Ga0070667_101488592
569 Ga0070703_10328688
570 Ga0070709_11026334
571 Ga0070714_100286273
572 Ga0070714_101464847
573 Ga0070714_102031091
574 Ga0070713_101604150
575 Ga0070711_100324104
576 Ga0070711_100328710
577 Ga0070705_100196212
578 Ga0070705_100679610
579 Ga0070700_100137712
580 Ga0070700_100259393
581 Ga0070700_101604191
582 Ga0070708_100020966
583 Ga0070708_100027395
584 Ga0070708_100234176
585 Ga0070708_100971266
586 Ga0070708_101547520
587 Ga0070663_100833239
588 Ga0070678_100001802
589 Ga0070678_100028152
590 Ga0070678_100093058
591 Ga0070678_101329945
592 Ga0070662_100532739
593 Ga0068867_100076058
594 Ga0070706_100000286
595 Ga0070706_100003298
596 Ga0070706_100027832
597 Ga0070706_100097706
598 Ga0070706_100107424
599 Ga0070706_100140746
600 Ga0070706_100222104
601 Ga0070706_100311122
602 Ga0070706_100719628
603 Ga0070706_100915881
604 Ga0070706_101236241
605 Ga0070707_100002233
606 Ga0070707_100094922
607 Ga0070707_100155382
608 Ga0070707_100394154
609 Ga0070707_100450499
610 Ga0070707_100608769
611 Ga0070707_100630410
612 Ga0070707_100675411
613 Ga0070698_100001957
614 Ga0070698_100020545
615 Ga0070698_100181446
616 Ga0070698_100361323
617 Ga0070698_101074841
618 Ga0070698_101599698
619 Ga0070699_100019406
620 Ga0070699_101081505
621 Ga0070699_101339434
622 Ga0070697_100032866
623 Ga0070697_100038604
624 Ga0070697_100065591
625 Ga0070697_100145983
626 Ga0070697_100423860
627 Ga0070697_100722206
628 Ga0070697_100988943
629 Ga0068853_101161066
630 Ga0070672_100004759
631 Ga0070672_100034400
632 Ga0070672_100037824
633 Ga0070695_100025252
634 Ga0070696_100064022
635 Ga0070696_100905838
636 Ga0070696_101042884
637 Ga0070665_100014886
638 Ga0070665_100076732
639 Ga0070665_100166469
640 Ga0070665_100231360
641 Ga0070704_100119204
642 Ga0070704_100923720
643 Ga0070704_101261955
644 Ga0068855_100815701
645 Ga0070664_100162584
646 Ga0068856_101273106
647 Ga0068856_101415409
648 Ga0070702_100160399
649 Ga0068852_102134453
650 Ga0068864_100301298
651 Ga0068864_100324452
652 Ga0068866_10222985
653 Ga0068866_10253076
654 Ga0068858_100364170
655 Ga0068858_101601466
656 Ga0081455_10001521
657 Ga0081455_10032183
658 Ga0081540_1008065
659 Ga0081540_1023222
660 Ga0081539_10000061
661 Ga0081539_10001104
662 Ga0081539_10009995
663 Ga0081539_10073148
664 Ga0070717_10005474
665 Ga0070717_10069243
666 Ga0070717_10096030
667 Ga0070717_10594621
668 Ga0070717_11249558
669 Ga0070716_100027561
670 Ga0070716_100146437
671 Ga0070716_100403225
672 Ga0070716_100784878
673 Ga0070712_101030964
674 Ga0097621_100007270
675 Ga0097621_100065637
676 Ga0097621_100200389
677 Ga0097621_100202914
678 Ga0097621_100336342
679 Ga0068871_100099117
680 Ga0068871_100146937
681 Ga0068871_101545625
682 Ga0075428_100120877
683 Ga0075434_100267539
684 Ga0075434_100302327
685 Ga0068865_100028325
686 Ga0068865_100097958
687 Ga0068865_100609639
688 Ga0075436_100252315
689 Ga0075435_101557064
690 Ga0099794_10141757
691 Ga0099794_10225901
692 Ga0105240_10205383
693 Ga0111539_10311502
694 Ga0111539_10498351
695 Ga0105245_10059835
696 Ga0105247_10232080
697 Ga0114129_10031857
698 Ga0114129_10444804
699 Ga0105241_10853346
700 Ga0105242_10007333
701 Ga0105242_10310439
702 Ga0105242_10749758
703 Ga0105248_11453825
704 Ga0105237_10447970
705 Ga0105249_12221225
706 Ga0099796_10332710
707 Ga0105239_12580663
708 Ga0105246_10296191
709 Ga0157321_1007129
710 Ga0157327_1002849
711 Ga0157374_10017735
712 Ga0157374_10049758
713 Ga0157374_10085680
714 Ga0157374_10168974
715 Ga0157374_10458814
716 Ga0157374_10550694
717 Ga0157374_11475291
718 Ga0157374_11830994
719 Ga0157374_12170129
720 Ga0157378_10034167
721 Ga0157378_10065134
722 Ga0157378_10111852
723 Ga0157378_10169445
724 Ga0157378_10210536
725 Ga0157378_10228056
726 Ga0157378_10228646
727 Ga0157378_10259731
728 Ga0157378_10262242
729 Ga0157378_10885600
730 Ga0157378_10981598
731 Ga0157378_11348060
732 Ga0163162_10025675
733 Ga0163162_10227260
734 Ga0163162_10343672
735 Ga0163162_10545383
736 Ga0157372_10193155
737 Ga0157372_10529275
738 Ga0157375_10024632
739 Ga0157375_10033886
740 Ga0157375_10034150
741 Ga0157375_10058852
742 Ga0157375_10390092
743 Ga0157375_10965786
744 Ga0157375_11291955
745 Ga0163163_11076207
746 Ga0157380_12866736
747 Ga0182008_10411340
748 Ga0157377_10171424
749 Ga0157377_10377074
750 Ga0157376_10111305
751 Ga0157376_10246101
752 Ga0157376_10302814
753 Ga0157376_10387255
754 Ga0157376_11605439
755 Ga0157376_13119844
756 Ga0182007_10227250
757 Ga0163161_10018151
758 Ga0163161_10280603
759 Ga0213876_10462191
760 Ga0207673_1004905
761 Ga0207697_10000444
762 Ga0207697_10001023
763 Ga0207697_10028853
764 Ga0207653_10053762
765 Ga0207682_10031717
766 Ga0207642_10112619
767 Ga0207642_10275200
768 Ga0207688_10009933
769 Ga0207688_10022887
770 Ga0207680_10005793
771 Ga0207680_10076645
772 Ga0207680_10303714
773 Ga0207680_10895192
774 Ga0207685_10107978
775 Ga0207699_10023315
776 Ga0207645_10001285
777 Ga0207645_10026097
778 Ga0207645_10042020
779 Ga0207645_10047937
780 Ga0207645_10407409
781 Ga0207684_10000361
782 Ga0207684_10006037
783 Ga0207684_10010162
784 Ga0207684_10014196
785 Ga0207684_10112645
786 Ga0207684_10152653
787 Ga0207684_10284704
788 Ga0207684_10807961
789 Ga0207684_11109212
790 Ga0207684_11324424
791 Ga0207695_11430043
792 Ga0207671_10544802
793 Ga0207693_10086956
794 Ga0207693_10814113
795 Ga0207663_10094235
796 Ga0207657_10241171
797 Ga0207646_10000115
798 Ga0207646_10001435
799 Ga0207646_10314322
800 Ga0207646_10341541
801 Ga0207681_10083155
802 Ga0207681_10126555
803 Ga0207681_10240765
804 Ga0207650_10028632
805 Ga0207650_10193965
806 Ga0207650_10835527
807 Ga0207659_10037817
808 Ga0207659_10043476
809 Ga0207659_11125132
810 Ga0207687_11598147
811 Ga0207700_10277154
812 Ga0207664_10015216
813 Ga0207664_11382499
814 Ga0207644_10018153
815 Ga0207644_10071555
816 Ga0207644_10245491
817 Ga0207690_11153621
818 Ga0207706_10041283
819 Ga0207706_10121389
820 Ga0207686_10063032
821 Ga0207670_10235346
822 Ga0207669_10028446
823 Ga0207669_10029298
824 Ga0207669_10114364
825 Ga0207704_10078111
826 Ga0207704_10219873
827 Ga0207665_10028161
828 Ga0207665_10133731
829 Ga0207665_10168524
830 Ga0207691_10001851
831 Ga0207691_10003807
832 Ga0207691_10018166
833 Ga0207691_10048402
834 Ga0207689_11231303
835 Ga0207679_10128100
836 Ga0207679_10446153
837 Ga0207651_10006741
838 Ga0207651_10105818
839 Ga0207651_10342622
840 Ga0207651_10626499
841 Ga0207668_10013858
842 Ga0207668_10094626
843 Ga0207668_10176553
844 Ga0207668_11869704
845 Ga0207658_10019466
846 Ga0207658_10159828
847 Ga0207658_10177413
848 Ga0207658_10199205
849 Ga0207658_11779080
850 Ga0207658_11965129
851 Ga0207677_10065796
852 Ga0207677_10073922
853 Ga0207677_10079580
854 Ga0207703_10356515
855 Ga0207703_10806147
856 Ga0207678_10082389
857 Ga0207708_10337918
858 Ga0207708_11634031
859 Ga0207702_10292400
860 Ga0207648_10477401
861 Ga0207676_10891702
862 Ga0207683_10004604
863 Ga0207683_10049221
864 Ga0207683_10282575
865 Ga0207683_10293278
866 Ga0207683_11234350
867 Ga0207698_11453646
868 Ga0207428_10653615
869 Ga0268266_10019922
870 Ga0268266_10032992
871 Ga0268266_10082421
872 Ga0268266_10105071
873 Ga0268266_10664471
874 Ga0268264_11671345
875 Ga0373938_0095830
876 Ga0373940_0035309
877 Ga0373951_0143045
878 Ga0373923_0423746
879 Ga0373936_0121577
880 Ga0373957_0097702
881 Ga0373946_0179951
882 Ga0373955_0003871
883 Ga0373942_0081071
884 Ga0373931_0055075
885 Ga0373935_0033859
886 Ga0373935_0077364
887 Ga0373935_0092645
888 Ga0373935_0547028
889 Ga0373927_0181884
890 Ga0373947_0026416
891 Ga0373947_0053027
892 Ga0373947_0070651
893 Ga0373947_0266651
894 Ga0373937_0006068
895 Ga0373937_0047009
896 Ga0373925_0008367
897 Ga0373925_0118427
898 Ga0373925_0351079
899 Ga0373925_0533256
900 Ga0373925_0672675
901 Ga0373925_0688012
902 Ga0395899_0056258
903 Ga0395900_0007479
904 Ga0395900_0027545
905 Ga0395900_0624273
906 Ga0395900_0780520
907 Ga0395898_0013491
908 Ga0395898_0212982
909 Ga0395898_0473874
910 Ga0395898_0593715
911 Ga0395898_1026253
912 Ga0395905_0008443
913 Ga0436364_0089791
914 Ga0436364_1329891
915 Ga0395901_0001270
916 Ga0395901_0028632
917 Ga0395901_0037856
918 Ga0395901_0199011
919 Ga0395901_0436498
920 Ga0395901_0798835
921 Ga0436365_0435640
922 Ga0451789_0757860
923 Ga0451791_0724790
924 Ga0451802_0741486
925 Ga0451853_2292673
926 Ga0439448_0194195
927 Ga0466967_0166057
928 Ga0495651_0046006
929 Ga0495664_0588026
930 Ga0495663_0160670
931 Ga0495652_0021147
932 Ga0495640_0421381
933 Ga0495598_0280142
934 Ga0495659_0063511
935 Ga0495647_0038133
936 Ga0495647_0371339
937 Ga0495658_0279985
938 Ga0495669_0080444
939 Ga0495604_0247668
940 Ga0495680_0142350
941 Ga0495675_0008247
942 Ga0495684_0034630
943 Ga0496100_0009688
944 Ga0496100_0365528
945 Ga0496101_0047030
946 Ga0496102_0002637
947 Ga0496102_1182617
948 Ga0496104_0052465
949 Ga0496104_0263034
950 Ga0496104_0385476
951 Ga0496104_0401370
952 Ga0496104_0441767
953 Ga0496105_0047692
954 Ga0496105_0062706
955 Ga0496105_0582916
956 Ga0496106_0194638
957 Ga0496107_0053736
958 Ga0496108_0161458
959 Ga0496108_0201784
960 Ga0496109_0077655
961 Ga0496109_0318768
962 Ga0496109_0349363
963 Ga0496109_0444384
964 Ga0496110_0790349
965 Ga0496112_0015714
966 Ga0496112_0028618
967 Ga0496112_0075011
968 Ga0496112_0388732
969 Ga0496112_0389061
970 Ga0496112_0819515
971 Ga0496112_1065038
972 Ga0496112_1420927
973 Ga0496113_0126424
974 Ga0496114_0080740
975 Ga0496114_1402282
976 Ga0496115_0001208
977 Ga0496115_0002913
978 nmdc:mga05p37_1576182_c1
979 nmdc:mga05p37_8732_c1
980 nmdc:mga08y16_307286_c1
981 nmdc:mga08y16_410522_c1
982 nmdc:mga0n895_293455_c1
983 nmdc:mga0n895_442307_c1
984 nmdc:mga0n895_490897_c1
985 nmdc:mga0rr50_822210_c1
986 nmdc:mga08x19_15186_c1
987 nmdc:mga08x19_386069_c1
988 Ga0495601_0012199
989 Ga0495612_0238399
990 Ga0587073_0158312
991 Ga0587106_044106
992 Ga0587069_039130
993 Ga0587079_042500
994 Ga0587114_089636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

8

136

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.868 62 131
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.853 61 124
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.826 62 131
1vdm-assembly1.cif.gz_I crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.8126 97 132
1vdm-assembly1.cif.gz_L crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.7998 97 132
ID Description Score Start End Superfamily
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.853 61 124 3.30.420.270
4evwA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7774 97 132 3.90.550.10
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7572 99 134 3.40.50.2020
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7409 61 124 3.30.420.270
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7347 99 134 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A349WI13-F1-model_v4 Biopolymer transporter ExbD 0.8311 47 132 GO:0005886
GO:0015031
GO:0022857
AF-A0A3M5C5Y2-F1-model_v4 deleted 0.8253 47 132
AF-A0A2E6S8U8-F1-model_v4 Biopolymer transporter ExbD 0.8194 41 133 GO:0005886
GO:0015031
GO:0022857
AF-A0A7Z9Q4R5-F1-model_v4 deleted 0.8139 47 132
AF-A0A349WI13-F1-model_v4 Biopolymer transporter ExbD 0.8129 47 132 GO:0005886
GO:0015031
GO:0022857

Map